ELF>`h@ @8@$# ,,!,!p --!-!$$PtdxxxQtdRtd,,!,!00GNU$,K1MP0 !@P˒BstHTD2 lFDaRHA @ ] K%C(OX$JA@( 8H, xaS)HP0" D "D     "#$&()+-0123459:;<@ABCDFHIJMNRSTVWXY[\]^_aegijmoqtvwa wiiSV|JL383~j#sVqִQmO2{gN`#U$h%ZM/<iB1:P Kj#TFDO&f8N蟫S^8 vy`!v%)(ufzFAP0TԼ'W9NO$hHH90nx\`ԯ{fE*uQ$~Uoc2:Fa2q܎# &! Y"8cU_jg0pOvӴwM|_&Jm$z/a"hn~]}8Bpʴ p>qX&.opFF\|qV xR%yCc,o%h̺*:PV1xsr'I 0A"4|˷TA\R(a9|L?"?~G3F[Ddr'BEGGN/C<5i(ָ˽5뚇9Y~5s YۚBXPu yɑhҟcN lYn*B1C3f*-9T਋Cc'J%s djDyFZ<qIcn fB;j u   N( E F 0   ,(  b`D e a  LX6 U z:x \N n !l l @ 8 !f* ; 0 ou Pi T^Z i b  / :s  e A r   .)E  e "} rGZ UWQ#> F |2 _zY'2:L"fr0i |  `.P   @DU )K f T 6 n  М& }[ @i  `Ah 9    З  MS Zy ` ^  P M Hp 5  n;G 0o]V 9  I   k 0Ek   d Z   P{O p5 p}m  ~  К /  `pX o  77 p   < Z lV Pj _ {f  Х@ pY  @v wgM }T  F _ D    P9   P 0  pH{ ,R P{  GD p( @z @h 0L  а8      p ~"+ o_ ;`  @m @,   `q @7!2 ЏB ` 1  Р pW  p-0 P }(    c Yx P^;  I  Ъ   Ћ pq  p x   .  ).   P(   P  `IX7! 0& @n]   0MD ) ' E  h@7!  @G{ p5t   ( 0A    A2   pe ^ p-T < p  0 F B[  4  H  9K   PyP V 7|  < {M   E  C0  B p j H7!  . , P^&  P 0V __gmon_start___fini_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizecaml_unix_access__tls_get_addrcaml_unix_check_pathcaml_convert_flag_listcaml_stat_strdupcaml_enter_blocking_sectioncaml_leave_blocking_sectioncaml_stat_freecaml_uerror__stack_chk_failcaml_unix_inet_addr_of_stringcaml_string_is_c_safeinet_ptoncaml_unix_alloc_inet_addrcaml_unix_alloc_inet6_addrcaml_failwithcaml_unix_chdircaml_unix_chmodcaml_unix_cst_to_constrcaml_unix_cstringvectcaml_stat_alloccaml_unix_errorcaml_unix_cstringvect_freecaml_unix_execvcaml_unix_execvecaml_unix_execvpcaml_unix_execvpe__errno_locationcaml_unix_fsynccaml_unix_mkdircaml_unix_exitcaml_unix_getaddrinfocaml_string_lengthcaml_bad_caml_statecaml_unix_socket_domain_tablecaml_unix_socket_type_table__memcpy_chkcaml_unix_alloc_sockaddrcaml_copy_stringcaml_alloc_smallfreeaddrinfocaml_unix_getcwdcaml_copy_string_arraycaml_alloc_arraycaml_atomcaml_alloc_initialized_stringcaml_unix_gethostbyaddrgethostbyaddr_rcaml_raise_not_foundcaml_unix_gethostbynamegethostbyname_rcaml_unix_gethostnamecaml_unix_getnameinfocaml_unix_get_sockaddrcaml_unix_getprotobynamecaml_unix_getprotobynumbercaml_unix_getservbynamecaml_unix_getservbyportcaml_unix_gmtimecaml_unix_localtimecaml_unix_mktimecaml_copy_doublecaml_ba_byte_sizecaml_ba_unmap_filecaml_unix_mapped_alloccaml_alloc_customcaml_memprof_sample_blockcaml_ba_comparecaml_ba_hashcