ELF( H44 ($#pxxx$$QtdRtd<<GNU% i3cȧz-u xa׃ \%˒bsPT`'6lG"D!@RhA @@ J1B(OHEPdB(8`,`A)A@L$B"    "$%&(*+,.123456:;<=ABCDEGHIJLMPQRTUVWYZ[\]_ceghkmortua wiiSV|JL383~j#sVqִQmO2{gN`#U$h%ZM/<iB1:P Kj#TFDO&f8N蟫S^8 vy`!v%)(ufzFAP0TԼ'W9NO$hHH90nx\`ԯ{fE*uQ$~Uoc2:Fa2q܎# &! Y"8cU_jg0pOvӴwM|_&Jm$z/a"hn~]}8Bpʴ p?&.opFF\|qV xR%yCc,o%h̺*:PV1xsr'I 0A"4|˷TA\R(a9L?"?~G3F[Ddr'GGN/C<5i(ָ˽5뚇9Y~5s YۚBXPu yɑhҟcN lYn*B1C3f*-9T਋Cc'J%s djDyFZ<qIc=   n#H$F" ;  u Bs (S  9:X  s"h N s 7 7P K  Hu.( k r\W Pk0T8   i 07U  KjB0 N )qG S~@:  _ '  Tn0   ~Ft !1 A wS8,I  h , Ue #d ; `t  h dQx H < D x X_X 7l0 -T $ 6 M psl "|iX dDI L JH < ' n 8` P [ذ TP , T $L jg@ M4 0N` 8LD 8T 0 @K T M  kL fT ^pa  $rL I] Ȩ 9 ȋ q(  ( tLO A|N a @L  | | jD $q` LT J [D hm Z Lz n 8 Pe `(T@ IiX DD [D TZH _ ^ iL d j < J,dT H u( <@W8 lH &<0 xV hP RaP v P  $  ~j XY   AԢD &  XL k4 q  P  ,gH z$hd X 1 pv \@ # , Л i(Y0  u i D{X _@j@ ZXP  P ~( D} d P  Ј rd P4  0 bT s i  z8l T h,  ?@ABC D$E(,F0G4>8H<I@JDKHLLPMTNXO\`PdQhRlSpTtUx|VWXYZ[\]S^_`acdefghijkmnopqrstuvwx yZz{| }$~(,0488<@DHLPTX\`dhlptx|j B $(,04 8<@DHLPTX\`dhlp@-- Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌX0 0 R/Ї,,00S 00/ 0S//ဋ|x88A, ?A /00S//<8PL0L 0 0S/80@-0S (0Q0 0 tC-4M0 c먀0` p000 000 0p dC \@PJ|u p4Ѝ D4mm0@-M@IP P SP P  LP3Ѝ0KЍ0XlC-,M0널0 `` `p000@fP1u ,Ѝ lC-,M0뜀0PUY`p00 000 00p@6Pu p,Ѝ8lRA-R ^/G-p'u `@PPP 0W@t@`@HU@0 1d bp@-PP @Pp@A-`L@P@`qpa4jA-pl@`@Pipe`T iwAiA-`L@P@J`9pY])diA-p|@`@P1p-` }H0<  i@-@_@t `hC-,M0뜀0PUY`p00 000 00p@3Pu p,Ѝ,8h@-O-KM3 sp@T 0 0# 0$0`00d0 0h0$0l0X000D00H0 0L0808\ X0PKߍP `PPPx  R (0\pV U `Y`(PU 220O000400000pY0,0p#00 ,`0`4``嘠j  50P41 ,01 0,x 0, 000,00 ,04  ,0$0$0 0! P 0U0E @TSQq Q Q  R  0 0 0S S Sx00x0001|00000010x00x0x00x0KߍPG`?(P\ll@-M @P eڍTc1p@-@0MPU=  0`  000 0! 000 00$0 0(0`A0S!  0S =00000S S00 000 0`0Ѝp(C-MM`P" 0u~@PP@70080E 0<0E00E 0$0E@9T0<7 <P ݍЍ@PP4Eu~ '0@-'M KN p0@`  $$$$ |404t-;㰀0: k`VqnJ404$ pRݍ0ЍXy4|_0p@-@(MPU ` 0  0 H 0000D00      `(Ѝp*{@-@P lP @?@-P @70p@-@0MWPU+  `0  0!0 0000 0 0$0`00r  00000?s0000 0 0`0Ѝpzp@-P@:P 6P _P p@@-M@&P 0?sVP Ѝ@@-@                     R   - M  E P Ѝ\- M  P Ѝ[01A-@XMPU> 0`0000000000,p0,00 `0000p040 008000<00 0@00 0$0L0p@ zJ 00   `XЍ# "O\wZp@-@ 0S /BPRp 0f p@gPHp@\C-@QDMPA{!D ` i 0X0 @P p0`X"0 !DЍ40 <0@`P p0u,up@-P@"P P h 0 `@4p p( ' YXX@-@P p   hXTXA-Pt`~@P(pw @XC-,M0널0 `` `p000Q@Pu ,Ѝ @sW0@-TM|0}@T 00P000000 0<0P 840 0 PTЍ0rA-P0P@`0 S0P%  00 0 00 0000?0 p00kPP&0S FP  P5P 000 0000 000?0   $P[<[D1G-@(MPXF 0`0U0`` `04pW, W W z  aU` 0ES d!L g000?s0000(Ѝ2(ЍjpZ-LM@0 P P _LЍS@-  @-.@C-,M0널0 `` `p0005@P{u ,Ѝ un\S A-@Mp`PU+ 000 0 0`000`Kp00(@T07 @Jt  :@@@  `Ѝ 8(nQ@-@M  jp Ѝ!Q@-xM@ p 0: S  S :C:SxЍ=xЍ 0  p 0SxЍp@-@MPUp@5  Pp@-@;PUp@  |P@-@)@t PP@-@M w @t ЍO@-@4 P'p  O0 00P g@-000P$ 0P @@f-MM+ ۍЍ@-xM@p0 02p  JxЍSN@-T@-xM@p0 0p  /xЍ8TN- M z[kz{  0 Ѝ.A@-@l@-#PA-8M(1 @T= 0 000000$00(0 0,0 ` PR0S 0 c 00gpw 8Ѝ00;Bp~ hO@N@-pp |L@-R< MPL/J0 0 Q:!"3c0? 00 0%@t  Ѝ000 @00 0 p 0S 00 t000XKp@-MP@`t0@0 ?@PVut T0Ѝp M K%$KJJ0@-PM@@ T 0P@+tu Ѝ0@8 $tJ JO-M `t0 P"%%UB2 ER0ʠU @`FR U r [ 8@0P` 0pQ "0w a!0sR0 0sE @ Q00%:+0000V@ 0 ЍX  `v@,00[00  0 p0S 0 pQ 0!@Q  0 0 SV }t0` 0p 8 0w ai( aIH@H(HGDG- M  Ѝ0@-P M@U Ѝ0 @D Ѝ0@C-4M$1  * PU: 0p000X00` 000 ` 00$0p<@ G `k @4t p4Ѝ4000S  Ta]FF(F- MP p q00000000 Ѝ(FC-M,MpP(@`V 0P #0000$0D0U (Pu $ ؍,ЍM _`E@-=@-M M@8 0`|Pp} R@(  @~t ؍ Ѝ x==C-MM@80`S80p P ! R( | p@Jt ؍Ѝ D<P<- M  Ѝ400@-p  )0<;0@-M@ J k{P{z  L0S o%@t Ѝ0eAx;A-``P`0P 0@q@ P<w0p P;@-`P0P 0 M@q@ 0Pdw<p X00000000 ЍLPx:C-pu 4Ѝ  8F.8@-0D @|p@@@T./ 00/-1@-`0MPp0   00000 0 0$0000 000S@ U  P0000}     UD@P @$PDD,D.,- M@ p@-P@Pp $00/ 0/?p@-`P @0p  *ppp@-`P @p  pp@--h1LM  r(0L` p00000,0 0400800<0(p@@00@ 00S ^@PL~u pLЍ@@I 5k@kj { H {z*{{z  ,.AtB,L+O-M,M pP(`Y4 0P #$ F0U0p00 (XPEUp$U ( X f@t([ AoQ ؍,Ѝ@*G-0M  0X<     0 ` $  ( P , ʠp@`P   p P0P0@DTʠ0ЍU@ @DOoB@T=?(A-M(Mp`y(@PU' 0`\ `#$ D0000 `؍(Ѝ$\ (X j @\t `؍(Ѝ T> (@-G-(M0`p8@T 0  000 7PVW(V`$Vv (Ѝ ='C-,M0 @T 0 p000p pP^`)v ,Ѝ <'@-,M0@T  p0P00pP P0`V 50  p,Ѝx  <%p@-PU@  00 \p P'p( p%%|%p@-@P@t p(%p@-@P` @}t pz$@-@ p +p e$@-@ p +p PP$ @-L$ @-($ ?@-@ 0p@-``PP$p@ P 000S p000S T pHD0003/T$:5#D#p@-@PX ?=@t p,#@-@MA 0&@t Ѝ"@-l@-O@- 0p@-@0MPU/  0`  00 0!000 0 0$0`[0S U0 0 -      `0Ѝp 006l7!p@-PP 0@0P p@0S CrP!p@-P0@0P p@0S /^ !p@-P0S*p@ Pp@ JT`  EA0 A00R0dpU ^ +X %L 4 @- P @ @-1p@-@8MPU>  0`  0!0 0000$00(0 0,0000040`000 0r            `8Ѝpv4p@-PP 0@0{P p@0S p@-P0@0P p@0S p@@-p@-@PP p p d 0@- M@ n{k{zZ 0 {:zSP"0#P%0% Ѝ0.A@Bp@-@-zkz{ P 0ejzk{  0]p.A0@-@,MP_Y@0@0P p ,Ѝ0 )D0@-0M @p Ѝ 8@-@ p C-,M0@T# 0☐00 0 0 p0 00`pVgP>`v ,Ѝ~ `0p@-P`@`p p0S C-,M0@T 0 p000p pNPl`V $`,Ѝ9 ! RP= P(!  1p: 0PS @0Ȁ0 p+ @Ѝ0 bR\0!000 A 1 0 0 0@T D  1,@0D8T@-p @-p 400@-p  X`8001@-fp  X @-0A-@(MPx T p`  B PP@@@  `(Ѝ\ 3P u R 000ETu"@-M@@t Ѝ:@-@TM @&t Ѝ  < Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/P<Q @-@A/SRQP)M`-QS&Ѝ /pSЍ p r0/ r0Ѝ p/ r0 Ѝ r0/@-PC-3` P1;:Soo Qo o N NΠ pnȌ2nj.P 03 P1:PX9W ^ 0?@ P  @T P *@T0P11>0YPV @-:= ==$=2==== = =#==&==== =accessinet_addr_of_stringchdirchmodexecvexecveexecvpexecvpefsyncmkdirgetcwdgmtimelocaltimemktimeputenv=unsetenvrenamermdirstring_of_inet_addrunlinkacceptbindin_channel_of_descrout_channel_of_descrcloseconnectdupgetpeernamegetsocknamelistenlockflseekUnix.map_file: bad number of dimensionsUnix.map_file: negative dimensionmap_fileUnix.map_file: file position exceeds file sizeUnix.map_file: file size doesn't match array dimensionsopen@pipereadread_bigarrayreadlinkrealpathselectrecvrecvfromsendsendtoshutdownsleepsocket socketpairsetsockoptsetsockopt_intsetsockopt_optintsetsockopt_floatsetsockopt_errorgetsockoptgetsockopt_intgetsockopt_optintgetsockopt_floatgetsockopt_error   )statlstatfstat@ `symlinktruncateUnix.Unix_errorException Unix.Unix_error not initialized, please link unix.cma  #!$% &' " srXYZ[\]^_`abcdefghijklmnopq(Kutimeswritewrite_bigarraysingle_writechownchrootclosedirdup2fchmodfchownset_nonblockclear_nonblockset_close_on_execUnix.fork may not be called after any domain has been spawnedforkftruncategetgrnamgetgrgidgetgroupsgetlogingetpwnamgetpwuidinitgroupssetitimergetitimerkillmkfifoniceopendirreaddirrewinddirsetgidsetgroupssetsidsetuidsigprocmasksigpendingsigsuspendsigwaitcreate_processtcgetattrtcsetattrtcsendbreaktcdraintcflushtcflow @0 0@@     @  2Kn,X   `  %K @B  `  %& -g5 =waitwaitpid:= ==$=2==== = =#==&==== =@IHxp$4H\̺ܺ = o8d  658o4oo1o==========================================================================================================================================================================================================================\]GCC: (Raspbian 10.2.1-6+rpi1) 10.2.1 20210110A,aeabi"6  "DI J JG@K LT\!XL$h 9I =?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  AZ` T Ceh  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B - "T EZ} F, G Ht8%T` 4 ~ Z   k &I6 22& $ 5 5end 5 5ptr 5 a 5G$ 5 5 73 8  9  : . <9 <9end <9 <9ptr <9 a <9G$ < <d >t ? mem @ max A R C Cend C Cptr C a CG$ C C? =z,  =)& T53DI 63'#33&$5 ;9O5SQ5k@5%p6 jfret7%[7 %B`I I # PPQxI I I I Z PtQI I w Pt J Px !pp l !G! !"?? !>> !tt S! j 5 dJintF8&A(H*,K:]p|P]%l[:;& &  { /!]\ ] m } m , } ,  ,S  / gJ| s4 ^C\ D`DJ|P2QtRT`J|9P:QtRXpJMPXJPu(JrPtJ  :  TBB Pq b 3 A dJOint8F/,?KpP]%O`8l- mO,uA#a*[:;y>h 4 D8?  "  [       "  %  ( (  +0  .8  2@  6H  9P  =X  AU` T C`h  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?   l  .  _  >  R      %(  0  8 id %@ %H   P X  ` / h  p  x   u      A    &       %       Y    B (   "   T EU} F' G Ho8  T [ 4 ~ Z   f         &D6 22! $ 5 5end 5 5ptr 5 a 5G$ 5 5  73 8  9  : . <4 <4end <4 <4ptr <4 a <4G$ < < d >o ? mem @ max A R C Cend C Cptr C a CG$ C C :8z]  J# U &  # ,*ODBI f@m %p ) [Wret%}y0$ J/ J8 PPQyJD JP K\ Pt Ki Ku  Pt8K Py   pp l   !g g  >>  tt S  j 3 ;d@Kint/,bFK3VP]OO`3l- mOuAy#wa*[:;y>h 4 D3?  "  [       "  %  ( (  +w0  .8  2@  6H  9P  =X  AU` T C`h  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?   l  .  _  >  R      O(  0  8 id O@ OH   P X  ` / h  p  x   u      A    &       O       Y    B (   "   T EU} F' G Ho8  T [ 4 ~ Z   f         &D6 22! $ 5 5end 5 5ptr 5 a 5G$ 5 5  73 8  9  : . <4 <4end <4 <4ptr <4 a <4G$ < < d >o ? mem @ max A R C Cend C Cptr C a CG$ C C :3z  @KQ 6&  2 Q Of@Op W ret!O=9 "O_[H* \K] Kf PPQxKr K~ K # PtQuK K @ PtK Px   pp l   !  >>  tt S  jU3 dLTint%FKP]%O`1l~- m[:;& &  LTRn#%tbl1RG$:%R D%S ` i %?9 ,O dXL intFKrP]%O`,l~- m,  ~ 2   Y uAr y& +[:; <y>z (M4 v(,rj i*% $M Pt Qu   ppl r  3 ttS s j  dM1 intFKP]%O`,ly- muAr[:;z ME6'_[ 3}env? E E  K  MQ Pu Qt M] Pw Qt M] Pv Qt Mi Pu Mu Px Qw Rv M Px N Pw N. Pv N Pt Qu K ppl  r  ' ttS s j  S dN4 intFKP]3O`%ly- muA:[:;z .|N]6.(1- .4UOenv.@ 0] 1] 2 c err33 Nt Pu Qt N Pw Qt N Pv Qt N Pu N Px Qw Rv N N N, Pw N@ PvO Px Qt RucB N`t6'2. 3VP ]  c 8Nt Pu Qt DN Pv Qt PN Pu \N5 Pw Qv dNI Pw lN] PvxN Pt Quppl  r) ) N 1 1 % ttS s " " hL L B j  l d O@ intFKP]%O`,ly- m[:;& & \  O@cv&ret%fd!% Oc OoJ Pt1&(O| HO Q0  f f  >>  j q  dLOhint/,bFK3VP]OO`3l- mOuAy#wa*[:;y>h 4 D3?  "  [       "  %  ( (  +w0  .8  2@  6H  9P  =X  AU` T C`h  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?   l  .  _  >  R      O(  0  8 id O@ OH   P X  ` / h  p  x   u      A    &       O       Y    B (   "   T EU} F' G Ho8  T [ 4 ~ Z   f         &D6 22! $ 5 5end 5 5ptr 5 a 5G$ 5 5  73 8  9  : . <4 <4end <4 <4ptr <4 a <4G$ < < d >o ? mem @ max A R C Cend C Cptr C a CG$ C C :3zt  LOQ 6& k g  2  Q O f@Op W ret!O  "O  * ; 9 hO] Of PPQxOr O~ O # PtQuO O @ PtP Px   pp l   !~ ~ = >>  tt S  j"q dP iintFKP]%O`,ly- m[:;& &  P n%S O PPP1& [ e dP 1int?F8&`(8*1/,RKKJ 1:uP]?O`1l- m O%#a*[: ;h z [ 1?  " D [ D  K  K  "K  %K  (V(  +0  .8  2a@  6gH  9KP  =KX  Ar` T C}h  F"p  I"x e L"  P" $ T" 7 ["  ` r" f tN g w"  y  {  }      ? [ l  . " _ " > " R "     ?(  .0  8id ?@ ?H  [P X  ` / "h  "p  x   u      A "  " & "    "  ?       Y  & K B n& [Q"\VmTx 4 ~ Z  K A&  ! &6 22E, K[ 1L  8  h7  K 1  n h   K 1k {  ! wE\ E U e U 1 e 1 u 1S    h  z A  ` 1 5 h@  ^ Ru  p0s 1t\29 3V 5J :[ 5 7?} 8?n 9? :?  ; [) <E= 1 > t F   "  # !<[P   <,[x t ' <9[ ? O>, "  >} >?s o  ?[}v?[}e?[} ?~c??  @ ( @  A~resB }C?( " P F[S Q xQ| rx m g ! Ry "% #$/ $; %G }%S }%_ }%k ~$w % ~$   & d $ 0 . 'R  (P~(Ry' R (Qy(R ) R '0R (P5(Q0'PR (R3(S0'pR (R4(S0)R *R (P2(Q0+ ( [E C )> 2tt S2- - >2 4   td(T@BintFKP]%lyuAr[:;z}&(T@S .&'^ Z }1( S_ ret) d  @Tj4 P_ Q  PTwI P_ dT d,] ] 2j  dhT+1intSLF8&f(8*1/,XKLJ 1:{P]?O`1l- mO%#a*[: ;h  a 1?  " J [ J  Q  Q  "Q  %Q  (\(  +0  .8  2g@  6mH  9QP  =QX  Ax` T Ch  F(p  I(x e L(  P( $ T( 7 [(  ` r( f tT g w(  y  {  }      ? a l  . ( _ ( > ( R (     ?(  40  8id ?@ ?H  aP X  ` / (h  (p  x   u       A (  ( & (    (  ?       Y ! , Q B t& aW"b\sT~ 4 ~ Z  Q G& ' &6 22K2 Qa 1L  { !t\     1  1  1S  bcd *e nf?g? Eh naxVA.a hpı ẖerr?ȱ8Rrc ?V V HPtQıRرS '}}V V% fPtV2 zPtV> PtV  WJ  L 1'PaU !aP.a($adrRFJFin4ShpTU?tlQV ain6Xhvwбx?rcx?UV PvU Vc PxQtRySu\}up} '}uD} uH$V 8VJ HV ".ahT,` =?./ 0` 0.O0HFA1a@,1aDG1aHadr1aL1P1?][2 u sqres3 a#`U MaTo Tx T U $U M P4Q0|U U $au %Ff ")aU  !a),F&U P@QP"4$aU  !a$+F&U P4QP''ZZ '>> ( q' 'tt S'k( p' )'] ] 2'jj3'8'l l ,(   '- - >'1Qo dW0intFKP]%ly[:;& &  W0+ .,A +(W; P Q@ 8WH P r; ,? m ] ] 2d G Kd@W81int?F8&`(8*1/,RKJ 1:uP]?O`1l- mO%#a*[: ;h tU 1?  " > [ >  E  E  "E  %E  (P(  +0  .8  2[@  6aH  9EP  =EX  Al` T Cwh  Fp  Ix e L  P $ T 7 [  ` r f tH g w  y  {  }      ? U l  .  _  >  R      ?(  (0  8 id ?@ ?H  UP X  ` / h  p  x   u       A    &       ?       Y    E B h& UK"VPgTr 4 ~ Z  E };&  &6 22?&EU 1L  8  b7 K 1  n b  K 1k { ! w?\ ? O _O 1_ 1o 1S    b z A ` 1 / b@ ^ Ro  p0m 1n\29 3V 5J :UF 1y4 k$U@W8  $,UC9?$9U& O&.'UV' 'UV 'UV"'}VY'?%!W(/VQ)mV/* _( + W@,?KE, ?ztTX <U`W W  PvQVRVW ' PxW X j PVR_S }W} }xX+  X7 P_,X7 PW> "] ] 2"l l ,"- - >"kX dxXint8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8 DA F  G  H%4XY 41=?6dY@PP1&tY0xYM+(Y00A+/ =?-B@4YY PtDYfPtTY0XYMxX:=?1YU:ywOlAH,L*P%res Y(XsX|XX0P3Q0$Yl  i! k q  c"!] ] 2!jj3!l l ,!- - > y 1dxYph!int8F(T/,?K|P]%O`8l- mO,#a*[: ;h -= 8?  "  [       "  %  ( (  +0  .8  2@  6H  9P  =X  A%` T C0h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yx  {  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B !& "  T+ x4 x~ Z   6~&  &=6 22 8) Z    A %  S;ZLE ;.;:'#=?=HF Zh? ][Z* PlZ7 QlZZD k1TZHA1.|t1:=?3dZ* PutZ* PtZP PuQtZZD   xY =? 2 " +)O"xCAA#D,#H#L#6P#%XVres$ nl @Z. ZP, Y] Yf Yr Zf Z~ P4Q0PZ x!H"p* ";"p# q#]] '$k#uu %$] ] 2$jj3$l l ,$- - >  dZt$int?F/,FKLwP],O`?l- mNO3#a*[: ;h E &U ??  "  [       "  %  (!(  +0  .8  2,@  62H  9P  =X  A=` T CHh  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ? & l  .  _  >  R      ,(  0  8id ,@ ,H  &P %X  %` / h  p  x   u      A    &       ,       Y    B 9& &"'!8TC 4 ~ Z   N &  &U6 22   ?tm, U , , ,D ,  , ,* , , ,    $ (>&\@6t>'&@6O@'#A&A&AN2A,IEtmB C qiresD &0]V&4\ \ P\b P ] @At,% ] PwQ0@] T] P"R0l2&[Dt2*&4 ttm5[ PP[ Pl\b \ PF(&[Db t('&'#* ttm+NH[ 5 PP[ I Pl[b [ PF &Z tm"{wres &Z P9Q0!"R"4"l l ,"- - >"" " h#\\ {"vv{"w d\]X@)intFKtP]%O`,l- m{[:; ,@  8 K  KDL:M rG$N  Q:R rS  T U dimV , H w   K B + _ t  # $ _O%%%_ Kt e  z r,   _  \/!>] >%>'%:>8r4,dim>Gph@ @resA bB-)C iH %OK^PQSRy0iP %soH^PtQRy^NQtR0S1P^bPvh^{PtS3^QtR0S1D,3 \]lRv+b  Rp]% "!c;9"#oPN$]%]]HPt%]&N|'oN>|(oldP ) *8*h*,*ww +~~ 5 c" d^T+intKFqP],O`%l- muAq[:;z;X_XxA;)gc ret=, d_: Pt t_N Pt _g PF Rt _ Qt^A' val3 s! k p" MG ret#,zv ^ Pu ^ Pt ^9 P3 Qu St ^M Pv _a Pv _u Pt 4_ PF Ru <_ Pt L_ Quq " " hjttS zX# d_,intFKP]%O`,ly- muAr[:;z_#''6! # # ret%'# _)v Pv Qx _) Pu Qx _5 Pv _5 Pu _A `M Pt Qu `Y `e Pu `e  Pt 4`q Px Qvppl  >> ttSj E$ /d8`-int8F/,?KpP]%O`8l- mO,uA#a*[:;y>h 4 D8?  "  [       "  %  ( (  +0  .8  2@  6H  9P  =X  AU` T C`h  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?   l  .  _  >  R      %(  0  8 id %@ %H   P X  ` / h  p  x   u      A    &       %       Y    B (   "   T EU} F' G Ho8  T [ 4 ~ Z   f         &D6 22! $ 5 5end 5 5ptr 5 a 5G$ 5 5  73 8  9  : . <4 <4end <4 <4ptr <4 a <4G$ < < d >o ? mem @ max A R C Cend C Cptr C a CG$ C C :8z7 8`# 6& IE# kiOf@%p ) ret%$ P`/ `8 PPQy`D `P `\ Pt`i `u  Pt` Py   pp l   !AAB >>  tt S  jOE& Od`Lq/1intF8&[(8*1/,MKJ 1:pP]?O`1l- m O% #a * [: ; y >h {P1?  " E [ E  L  L  "L  %L  (W(  +0  . 8  2b@  6hH  9LP  =LX  As` T C~h  Fp  Ix e L  P $ T 7 [  `  r f tC g w  y  {  }        ? P l   .  _  >  R      ?(  #0  8 id ?@ ?H  PP X  ` / h  p   x    u       A    &        ?         Y  ' L B o& P R" ] W nT y 4 ~ Z  L    6&       " &6 22F -L\1L  8  i7 F1  n i  F1k {  ! wF\ F V fV1f1v1S    i  z A [1 6 i@  ^ Rv  p0t 1u\29 3V 5J :\ pPbT adrp8 Gq.tq;?84s XVOspnatP\t@t?resu Pd yPd w P0!d tc< j\\c Pv Qu~c Qv!c c P42" cc 7 # IG!b `c T Pztcm Pa R0c Ptc P2cZ Pt!$d  6 $hP` 6h(Pa]i Oiii?resjPxjPj?% mP!` La P1 Q0!la &6aP 6#Padr70 bZG8- %( 6< Plen=\ b,K Pw4b9_ PwPbF Pt Qw Rub P2 Rw'b P$ Rw( a_ # NL( b@T # ge!a, t-P|a T a-?T ~)res/ P*a P@ QP vB!Ppa  a!= )res# P*|a P4 QP +H" ,;"-0.-1/.a -" " h-l l ,-- - >. p. q-/F) %d,dT4intF8&A(H*,K:]p|P]%l[:;& &  { 5!c \ c  s   s ,  ,  ,S  5 ,dTJ a4res  4Jh 4 D8?  "  [       "  %  ( (  +0  .8  2@  6H  9P  =X  AU` T C`h  Fp  Ix e L  P $ T 7 [  ` r f t g w  y  {  }      ?   l  .  _  >  R      %(  0  8 id %@ %H   P X  ` / h  p  x   u      A    &       %       Y    B (   "   T EU} F' G Ho8  T [ 4 ~ Z   f         &D6 22! $ 5 5end 5 5ptr 5 a 5G$ 5 5  73 8  9  : . <4 <4end <4 <4ptr <4 a <4G$ < < d >o ? mem @ max A R C Cend C Cptr C a CG$ C C :8zW d# 6'   # O f@%p ) ret% X$ !!d/ d8 PPQyeD  eP e\ Ptei $eu  PtHe Py   pp l   !aa9 >>  tt S  jr +- )dPeP9int8F8&M(T*8/,?KJ 8:i|P]%O`8l- mO,#a* [: ; h oP8?  " 9 [ 9  @  @  "@  %@  (K(  +0  . 8  2V@  6\H  9@P  =@X  Ag` T Crh  Fp  Ix e L  P $ T 7 [  `  r f tC g w  y  {  }        ? P l   .  _  >  R      %(  #0  8 id %@ %H  PP X  ` / h  p   x    u       A    &        %         Y   @ B c& P F" Q K bT m 4 ~ Z  @ x   6&        &6 22: !@P8L 8zd mq T  7 8 D  ( (27= =G   n z S A  R R  @ n ^ R     &1 1;F FP n   7 [ [     - B     ! 6 K ! , G 8k { n !G  w \    8 8 8S   z M 8 p0A  1\2[9 3RV 5J :PPPe 9'P4!*!6P}!y! !!O!! aP~!\x~%!! %" ""res! P:"8"!W" ~!Q#A ~"clo$%Q"M"#fg 7Pq"o"$le %e &Pt$e! %e- &Pw1&&Q~&R~$e9 %eE &P~&Rt%fQ &P2&Q0$,f] '> ) M)l l ,)- - >)j8/ dDfX[<intF8&A(H*,KJ ,:]p|P]%O`,l- m[:;& & L  H  m 97 m} ,  n  9  ,k {   ! w   \   &  6& ,6 ,F ,S a    9 z A A ,   9 @  ^  R F   p 0D 1E \ 2} 9 3a V 5J :,DfX2%""3""ret%""WQDdfPQQR~tf#Pt1&Q~f/Q0 J  p j0 ,dfH=int/,bF0.u>i33:i3F3KVL1V!J 3( N A6h&,%( |),- /0!1 2 3 | 4,(80t:8?@H&HI&P J&XZ`P]Ol3[:;?L z3  z  d    m qJ :s MRgHt fdM8R""errOO?#9#g!g@Pt1&g-g9^PPgEPuR0 sCRTgH fdC7Rr#h#errEO##`g!hgPt1&pg-gQPPgEPuR0G% Of fd%1O##buf'Nk0 Oh1g]4giPtQ1R3S}fp) $$0$*$fuP3QtR6OON >>  " " hPP 1 1 % 55 < 2 dg@@intFKP]%O`,ly- m[:;& & g@evfd&_$Y$fd%$$ret%$$ge gqL Pt1&h~ h Q0  a >>  jb3 d$hdjAintF8&A(H*,KJ ,:]p|P]%O`,l- m[:;& & L  H  m 97 m} ,  n  9  ,k {   ! w   \   &  6& ,6 ,F ,S a    9 z A A ,   9 @  ^  R F   p 0D 1E \ 2} 9 3a V 5J :,$hd)2( %%6=%9%%b%^%WQDDh)PQQR~Hh5XhAPt1&Q~`hMhYQ0 J  ~ >> j4 dhPCintFKP]%O`,ly- m[:;& &  hPk9$%%fd3%%ret%%% hkB PP hw[ Pt R0 h Q0 PPv % j5 hdhxCintFKxP]%lr[:;& & |+<iLV .<,%% e> && Vi>= i PG  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8jD%''3''@''''Ol!((*H%C(?(p1 g(c(p2! ((ret"%(( , %((|kP QvR Su;9))j$k aPQQ0k wQ8kDkLk$k0k<Pvk<PukHPvQukUkal  pp l  >> tt S**  - - > j_ > %dk4BNintFKP]%O`,ly- m[:;& & k4J'.)*)33S)O)lJ:PP1&QQ1& lVQ0  j> bd$lD+Oint/,bFKVO\ H;HD$wz%wo' P]OO`3l- m[:;& & L#$lD~fd&#|)t)cmd0#)) u;#)) lX retO+** O** G$p%+ + l~PtQ=RPl l~0PtQ>RPl m~XPtQ<RP4m LmtQ0Xm% >> 1 1 %  j? dhm,2QintO/,gFK[W|P]OO`3l- m[:;+zV3 & 6n fd6),, ofs637,3, cmd6>^,X, ret8,, <,, nPQ0n PnPu1&\n|nnQ0 *hm fd*& -- ofs*00-*- cmd*;b-\- ret,--m mPv1&m mQ0m PKR0 Q>>  6 j" " h&@ B%dnRint%F/,80.>u11Tu1F1KiL1iP]%O`1l- m(W1  ~ 2   Y & +@[:;4 <@y>@  '1 5"  ,  q +L1 H>Y`nl,z))=& , {+ # O) ,+Ox')+#H('f*'dF+V"A!$/) V+!z"*#+$%)&n&'%(,) ,*l$+l!,#-^!.E-/ &0!1'2&3\$45%6.78'9&:+;2"<!<#=!>5+?~ @%AA)B"C"DE,F%G+H@'I%Je#K)LM]-N&O-PQR'S-$Ty$U(V&+W+XY%Zz#[;*\!](^*_}`(!a b c dref!gCh!iN%j"kl m,nKo"p'qO,rq%st uE&v(wO xp y)z7-{#|*}[%~b(',$'%%',h+A"**!4( /*t%$"N!$$(*@l""(%*$)*(!&e%L$$*+' )\,*X)g)#^ |,\&(-8 a', K*{"3# ++(-{!K## +S&$#'(),&)}*=,zA6h &J% (  )M -  / 0! 1  2  3  4M( 80t :8 ? @o' OH0, PTL) QP% RTT! SX%" TT\ Z`wq`W --len.@--& @*.&.( @L.H.q^PNqkrtPtQdR1$rQd&q(J  4x.t.b)>%..qJ &`n vfd`)..$`4..)`A//&a)>/:/2-a8#aDfdc%`/^/ c %u/s/v(c%//&c%//d 4//dime ~f//b"f00B$f$00stgE~R-h @00&h@:161(h@`1X1Wi 11nX it411Lox% i422 nnd 15232!=">J2H2#J n (q 1a2_2!=H">v2t2#J To`~ 22 22do P3QzR~$8qP3QzR~% dpdpL 22 22& ~" 33px PzQ~R1p$pPzn P|Too^ PNokpp PwQuRtS~@p$ P0Qvt"R3}zHpdp@ Q0pp\ Q0pq q(qdqpq|q 4 '1(2!4 % )fd4%*G$4/+c6+p7%,6%-%- E( +X)val8./  X/G  @ @0))k1""2**Y 2##L 2""d0< 0'21 1 % 0(= 022>> 2*2!!=2j1 $ $2bC -d$rLWint%=F/,DKuP]%O`=l- mO1#a*[:;h & 6 =?  "  [       "  %  ((  +0  .8  2 @  6H  9P  =X  A` T C)h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yq  {|  }      ?  l  .  _  >  R      %(  0  8id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T$ q4 q~ Z   /w&  &66 22  =- u % ,# =w-)#=1U0--3#Ĺ-:$rL;6:%*3&3 :1L3J3 :>a3_3<;x3t3O<q33</@<%33fd=%33[= %44-=%D4@49= %p> h4b4 ?%44W44DrArJPPrVQvrVQv<rbrnrz PvQtRxss(PvHsXsq !pp l ! G! !!-- !>> !tt S!- - >! jE -dpslGZintFK%,P]%O`,l- m[:;& & -psl9%44 .455 fdrp res '5%5 |sa PP su Ph s P2 Q0 s Q0PPv -- l l ,j F P.ds:[1intF/,MKwP]?O`1l- mO%#a*[:;h +1?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T Ch  Fp  Ix e L  P $ T 7 [  ` r f t g w  yf  {q  }|      ?  l  .  _  >  R      ?(  0  8 id ?@ ?H  P X  ` / h  p  x   u      A    &       ?       Y    B &  "   T  f4 f~ Z   $ l w &       &+6 22 1 K1 L: M G$ N  Q: R  S  T  U dim V  1.(t&vfd(.>5:5K.(9`5^5&.).u5s5\.):55+&55O+f55+.+$H.+?55ofs, 6 6len,F6D6ret,a6[6buf- 66fd2?66766t Hu Xu PQwt"R`u u u Q0 fa.s fd%66buf/77ofs:5717lenE]7S7&77Of77p.${;.?77.88ret?8|8 . {9 %88t @t Xt i Py1&Q{`t |t Q{Rut t Q0F 1!" #k.k.h">> "- - >"j"/H .du^int8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8.#up6#)88%p88O%l#99%*_%%E9A9&v_len'%k9e9p( 99199DvP_uuPPQyv vv9PvQ_R $v,vVPvXvdvPyl8] ] 2pp l   ..(>> tt S- - > jJ .dpv`int8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8.pv5p*995:9Ol(:$:.*H.%J:F:r r:j:rp ::#::v;vDPPQvvPQ0v]PuviPuwvwPvlpp l .. ] ] 2~~ 5 - - > j#vL ,0dw4bint8F/,?KLapP]%O`8l- mN  /  [ 8/  M@ N  c +0 1 ; }o0 C}Z 8/ Ff O,  # a *[: ; y > h  8?" ["% ((+0.82@6H9P=XA`TC(hFp IxeLP$T7[`rftgwyp{{}?l._>R %(08id%@%HPX`/hpxuA&%YB  "   TE}FG\H 8 T #  p4 p~ Z  o . v      @jmpABp/C  & 6 22 /! ,%< 8?c/!v'/'/( %J0)< 8D/Sv`0.buf/  $5!5!end5!5!ptr5! a5!G$55   7\38 9 :  .<<end<<ptr< a<G$<< ' d > ? mem@ maxA  RCi Ci endCi Ci ptrCi aCi G$CC  8zw/Axm [/A'::/A6;;/AF;;/B'/;+;Dm O;M;ODpg;e;O/D.|0/D%k.E |:E}/E~q/F%|UG |;z;tvH&| tvpIs ;;J%;; resK <<!z e<<"{TyhW > #$h%|&2<0<'`y(P|)x*y j (PP(Q|(R|*$y (Q}(R|*8y (Q~(R|*Hy (Pv)y*y (Qw(Ry(Sz(}t)y*yy  (Qw*yy  (Qy*yy - (Qz*yE (P3(Q0*(z] (PF(R0'8z(Q0 p &+:00w C00$T<L</04 <<2m <<O2p<<l3@res3D03.H/3%! xXn fd6 %<<,@x$/8 =='Lx(P2(Q0-H >6=2=)w +/# %w|uC0#"Z=V=/#2 |=x=q/#>u==-? __i%8==/% =='8w(Pu(Q0(R,8wP l&==$( fd' > > %./&/sec70$0 0W0100n23\\ {11// e 1>> 1l l ,1" " h1j4 O 0dLzg1int?F8&`(8*1/,RKJ 1:uP]?O`1l- mO%#a*[: ;h tU 1?  " > [ >  E  E  "E  %E  (P(  +0  .8  2[@  6aH  9EP  =EX  Al` T Cwh  Fp  Ix e L  P $ T 7 [  ` r f tH g w  y  {  }      ? U l  .  _  >  R      ?(  (0  8 id ?@ ?H  UP X  ` / h  p  x   u       A    &       ?       Y    E B h& UK"VPgTr 4 ~ Z  E };&  &6 22?&EU 1L  8  b7 K 1 1J011011 0@0z00!2111 1@20111 0@ nr b  rK 1k { ! w\    1 1 1S.   p b z A p` 1  b@ ^ R  p0  1n\2J9 3.V 5J :UF- 1 0- d&1wU~(  w(E/>+>1w2?T>P>4~ 71aUD}F a.Uy>u>}1a:U>> ofsaFU>> lenb.U>>! b9U!1bFU"retd?? ?#[d ?3?/?#.e\?T? .fF {Wg{Qh {$x} %Px$} %P|%Q{%R{$} %P{%Qy1&x"%R{}$}- %Pv1&%Q{%R{%S{%}{}& ~+%Q0KW '1O1OU| O%U??}1O1U?? ofsO=U@@ lenOHU+@%@! P U"retR?[@W@#[R ?}@y@#.S@@ .TF {$|2 %Px$|\ %P{%Qw1&v"%R{|$}7 %Pu1&%Q{%R{%S{}&<}+%Q0^12UD{X!2)U@@}125UAA ofs2AU-A)A len2LUUAKA! 3$U#5!AA#O5AAq15}{#15?AA(adr6U{26}{#16? BB"ret7?2B,B#[7 ?aB[B#.8BB .9F {"res: UBBW;{Q< {)l|O#LUCCl{C${m%Px{$|L%Py1&%Q{%S{%}{%}{|$8|X%Q{%Ru$H|d%P{%R $`|p%P2%Q0||&|+%Q00ULz%U*C&C}11UJCHC ofs=UaC]C lenHUCC!  U#"!CC#O"CCq1"}{#1"?DD"ret#?BD> +j+Y1Y1-+h1h1+/+ M+l l ,+- - >+00*R S2d<~Dlint%FKP]%O`1l~- m[:;& & ,1)2| @2<~Dm )8E4E cmd5]EYE X~m] PP1&x~y Q0J2J2 j S 2d~mintFKLk!kP]%O`,l- mNr(  r~[:;zp2 ~c2 &E~E sec"    t&h ret' %EE ~~,&-9`EEE~RPX~^~j~vPuQu~Q0~PP2Rsec9$0 W000 n1 1 %  22 >> j\\{JT 2doint%FKP]%O`1l~- m[:;& & 1 *zd m q M ^ * 7 c6 ws 1 6sD~~7  &&0;;E PPZeeo^z+@Uj , 1    ,@ 10 % @2))9)'EE2)6&F FA*"VFRF*.{FwF,%FFty-%FFD)PPh5QwRv1&AQ0PPv 22f jU 2dqint%FK%1P]%O`1l- m[:;& & 1:  z  d    m q,E : E 3E2`9+FF2:FFA&+G'G2PGLGsvw`res pGnGty %GG`PPl8QwRv1&SXxPP2Q0<Q0PPv 22l l l ,jeW >4dPrint8F/,?KLaJ 8pP]%O`8l- mN  /  [+ 8/  M@ _  c + O,   # a *[: ;y > h  8?" ["% ((+0.82@6H9P=XA`TChFp IxeLP$T7[`rftgwyH{S}^d?l._>R %(k0o8id%@%HPuXu`/hpxuA&%YB  "   TE}FGH?8 T   H4 H~ Z    N Y  j |  @jmpAQ BH/C  &6 22  $5`5`end5`5`ptr5` a5`G$5k5k   738 9 :  .<<end<<ptr< a<G$<k<k f d >?? mem@ maxA  RCCendCCptrC aCG$CkCk    8/!  % 8?c/! '/'/( %J0)+& 8D/S `0.Q buf/&  3 L z5i 4k %5l %8)B 6#4W3v44J55 j45%53!4)3.l5/32532\4^I3b3g3l 455 54J :W 48a 3M4d3V44 04i 3j%74k% 8  !=5p#  8 !=3}#  8 !.3#  1 8! !3#1 x!3# p j j 8  !V5%Z  ~ 8!5 !5 "05 #i%#lgk #tv7$4P %vty+GG&46GG&3EGG%val&HH'tyN LHFH'opt j ~HzH(Ѓ< )QP1&)}t)}u$x5 @L< %vty +HH&4 6HH&3 EIH'tyN &I"I'opt j MIII()QP1&)}t*p3<+A8~IuI,ty7N II+3?%PJDJ+74J%JJ-2,.val:!c4 h/d5B K K051YKWK23h4uKsK()P\5X)Px1&)Qv)Rt5 m)P|5,)PF)Qu)R0(8#)Pu)Q0*4P+A8~KK,ty7N KK+3?%hLdL+74J%LL-2,/LL/OHLL6err!3@74%8res LL!c4 !d5B 9/$MM:t/58)Px1&)Qu)Rv)S)}588,)Px1&)Qu)Rv)S)}:`D58g)Px1&)Qu)Rv)S)}5ā#)Py)Q0:P:\:\(0)PF)Qy)R0 H;/700n>44 ?\\ {>" " h>j@>55 >4>33d>55?E [ 6dwint,/,nF0.>uAAHuAFAKbL1b!''zNAb(   A6h&d %( ): - / 0 !1  2  3 4:( 80 t:8 ? @ H^H I^P J^X Z`P ],O `A lk- mw OF.  # a *[: ;y >h    A?  " ["% ((+0.82@6H9P=XA`TC%hFp IxeLP$T7[`rftgwym{x}?l._>R ,(08id,@,HP%X%`/hpxuA&,RYB"TE }F G H- 8T  m 4 m ~  Z   +s~ & 6 22$5N 5Nend5N 5Nptr5N a5N G$5 5 7 38  9  : .< <end< <ptr< a< G$< <Td >- ? mem@ maxA RC C endC  C ptrC aC  G$C C  A ] A 6/ (6H\ fd)SMMMret,MMbuf\ y MM MMlP3Qt1&R\t& P1QQ0P6G 6)MM!G NN!Om.N,N+~",ret,ENANbuf~p !gNcN# !NN(&PwQ~% HNN;NNP3QtR~ PPQy 6 Pt@Pymu6Ј 6(NN!G NN!OmOO+~",ret,OObuf~p !>O:O#`/ !^O\Ol&PwQ~V8 { ysOqOlOOHP3QtR~( PPQy08PX PtPy6<fd&OOret,OObufP ~OO P P`P3Qt1&RPh&P0QuQ0ȈPKR0'6L| 6&EPAP!G gPeP!OmP}P+~",ret,PPbuf~p !PP#!PP &P0Qy% HPP;QQćP3QtR~d"PPQẋԇQPt$ePx4PKQx76o\& 6o%QQ!qG >Q> /j.c66 0/ppl //ttS.F6 7 /" " h.66/4/l l ,/ /6] %7d _int8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8Y7,, .,,UU.UUO.lVVz/,V*VDMl47DR7(DV@V6fVdVC{VyVVVOlVVF7*@7%VVp1 WVp2 1W+Wret%`WZW)WWĊDYPQQx(YQx0e<eDqP}PvQuX`Pvh*PuMPx- - >pp l    g7g7" >> tt S jW_ s:dȋintFKLrar!rP],O`3l- mM@ y [:;y>z9, H8 d8 (j 8* r 78+ / 71 r %92 5 P97 r 78 ; 7= r }8> B 7D r 8E H 7J r S8K N6 7P r 7Q UX H8W r 8X [z 7] r 8^ a 8c r 8d g b9i r 59j m 8o r 8p u 7w r 7x |$ F9~ r 97H!t8$Y9& H j    $ ( 6, X0 z4 8 < @ D 8ȋ5 .&WWres! WWru"$0,*8' 8'%WW5Pt k*8) 8)%XX85PtD *8, 8,%LXJXd5Ptd *8. 8.%~X|X5PtBP8QNP0QDNP Qo7o7|l l ,77 W H ga 9dint/,bFKVWw3V / : 3/P]OO`3l- m O  # a *[: ; My >Yh  M 3?  " M[  M M "M %M  (X( +0 .8 2c@ 6iH 9MP =MX A`T Ch Fp  Ixe L P$ T7 [ ` rf t@g w y { }    ? Ml . _ > R    O(  0 8id O@ OH MP $X $`/ h p x u  0 ;A  &    O   Y v  MB wMS"^XT E} F GJ H8oT 4 ~ Z  ] 3+6 @vjmpA B/CqA| &6 22$ 5 5end 5 5ptr 5 a 5G$ 5  5 M 7J3 8 M 9 ^ : M. < <end < <ptr < a <G$ <  < d > ? Mmem @ ^max A ^R CW CWend CW CWptr CW a CWG$ C  C  Mm 3/! z O 3?c/!'/'m/( OJ0) 3D/S`0. buf/+z90Mt 60,MXX\.08MXX2 XXO2YX2@2Op3 YYret4O:Y6Ylen5 ^YXY ` >MYY! "ԍ  #PQ" 0 #Qy! ! " V #Pt!' "3 s #Pt$<? #Pyl9M 6)MYY\.5MYY! YYO!ZZ!@!Op" ZZret#O>Z:Zlen$ `Z\Z Hh -MZZ! " #PP#Qx!  !( "8 #Pt!@' "H3 #Pt$l? #Px%& 'ppl ''&(v9 '>> 'ttS'jmc 9dDint%=F/,DKuP]%O`=l- m / ` =/O1 =K ~  2    Y  #a*[: ;rry > ~h  r =? " w[  w w "w %w  (( +0 .8 2@ 6H 9wP =wX A`T Ch Fp  Ixe L P$ T7 [ ` rf teg w y! {, }7   =? rl . _ > R    %(  0 H8id %@ %H rP NX N`/ h p x u  Z eA  &    %   Y   wB  r }"  T E} F Gt H8 T  !4 !~ Z    ' 2 X C U ` @jmpA0 B!/C k  &6 22 $ 59 59end 59 59ptr 59 a 59G$ 5  5  w 7t3 8 r 9  : r. < <end < <ptr < a <G$ <  <  ?d > ? rmem @ max A R C Cend C Cptr C a CG$ C  C   w = /!  % =?c/!'/'/( %J0) =D/S`0.0 buf/   -u %z ,` =CP 9` :"= I 9[HQ !fd["%ZZ" [2RZZ"9[ArZZ# ]% [[$А! %Pt%Q1%R0$: %Pt%Q2& %Pu%Qv ::SlH !fdS %![[" S0RC[?["9S?re[a[# U%[[$ %Pt%Q1%R0$ %Pt%Q2& %Pu%Qv'PK%84: "9Kr[[ pD( "6D!r[[" D4R\[$  %Pu&8 %P2%Qt%Ru(?$ " ?R"\\"9?-rD\@\)& %Qt%Rl(" $8 " :$%g\c\" $/R\\"9$>r\\#& ]]#O&!]]A'rL*err'rP*arg'rT'X+'%,res( r?]=],exn)`]R]-x8  + #G + ]].p #':1 ]]#91]])Ԏ$L( %Pw$\ %Pv$p4 %P4%Q0)@)L)ď()؏X ! '%,")r^^/3rU0 :$%19%2err r3DD4-N^H^5:|^z^5G^^6hh4-^^7:5G^^&t4%P1%Q0&`d%Pt%RD%S 8% 9 q81 1 % :8] ] 28l l ,899[8P:P:<8""d8 y Xg r:d/! 9PII?int n/n~~I /W c/! '/', /( P J0) ID/S IF /,K L2 a2Y  P ]P O `I  ll - mx N 9M@  9 E c +E O#Qa* [:;  y> h? OI?"  [     "  %  (( +Q0 .8 2@ 6%H 9 P = X A`` TCkh Fp Ix eL P $T 7[ ` r ft gw y { }    ?  l._>R P(08idP@PH P%X%`/hpxuA&P`Y+6 B3 "TE`}FG#H8+Tf 4 ~ Z  6 q @+jmpAyB/C-1&O6 22U< `0.ybuf/[$55end55ptr5 a5G$55  7#38 9 : .<<end<<ptr< a<G$<<d >? mem@ maxA RC0 C0 endC0 C0 ptrC0 aC0 G$CC F Iza:  6' ^^63 __)@ __  ._,_O F_D_ q Ptv!  t! ]_Y_ p" S__ ret#P__ at$ %__ mt$%(`"`!s 5 h`f`" + # ~`|`$% & ``' (@AR%(P" ,, / # ``$% & ``'< (@AP%(P)$ *p M (PP)x' )' )4 )đ@ *БL (Pt(Q)ؑX *d (Pt)lp  I+/ ,sec7%-$0 %-W0%.00n/.ppl 0\\{...k:k: .>> .ttS.j. 5j :dP81intF/,MKwP]?O`1l- mO%#a*[:;h +1?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T Ch  Fp  Ix e L  P $ T 7 [  ` r f t g w  yf  {q  }|      ?  l  .  _  >  R      ?(  0  8 id ?@ ?H  P X  ` / h  p  x   u      A    &       ?       Y    B &  "   T  f4 f~ Z   $ l w &       &+6 22 1 K1 L: M G$ N  Q: R  S  T  U dim V  1:_8fd_-``buf_7aa&._B'a#a\.`-OaEab8aaObfaap.b${;.b?aaofscbblenc 2b,b.d?kbebretd?bb .e>{8r | PtR{  Pw1&QtR{  ̕ Q0 fFO!1::0 vfd:/ccK.::5c3c&.;/JcHc\.;;_c]c:;Gtcrc=8ccO=fcc+.=$@.=?ccofs> cclen>cc:>ddret>)d%dbuf? IdGdfdD?^d\d  Tudqdԓ @ \ PvQwz"Rt % Ĕ Ԕ  Qtؔ :, fd&ddbuf0dd&.;ed\.GVeLe!8eeO!feep.!${;.!?eeofs" f flen" 1f+f:"bfZf.#?ffret#?ff .$>{\ 7 0 PvR{4 D PxQvR{L X%   "# /#$::n#>> #- - >#j#1 1 % "Wl :dԕ̒intFKP]%O`,ly- m[:;& & :ԕt&1g-gPP1& ::l ;deint8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8:z6&VgRguid2gvggid=ggzggOlhh*@%5h1hp [hUhret%hhX!hh P PPQzX`pCPuQvx&Rwx&x`PuPzlpp l    :: >> tt S- - > jn ;dint8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8;@6'hh@hhOlii*@%;i7ip ai[iret%iip!iiȖF OPPQy[g$s Pu,4&PuP\Pylpp l   ;; >> tt S- - > jUp ;ddint8F/,?KpP]%O`8l- mO,#a*[:;h +8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T Ch  Fp  Ix e L  P $ T 7 [  ` r f t g w  yf  {q  }|      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B &  "   T  f4 f~ Z   $ l w &       &+6 22 8DIR 9;E;dvd)iiiiOfjjX;$H*;%Aj=jd ejajܗ%jj|ȗ(Pv̗4@LP9Rv f  O;O; >> - - >" " hr g;dintFKP]%O`,ly- m[:;& & n;9%jjfd14kjfd2?_kWk@K Pt RP1 L`n Pu Qtx Q0  Pt ::::~ PPv };}; j 99 ls ;dHintFKP]OO`3ly- m[:;& & ;Hmfd'kk 1kkOkk m yT Pt1& Qu1& Ę  Q0 ;;% >>  jTt ;dPintFKP]%O`,ly- m[:;& & ;Pfd'lluid1ElAlgid<glcl%ll p Pt1& Qu1& Rv1& 4 Q0  ;; >>  j(u <d8lintFKP]%O`,ly- m[:;& & ;6$fd64lltPP1&R0;0$dfd02llPP1&R0;&Tfd&/ll (%mm PtQ3R0 PtQ4ܙQ0 <8Ttfd-/m+m %RmPm PKPtQ3R0 hdPtQ4Q0 99 ::::~ % ju u=d(intFK%P]%O`,l- mar[:;=%I<%, ?@ < Z= < a< (< g= = p<6=6=z|=S K=$T .$%imem ret&%mm \k pw1Pt  ̚ Qu 7<81 @TP5<(k <mm8P4==L<< <<& j b<< 8<< Gw =d$int/,bFKVWwP]OO`3l- m[:;+z=(p`fd(-nnlen(7HnDn*Omninofs+nn K PQ X d Pt1& q ̛} Q0=$LKfd*nnlen4nn Onn 4X Dd2 Pu1& Lq l} Q0  (=  >>  jw =dЛ intFKP]%O`,ly- m[:;& & =Л .( oo؛==x >dintFKP]%O`,ly- m[:;& & = .(EoAo== y >d@intFKP]%O`,ly- m[:;& & > .'jofo>> y }>d ڢint8F/,?8KpP]%O`8l- mO,#a*[:;h -= 8?  "  [       "  %  ( (  +0  .8  2@  6H  9P  =X  A%` T C0h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yx  {  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B !& "  T+ x4 x~ Z   6~&  &=6 22 8@> *V&> , `> - > . Y> /  j><XPgid<)oo=?>oodxPu1&hF>,\hA,)pp=?.MpEp/Pu(LPu8hHT.> =?.ppppOxppAD>HmemL6P%ppres pp؜D)pp$xP4Q0 x 1 1 % t>t> e k j!q P>P> k" ] ] 2 jj3 l l , - - >{ >d3intF,KP]%O`,l- m@k[:;& & >R .*qq> R?q5qn!%qq>! %qqres" rr i2 %(r&r X Нd P0 Q0 q Pu Qt2$ d Pt Qu } Pt H Pu ` Pu p. Q0 xB Pu  Q01 1 % >> >> >> .tt S jL| >d,(intFKxP]%l[:;& & >,* .)@r>P] ] 2" " h} ?dintFKP]%O`,ly- m[:;& & ? .(rrĞ??wa ~ ?dОint8F/,?88KpP]%O`8l- mO,#a*[:;h 9I 8?  "  [         "   %   ((  +0  .8  2 @  6&H  9 P  = X  A1` T C<h  Fp  Ix e L  P $ T 7 [  ` r f t  g w  y  {  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y     B -& ",T7 4 ~ Z   B&  &I6 22  8c> 1? 3 i? 4 s? 6  ? 7 ? 8 z? 9 '? : C?BTPuidB)rr=?Drr`tPu1&  V?2\A2)8s0s=?4wsos \Pu$+ yPu4D P 0?О(=?0ssssOssAc>@?DdirH*?LBP%ssres tt/'t%t7 T@ d@ p@ @ @ L P7Q0X  1 1 % M?M? n k j!q `?`? t" ] ] 2 l l , - - >< ?dNintFKP]%O`,ly- m[:;& & ? .'>t:t??ŀ ?d`intFKP]%O`,ly- m[:;& & ?`s?+ct_t@>7ttȠs.PtܠJPtQu1&cPFRt Q0 q ?? " " h jz @dint,FKLwawP],O`8l- mM@ ~ [:;y>z@8YG @ h@ ?U@io?l_@n 3 8o @1 @=T @=*ttval?GheQ`P`̢qQ0 w@3@3*tt)@37ttnew5GPold5G`}Pu PH(}Pu0PPPQDRX`PXxqQ0?'ttp'9"uures* TuNuv*8+ 8+%u}uPu *8, 8,%uuPuP4QG?@ l_tv4_uusec?%vv $0 %hW0%?v=v,U@A@%P`H@@{ j\\{@@ o7o7|l l ,00 n:@0@ f @dԢDintFKP]%O`,ly- m[:;z@ԢDmpid%]vYv@0v{vsig%vv m> PQ1& yT Pt1&   Q0 @@c @@p @@" j; Adȱint/,bFK3VP]OO`3l- mO#wa*[:;h !1 3?  "  [       "  %  ((  +w0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      O(  0  8 id O@ OH  P X  ` / h  p  x   u      A    &       O       Y    B & "T l4 l~ Z   *r}&  &16 22 3An6'vvA3vvnvvOl'w#w*@OIwEwp yowiwretOww\<Oww(xx4t} PPQy7PuQvTPuԣPylpp l    A AZ >> tt S- - > jl #AdT1intFKP]%O`,ly- m[:;& & *ATJ9A%xxret%>x:xJ V9 Pu1& 8c Qv 1 1 % 4A4AV j >Ad<"int8F/,?KpP]%O`8l- mO,#a*[:;h !1 8?  "  [       "  %  ((  +0  .8  2@  6H  9P  =X  A` T C$h  Fp  Ix e L  P $ T 7 [  ` r f t g w  yl  {w  }      ?  l  .  _  >  R      %(  0  8 id %@ %H  P X  ` / h  p  x   u      A    &       %       Y    B & "T l4 l~ Z   *r}&  &16 22 8DIR9;HA<6(`x\xxxOlxx*@%xxd xxres yyp! 8y2yؤ,cyayT PPQy0PuMPuԤgPwQPylpp l   RARA >> tt Sl l ,- - > jaɈ AdTZintF/,30.|pKdP]%l[:;& & A@AAAHA AA! @P, DIR\ 9;lA ZAT vd(~yvy d! yy e"yy(Pt 44@HLP9RtLXPa|AdA>> ] ] 2" " hAA i\ AdP4intFKP]%O`,ly- m[:;& & DIR9;AP4Avd*zz d ACz=z dG S P9 AA " " hC Ad0yintFKP]%O`,ly- m[:;& & A0-gid'pzlz-PP1& :Q0 BB jl Bd;intF,KP]%O`,l- m@k,  ~ 2   Y & +[:; <y>& & B\>*zz >! \zz G$" zz n#%zz  i'{{ b%  s4{2{K{I{ХPu 8PwQvLPv8Q0 +val8  G  n n Z!B!B ttS jaΌ  Lh v @ 3? " @[  @ @ "@ %@  (K( +|0 .8 2V@ 6\H 9@P =@X A`T Ch Fp  Ixe L P$ T7 [ ` rf t3g w y { }   ? @l . _ > R    O( 0 8id O@ OH @P X `/ h p x u  # .A  &    O   Y i t @B j @ F" Q KT E} F2 G Hz8 bT  4 ~ Z      &    ) @ijmpA,B/Cd 4 o &6 22 z/!  O 3?c/!'/'/( OJ0) 3D/S`0.,buf/ $ 5 5end 5 5ptr 5 a 5G$ 5 5 @ 73 8 @ 9 Q : @. <? <?end <? <?ptr <? a <?G$ < < d >z ? @mem @ Qmax A QR C Cend C Cptr C a CG$ C C E  3BZ @ 3z V, 3 B5, kBd@Xj qCd(@{{setf ~gO{{BgO~ )hi !B||!6*|&|"Nx #OL|H|$]%i&Pu%pu&P~$'B &Pu&Q~$$ĩ%&Pt&R0\CX@Ȩt BX+@n|j|setZ ~[O|| )ب\5 !B||!6||"N# #O||$]%i&Pu%u&P~$'R &Pu$ $8%T&Q0BH@  .H+@} }J ~'CK 3}/}(xX )iM O[}Q}( * N G N }}+Hd)jPO}}'xi@ &Pw&Qt%i&Pw&Qt!'m &P~'@ &Pw%&Q0 B7@8B7,@~~B7;@9~5~)how9OY~W~set: },C:~;Op~l~ )\X> !B~~!6~~"Nh #O~~$t]%i&Pu%`u&P}$' &Pw&Qu&R~$$' &P~%ܧ&Pt&R0,B'@-set''~~)#O)64res*@Dx*H.*O()i+ OSI( B- @'&Pt%&P0%&Pu&Qt(@2@$  /}B ]0B!@1set223sig" O4@@c43C3C 4CC 44uBuB 4>> 4=C=Cd4" " h4fCfC 41 1 % 4j4BB 4vCvC 4@@"4CC4_B_B 5r Dd++intFK7a}P]7O`Ll- m2[:;& & %|!7$ L L+ b C-7 C.7 D/g C0 CbfD1$ +DQC&  !C!! D"!HD D#! % ph & 6'Ȁƀpid( src)7ۀr) 7 act*mLL;DBldst6 7(i=7QPwQuRvت]PwQu ]PwQui4PyQz$uNPwQzXcPwPwPxPuRyHPQyRwS~1&}x}zTPw\Px,PQyRwS0@PzuQzCC CC pp l  rDD EDED  s " " hDDH DDU ߒ EdЫint%FKpP]%O`1l- m[:;& & EFE1E1cE< E %F E :E D  D  D 4 D! 8  1 1  E mF SEEnd 1 sF D w 1pF)]* D^ E_% *? 1/E`? ,f 1VE0fEWf , 1FbBEfHfdf'KGCf1pl PP1&а" Q0D[LDfd[(kE[2h. yPP1&" Q0-FP0fdP(߂ۂ(: PP1&H" Q0 EE4SfdE,DE6)%F CPP1&QQ1&" Q0YF4̭sfd4*NJXE44{oarg4@у˃H6U( =&nbNH( zL( P  څօ   <6R oPy^ Py( ) jf  ׆ӆ #!j PFR0v APwQ cPwQxRy" Q0EF$ЫUfd$*:6 res& a[H'K ,d X p 0 q ' ` u 31 QG P  dPx Px! 8 Ɖ‰|     ?= YW om    v 1PP1&Q EP&" Q0"#E 9 #dst49 #srcI$ok%&pc? '(]EE &msk'(]EE &ofs %&num %)msk)i %'( @  %E  %)res  %%)i %%@ %w"qE  #dst4#srcI9 %&pc? ' (?FE &msk' (?FE &ofs %&num %&msk%&i%' (@ %(D%&i%%(@ %*LELE^ *j*EEZ *7F7FV *EEP *DD6 *DD9 *" " h*OFOFB *cFcFF *EE0*EE3*>> .$  FdذintFKP]OO`3ly- m[:;& & yFذ &ڊ֊PP1& FF4=  Fdint%=F/,DKuP]%O`=l- m / ` =/O1 # a*[: ; 4y > @h j 4z =? " 4[  4 4 "4 %4  (?( +0 .8 2J@ 6PH 94P =4X A`T Ch Fp  Ixe L P$ T7 [ ` rf t'g w y { }   ? 4l . _ > R    %( 0 8id %@ %H 4P  X  `/ h p x u   "A  &    %   Y ] h 4B ^ 4 :" E ?T E} F& G Hn8 VT  4 ~ Z          @]jmpA B/CX ( c &z6 22 n/!  % =?c/!'/'/( %J0) =D/S`0. buf/ $ 5 5end 5 5ptr 5 a 5G$ 5 5 4 73 8 4 9 E : 4. <3 <3end <3 <3ptr <3 a <3G$ < < d >n ? 4mem @ Emax A ER C Cend C Cptr C a CG$ C C 9 4 =z , =FV FZ48l  Z(4FZ54& pid\%VR3E\ %t[\%xt P !PP"X h !Pt1&!Ql!Rd"p !Pt# !Q0FE4L  .E%4pidG%3EG %t"  p !Pl"  !Pt#4 !Q0$F*4 %pid*'%ދ3E*0%%, ^\O,vt&st-4DF-H'F-%res. 4(tg B4"  L( !P1!Q0 `( !P2!Q0 ( !P1!Q1"4 #Ա( !Q2 )G))FFd)>> )j)FFM*)l l ,)=C=Cd% $ > &I: ; 9 I$ >  : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I 4: ; 9 IB U11B1 .?<n!.?<n: ; 9 ".?<n: ;9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8  : ; 9  : ; 9 I I !I/ .?: ; 9 'I@B : ; 9 IB U4: ; 9 I1B11.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > $ > : ; 9 I : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > &I$ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 I U 4: ; 9 IB  I% $ > $ > &I: ; 9 I> I: ; 9 ( : ;9 I  I .?: ; 9 '@B : ; 9 IB 4: ; 9 IB 1B1B.?: ; 9 'I@B: ; 9 IB4: ; 9 IB U11RB UX Y W 1B 1U41B1.: ; 9 'I : ; 9 I 4: ; 9 I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 1 B 1  I .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB 4: ; 9 IB 1 B 1  I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB 4: ; 9 IB 4: ; 9 IB 1 B 11 I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % : ; 9 I$ > $ > &I  I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9  : ;9 !.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I  4: ; 9 IB!1RB UX Y W "1B# U$41B%41& 1U'1(B)1*1+ U,.: ; 9 'I -: ; 9 I.4: ; 9 I/4: ; 9 I0 1.?<n: ; 2.?<n: ; 9 3.?<n4.?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I 4: ; 9 IB 1 B 1 I!I/ I.?<n: ;9 .?<n: ; 9 % : ; 9 I$ > $ >  I&I : ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB4: ; 9 I U4: ; 9 IB11B !I/!: ; 9 IB".: ; 9 'I@B# $'I%I&B1'.?<n: ; 9 (.?<n: ;9 ).?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I1 B 1 I !I/ .?<n: ;9 .?<n: ; 9 % : ; 9 I$ > $ > &I : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 11B !I/!.?<n".?<n: ; 9 #.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ;9  : ;9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB1BB11.: ; 9 'I@B4: ; 9 I4: ; 9 IB  .?<n: ;9 !.?<n: ; 9 ".?<n% $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ;9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB1RB UX Y W 1B1BB11.: ; 9 'I@B4: ; 9 I4: ; 9 IB !.: ; 9 'I ": ; 9 I#.?<n: ;9 $.?<n: ; 9 %.?<n% $ > $ > : ; 9 I &I I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I4: ; 9 IB 11B1 .: ; 9 'I@B!.?<n".?<n: ; 9 #.?<n: ;9 % $ > $ >  &I: ; 9 I I' I > I: ; 9  ( (  : ; 9  : ; 9 I8  : ; 9 I8 I!I'I> I: ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 IB U1B1!I/ .: ; 9 '@B 1RB UX Y W !1B" U#41B$1%B1&.: ; 9 'I ': ; 9 I(4: ; 9 I).?<n: ; *.?<n: ; 9 +.?<n: ;9 % $ > $ >  I: ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1 B 1 : ; 9 IB.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 4: ; 9 IB 1 B 1 1 I.?<n: ; 9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I4: ; 9 IB 1 B!1"1RB X Y W #1B$.: ; 9 'I@B% U&.?: ; 9 '@B'1(1RB UX Y W )4: ; 9 I*B1+.: ; 9 'I ,: ; 9 I-.?<n: ; 9 ..?<n: ;9 /.?<n% $ > $ > : ; 9 I I : ; 9  : ; 9 I8  : ; 9  : ; 9 I I !I/ .?: ; 9 'I@B : ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B B1 1 .?<n: ; 9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<> I: ; 9 ( ((&I7I : ;9 I8  : ; 9  : ; 9 I : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB 4: ; 9 I!4: ; 9 I"4: ; 9 IB# $1%1&B'1(.?<n).?<n: ; 9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 : ;9 I> I: ; 9  ( ( ( .?: ; 9 'I@B : ; 9 IB4: ; 9 IB11BB11.: ; 9 'I@B4: ; 9 I U4: ; 9 I1RB UX Y W 1B.?: ;9 n'I : ;9 I I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B11.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 B 1 .?<n: ; 9 % $ > $ >  I: ; 9 I4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1RB UX Y W  1 B B1B1.: ; 9 'I .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB 1 B 1 I !I/.?<n: ; 9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB 1 B B1 4: ; 9 I 1.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U1B11.?<n: ;9 .?<n.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB : ; 9 IB 4: ; 9 I 4: ; 9 IB 4: ; 9 IB 1B1.?<n: ; 9 % $ > $ > &I: ; 9 II!I/ 4: ; 9 I .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB 4: ; 9 IB 1B1B11.?<n: ;9 .?<n: ; 9 % $ > &I$ > : ; 9 I > I: ; 9 (  I > I: ; 9  ( I !4: ; 9 I?< : ; 9  : ; 9 I8 .?: ; 9 '@B: ; 9 IB: ; 9 IB4: ; 9 IB1B1B1.?: ; 9 'I@B: ; 9 I4: ; 9 IB4: ; 9 I  U1RB UX Y W  1B! 1U"41B#41$1%1RB X Y W &41'!I/ (.: ; 9 'I ): ; 9 I*: ; 9 I+4: ; 9 I,.?: ;9 n'I -: ;9 I. /4: ; 9 I0.?<n: ;9 1.?<n2.?<n: ; 9 % $ > &I: ; 9 I$ >   I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<4: ; 9 I> I: ; 9 ( .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB4: ; 9 I U11B .?<n!.?<n: ; 9 % $ > $ > I!I/ : ; 9 I.?: ; 9 'I@B: ; 9 IB 4: ; 9 I 4: ; 9 IB 1 B 1.?<n: ; 9 .?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 !I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1 !I/!.?<n".?<n: ; 9 #.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U1B11!I/.?<n: ; 9 .?<n .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   : ; 9  : ; 9 I8 I !I/  : ; 9  : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 I 4: ; 9 IB! "1RB UX Y W #1$ U%41&41B'1(B)1*1+.: ; 9 'I@B, - U..: ; 9 'I /: ; 9 I04: ; 9 I1.?<n: ; 9 2.?<n3.?<n: ;9 4.?<n: ; % : ; 9 I$ > $ > &I : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<> I: ; 9 ( (( : ; 9  : ; 9 I : ;9 I8  : ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB1 : ; 9 IB!: ; 9 I"4: ; 9 IB#4: ; 9 IB$1%B&1'!I/(4: ; 9 I) * U+.?<n: ; 9 ,.?<n: ; -.?<n% $ > &I$ > : ; 9 II!I/ 4: ; 9 I .?: ; 9 'I@B : ; 9 IB : ; 9 IB 1 B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB 4: ; 9 I U 4: ; 9 I 4: ; 9 IB 1RB X Y W 14141B1B11.: ; 9 'I : ; 9 I4: ; 9 I.?<n: ; 9 .?<n: ;9 % $ > &I$ > : ; 9 I> I: ; 9 ( ( (  : ; 9  : ; 9 I8 I !I/  I7I<4: ; 9 I?.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB1B1.?<n: ; 9 % $ > &I$ > I!I/ : ; 9 I> I: ; 9  ( ( ( ! 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB1B1.?<n: ; 9 % $ > : ; 9 I$ >  &I : ; 9  : ; 9 I8 I !I/  : ; 9   I : ;9 I5I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8  : ;9  : ;9 I8 > I: ; 9 ( ( > I: ; 9 !4: ; 9 I" : ; 9 # : ; 9 I$.?: ;9 'I@B%: ;9 IB&: ;9 IB'4: ;9 IB(1)B*.?: ; 9 'I@B+: ; 9 IB,: ; 9 IB-: ; 9 I.: ; 9 I/4: ; 9 IB01RB UX Y W 11B2 U341441B5164: ; 9 I74: ; 9 I 84: ; 9 IB9 U:1;.: ; 9 'I <: ; 9 I=4: ; 9 I>.?<n: ; 9 ?.?<n: ;9 @.?<n% $ > $ > &I: ; 9 I  I : ; 9  : ; 9 I8 : ;9 I I !I/   : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8<: ; 9 I 4: ; 9 I?< : ; 9 I8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1RB UX Y W 1B1B11 : ; 9 IB!4: ; 9 IB"4: ; 9 I # $.: ; 9 'I@B% U& U'41B(.: ; 9 'I ): ; 9 I*: ; 9 I+4: ; 9 I,.?: ;9 n'I -: ;9 I..?<n: ;9 /.?<n: ; 9 0.?<n% $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 14: ; 9 I4: ; 9 IB U1B1.?<n.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 > I: ; 9 ( (  : ; 9  : ; 9 I I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I U4: ; 9 I 4: ; 9 IB1B 1.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I  I : ; 9  : ; 9 I8 I !I/ : ;9 I 5I   : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U!1"1#B$1%.?<n&.?<n: ;9 '.?<n: ; 9 % $ > &I: ; 9 I$ >   : ; 9  : ; 9 I8 I !I/ > I: ; 9  (  I: ;9 I5I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I4: ;9 I4G: ;9  .?: ;9 '@B!: ;9 IB": ;9 IB#4: ;9 IB$1%B&1'.?: ;9 'I@B(.?: ;9 '@B)1*4: ;9 I+4: ;9 I ,4: ;9 IB- U. /.?: ;9 'I 0: ;9 I14: ;9 I24: ;9 I3.1@B41B541B61RB X YW 7418.?<n: ; 9 9.?<n: ;9 :.?<n% $ > : ; 9 I I!I/ $ >  : ; 9  : ; 9 I8 : ; 9 I   : ; 9  : ; 9 I 8 : ; 9 I8 I   I : ; 9 : ;9 I5I  : ; 9  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 4: ; 9 I?< : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 I 4: ; 9 IB! U"1RB UX Y W #1B$ U%41&41B'1(B)1*1+.: ; 9 'I ,: ; 9 I-4: ; 9 I..?<n: ; 9 /.?<n0.?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 !I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U4: ; 9 I11B 1!!I/".?<n#.?<n: ; 9 $.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB 11B1.?<n.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB1 B 1 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 4: ; 9 IB 1 .?<n: ; 9 % $ > $ > : ; 9 I I'4: ; 9 I?<> I: ; 9  ( .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB 11B.?: ; 9 '@BB1.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB 1 B 1 1 .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB11BB1: ; 9 IB.: ; 9 'I@B4: ; 9 I4: ; 9 I4: ; 9 IB  .?<n: ; 9 !.?<n: ;9 ".?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB U 1 1 B 1 I.?<n: ; 9 .?<n: ;9 % $ > $ >  I: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 1 B1 1 B .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB11BB1: ; 9 IB.: ; 9 'I@B4: ; 9 I4: ; 9 I4: ; 9 IB  .?<n: ; 9 !.?<n: ;9 ".?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > &I: ; 9 I : ; 9  : ; 9 I8 > I: ; 9  ( I !I/ 4: ; 9 I .?: ; 9 'I@B: ; 9 IB4: ; 9 I1B1.: ; 9 'I@B: ; 9 IB4: ; 9 IB U4: ; 9 I 4: ; 9 IB  I.: ; 9 '@B1.?<n: ; 9 .?<n: ;9 .?<n: ; % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 B 1 1 .?<n: ; 9 % $ > $ > : ; 9 I  I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB 11B1.?<n.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 I!I/ : ; 9 I < .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB11BB1 I.?<n: ; 9 % $ > $ > : ; 9 I: ; 9 I<.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1 1 B  I.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I> I: ; 9 ( .?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 4: ; 9 IB U 1RB UX Y W  1 1U41B1B1 I.: ; 9 'I : ; 9 I 4: ; 9 I.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > &I: ; 9 I  : ; 9  : ; 9 I8 I !I/ : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB 1RB UX Y W !1B" 1#41B$1%1&B'1( U)4: ; 9 IB*4: ; 9 I+ ,.: ; 9 'I@B-: ; 9 IB.4: ; 9 I /.: ; 9 ' 0: ; 9 I1: ; 9 I2 34: ; 9 I4.?<n: ; 9 5.?<n%  I$ > &I$ > : ; 9 I4: ;9 I?<I !I/  : ; 9  : ; 9 I8 < .?: ; 9 'I@B: ; 9 IB: ; 9 I4: ; 9 IB4: ; 9 I4: ; 9 IB : ; 9  U 1B1.?<n: ; 9 % $ > &I$ > : ; 9 I5I I : ; 9  : ; 9 I8 I !I/ > I: ; 9  ( ( 4: ; 9 I : ; 9 4: ;9 I4: ;9 I.?: ;9 'I@B: ;9 IB: ;9 IB1B11RB UX YW 1B U 1 1U41B 1U 4: ;9 IB! 1".: ; 9 ' #: ; 9 I$ : ;9 % &4: ; 9 I' (4: ; 9 I)4: ;9 I*.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > &I: ; 9 I$ >   : ; 9  : ; 9 I8 I !I/ : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB 1!B"1#1$.: ; 9 'I@B%: ; 9 IB&4: ; 9 I'4: ; 9 I ( ).?<n: ; 9 *.?<nc /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlaccess.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.halloc.hsignals.hunistd.hDI3K-/-/2*2Ff*.2/.K/ /KL-.H i /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arpacamladdrofstr.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hin.hinet.hsocketaddr.hfail.hJJ /.(JL  K JjJ J#JW /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlchdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.hJK-/.1+1G+.g1/g/ g/KK-.H z /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/syschmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hstat.h@KK-/-/2*2F1+1+.*.2/g/ /KK-.H i /usr/include../../runtime/camlcst2constr.cstdint.hconfig.hmlvalues.hL.I /...Kf.J ./- ./4 ../../runtime/caml/usr/includecaml/usr/lib/gcc/arm-linux-gnueabihf/10/includecstringv.cmlvalues.hstdint.hconfig.hmisc.hcamlatomic.hmemory.hunixsupport.hstdatomic.hXL+ ~ ..~.J/ J"I#.i,JJK./%.-#. /"-. 0 ,/)../.  . 0 .f .  .K/-. /usr/include../../runtime/camlcamlexecv.cstdint.hconfig.hmisc.hmlvalues.hunixsupport.hmemory.hunistd.hsignals.hP<K-/-K-KfK-/;.- z.-/ P.KJ<*CJJKJPJP.J/ /JKJL/-// $.fw. .fw./2/ z4z/  f/". g-/ L H./G0e/ ..0. ..J/.K.K. ./ / -//K1  3) 3/)$/....-5.3../ /-/ .. +f t.89.8.9.. K3J /*89.8.9.. K .'f ,)f ...PJ fz. f3...L /usr/include../../runtime/camlcamlgetcwd.cstdint.hconfig.hmisc.hmlvalues.hunistd.halloc.hunixsupport.h(T& MK KH.J /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinetgethost.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hin.hnetdb.hsignals.hfail.halloc.hhT.-g.I/ *K 2 1+1K .1jL K ,0 K./K.(hH1(6JK.oJd .uJu /..U /..U&xf6.Q  vJ-  .I///.J&0. .K /Yf ./I, 0/'Jwf  ..Lf/ =/.J2*20 .K /&`f /usr/include../../runtime/camlgethostname.cstdint.hconfig.hmlvalues.hunistd.halloc.hWL /-/ / /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetnameinfo.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hnetdb.hfail.h@W$-f/-/.fe/y.5y.QyJ/ym/ /Z0K  J/  K -/ K-//.K.i.= /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlgetproto.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hnetdb.hfail.halloc.hxX-g./ #+K  K-/  / -/ KKKf/.uJJ. 0.K KK -&+5 , 0/K -*-.EJ /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlgetserv.cbyteswap.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hnetdb.hfail.halloc.hxY -g.-/ +K 1 K-/  ./  K-/ KKKv y.JJ/K.sJJ. L.)JJL gK -+5J 0.Jgc f. .KK I'+ /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/typescamlgmtime.cstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hstruct_tm.htime.halloc.hunixsupport.hZ 0, 0./.J/f/f/f/f/f/f/f/*/1M/ -K/K /HJJ[M/ -K/K /HJJ\-g.-/  .r.3 ./ 6r.4 ./y.5./J/ J//-./-/./K / -//  K I/  / - / -/ /./K.iJ. ../../runtime/caml/usr/includemmap_ba.ccamlatomic.hstdint.hconfig.hmlvalues.hbigarray.hcustom.hmemprof.hstdlib.h\]//.M).U+./S/.K1+*Jmy..w .-w..  J3z.1.f.J  0/ zJ/ / //0/. /0.K5- ./htf ...J 3 )// // / /D /usr/include../../runtime/camlcamlputenv.cstdint.hconfig.hmisc.hmlvalues.hstdlib.hunixsupport.hmemory.h^ . O.)JJL././ KN.v../. 1.Q LM.t. .  /usr/include../../runtime/camlcamlrename.cstdint.hconfig.hmisc.hmlvalues.hunixsupport.hmemory.hsignals.hstdio.h_.2*2J/g g. K/ /KKLHW /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlrmdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.h8`K-/.1+1G+.g1/g/ g/KK-.H ~ /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlsocketaddr.cbyteswap.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hstring.hunixsupport.h.`.K.-/..f-.-K-/ /-Ig. K/-//-.EJ  3..|a 0..a . /-K ./- J-K-K3)KC.: F..:2/V. / ./ K ,/ 2 #f..M i+/1. I / 3)K N. / Q../2/ m.0f-g-K.f/h,fg1.)JKZ  .v. / /;z. 2; LJ2 J1.   K -/ K./ fJ/.lJ  K -/c.f.0JJp /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arpacamlstrofaddr.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hin.hinet.halloc.hunixsupport.h,deJ./ 0H02Pz.4/ /H.J /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/include../../runtime/camltime.ctypes.htime_t.hstdint.hconfig.hmlvalues.halloc.htime.hd/./i // -X /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlunlink.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.hdK-/.1+1G+.g1/g/ g/KK-.H  /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arm-linux-gnueabihf/syscamlaccept_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hin.hun.hsocketaddr.hunixsupport.hsignals.hsocket.halloc.hsocket_type.hPe-g-/.f//  3) O 0 M)00 /N /.,/ K/K.fJ. M /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlbind_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.hDf f3 K.H. /usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/include../../runtime/camlcamlchannels_unix.cstat.htypes.hstruct_timespec.hstat.hstdint.hconfig.hmlvalues.hunistd.hsocketaddr.hsignals.hio.hunixsupport.herrno.hsocket.hsocket_type.hf% J|.. J.|KJ + ifrJJoJ - // .L2 fJTg.0/ g/K / --.0/ g/K / --  /usr/include../../runtime/camlcamlclose_unix.cstdint.hconfig.hmlvalues.hsignals.hunistd.hunixsupport.hg.0/ ..//KH ] /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlconnect_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsignals.hsocket.hunixsupport.h$h f3/ /Kd  /usr/include../../runtime/camlcamldup_unix.cstdint.hconfig.hmlvalues.hunixsupport.hfcntl.hh1/ -N /E. - /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sysenvir_unix.cstdint.hconfig.hmlvalues.hauxv.halloc.hh/-/JK 0 fjn...nJK fK *0 , /usr/include../../runtime/camlcamlerrmsg_unix.cstdint.hconfig.hmlvalues.hunixsupport.hsys.halloc.hPih/ f/T /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetpeername_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.h|i  P - / e/ /K H.v /usr/include../../runtime/camlgetpid_unix.cstdint.hconfig.hmlvalues.hunistd.hi /./T /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetsockname_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.hi  P - / e/ /K H.d /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sysgettimeofday_unix.ctypes.hstdint.hconfig.hstruct_timeval.hmlvalues.halloc.htime.h@jLg 4. . .4J/ // -v /usr/include../../runtime/camlisatty_unix.cstdint.hconfig.hmlvalues.hunistd.hj /.K^M /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamllink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hunixsupport.hsignals.hjK-/-K.fj*jFg*2/gg.K/.Ng J./KKK-.sJ0zf v.. /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamllisten_unix.cstdint.hconfig.hmlvalues.hsocket.hunixsupport.hk.-/.LH  /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamllockf_unix.ctypes.hfcntl.hstdint.hconfig.hmlvalues.hfcntl.hsignals.herrno.hunixsupport.h$lx. .w. 4/,/2 I.K .z -/-/'f /e/ ./K.WJN.// /l.N /e/ /K  i. Ks J .K  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/sys/usr/include../../runtime/camlcamllseek_unix.ctypes.htypes.hstdint.hconfig.hmlvalues.hio.hsignals.hunistd.halloc.hunixsupport.hhm*Jh/ +/ -"/gg /c k)360,K/  //g K I-  ../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bits/usr/include/usr/lib/gcc/arm-linux-gnueabihf/10/includecamlmmap_unix.cmlvalues.hstat.htypes.hstdint.hconfig.htypes.hcamlatomic.hio.hstdatomic.hconfname.hstat.hbigarray.hunistd.hmman.hfail.herrno.hsignals.hunixsupport.hn% Jv.  ./u.  .v./ .=J-1=,s...p. ./K+ + 0.M$G%.KK -/.LfK }j$ +M$+..// .."$-J JfJJ.6 g .+0 +03/ wJ .J2/#/-$.o /J.m  =fJ/ jK+I-/g/ifK }j$ +M$+.././ff.Jq KJf0Mf0.0-6 wJJ0!+/,0LLH.W /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlopen_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.halloc.hsignals.hfcntl.h$r:K-/-K-Kf+Ji+Pz.3)O/-)g 3/g-/./Q0.L//KN/-.nJ M Lq. /usr/include../../runtime/camlcamlpipe_unix.cstdint.hconfig.hmlvalues.hunixsupport.hunistd.halloc.hpsN. J g.J/f/tJ Lg /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlread_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hbigarray.hsignals.hunistd.hunixsupport.hstring.hsf/-/-K-/f. 3)/ /K ./-.sf .K-/-g.fy.Jy.5y.N*/z.2/-/0/ /K/-.sJ . Q\ /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlreadlink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.halloc.hunixsupport.hsignals.hunistd.hu#g-/.-/f*.2*2*2*gN/g/ /KK/-/..sf . O /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlrealpath_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hstdlib.halloc.hpvK-/..f*.2*2F2/gK././-.vJ4J( caml/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sysselect_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmathcalls.hsignals.halloc.hw#./K....NJgJ0).K. 0/ +0-,.3 -N-g-//L, L+./(J,J*../ ./ JKg./K J..vJ ..JxK-/-g. ./t.. v..Y Kv ./I/./ I/L./ Kig*IK .../ /K g -/K-/ -/ /- / -/ /./KK.lJ  /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlsendrecv_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hsocket.hunixsupport.hstring.hLz f/-/-K-/f.3) -// /K ./-.rf .f/-/-K-/fegeKRw..x6w . 1H0+// Z/K . /.,/ K/K.hf.  f3E3)3E3 /0/K/ /K /yf5yJ5y.5yJ5//./ /J/ /K / KJf0 /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamlshutdown_unix.cstdint.hconfig.hmlvalues.hsocket.hunixsupport.h<~6..J-/.LH . caml/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/typessleep_unix.cunixsupport.htypes.hstdint.hconfig.htime_t.hstruct_timespec.hmlvalues.hmathcalls.herrno.hsignals.htime.h~ K/iKz., E.~.wf/  /Jgf{ /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bitscaml/usr/include/arm-linux-gnueabihf/syssocket_unix.cstdint.hconfig.hmlvalues.hsockaddr.hsocket.hunixsupport.hsocket.hsocket_type.h*.L,(0.,0020 .,%. (,0 O /zJ. /usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bitssocketpair_unix.cstdint.hconfig.hmlvalues.hunixsupport.hsocket.halloc.hsocket_type.hi+(1.+.1000.H%.(,0 J g.J/f/uJ_ caml/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetsockopt_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hunistd.hsocket.hsocketaddr.hmathcalls.hsocket.halloc.hin.hP-g-g/./  wf!J N.w a"JJ9..-9K -L .YJ yf"J J b..bJl . i. ..uJ.M  ./ .t. JJy. w(N*M ././JNff JD.J0M/-K/./-g&0.@.0.4.@/JhJ//Jfh,0...L KH,0,0.L KH  /usr/include../../runtime/camlcamlkill.cstdint.hconfig.hmlvalues.hsignals.hsignal.hunixsupport.hԢ. 0../..L/G em /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/sysmkfifo.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hsignals.hstat.hK-/-/.f2*.j*2F+N/H/// /KL-.sJ .  /usr/include../../runtime/camlcamlnice.cstdint.hconfig.hmlvalues.herrno.hunistd.hunixsupport.h.0 .. 0,0 2K /H f.4V /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlopendir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hsignals.hdirent.halloc.h<K-/..f).3a k/g/g/KK g/.qJ . H /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlreaddir.ctypes.hstdint.hconfig.hmlvalues.hdirent.hsignals.hdirent.halloc.hunixsupport.hfail.h1/K/g/K / -)&2 /usr/include../../runtime/camlcamlrewinddir.cstdint.hconfig.hmlvalues.hdirent.hunixsupport.hP //K/G. /usr/include../../runtime/camlcamlsetgid.cstdint.hconfig.hmlvalues.hunistd.hunixsupport.h-/.K#H ? ../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/usr/include/usr/include/arm-linux-gnueabihf/syscaml/usr/lib/gcc/arm-linux-gnueabihf/10/includesetgroups.cmlvalues.htypes.hstdint.hconfig.htypes.hcamlatomic.hmemory.hgrp.hunixsupport.hstdatomic.h+ ~. ..~/J/-/'31J".LJL./KH , /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamlsetsid.ctypes.hstdint.hconfig.htypes.hmlvalues.hunistd.hunixsupport.h<0/K 3zJ. /usr/include../../runtime/camlcamlsetuid.cstdint.hconfig.hmlvalues.hunistd.hunixsupport.hl-/.K#H  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcamlsignals.ctypes.h__sigset_t.hsigset_t.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hsignals.hsignal.hunixsupport.herrno.hsigthread.halloc.h'-g./ /-e./ g . 0+/ 0- /-i . Q-.J8)O.c..h../ `/K*.g..,1.J -/ 0/K KHMcML #H J.#H KzJ/(I)../ / -/.J,/(I).K K#z GJ9. E.KK*.g..,1.J</ g/Kd.(fJ. .KK*.g..,1.J/ /K gd  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/sys/usr/include../../runtime/camlcamlspawn.ctypes.htypes.hstdint.hconfig.hmlvalues.hspawn.hunistd.hunixsupport.h#xRx.6xJ/ guJ  J/1 i +g ./ -/ .sJL / -//  .0 ..J / .%IM J/ ... ./Kgp ../ .. /-M ./KgK gvJ 5af JJ K /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bitscamltermios.cstdint.hconfig.hmlvalues.htermios.htermios-struct.htermios.hunixsupport.halloc.hЫNf.L %Ja..%.a.%.,a. ./ ., %I/f /,X8.;.,.81J H / / %J .&J'. %K . K;`. .Jf /,_..8k,J f  / /- / /J-"J#.  K gJJ / ,n . /.p/f /,z 4.,z. Q%J ..P.z.4.)z4.L$Qd.. .,$dJ,./ *.,T.,.-/. /8S;.,.81J  .- /  /&J'. $K J K.<. J,];....8h,.!/-N f ., /  /H. /  /$..$.. 2  /,j ..m / -. /  6w.0 .0f  .<..). .-/.LH -/.K#H -..J-/.LH -..f-/.LH  /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sysumask.cstdint.hconfig.hmlvalues.hstat.hذ /.K /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/syscamlwait.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.halloc.hsignals.hwait.hunixsupport.h*-g-//N*I./M f/ . g../K.pJ0d2  . / -3 K-/..JE K-/ M/ g/K gHM+1J// /K gH  | (DIBBPX B | $<JB B(j  B F  B | (tJBBHD B | (@KBBHR B | LTH\ | XLB  M4BV | p "W j |iX    0   * ( = Q f }  Ј     @j@  &  7 H XP [ m DI ~  |a  W0  LO iX d , ;XL Qq( m ԢD +:G YizT L LT Ȩ .J >H Vl|j s _ g@ *=  [|N m~X P  Jk4  n ;K \n(T@ M4 N` ^ d (U @Uhz< @L <0 DfX ( 0t H\$rL n x ذ (E[P pX_X ̭   8 /hm ?$L SdxgH jD `  Pi, ,; Ji [8l m~q`  , ] T~ +, >O_{$lD @W8  u +BRT k$ Л P  8 TP 0|GIT3 < ?" \%$b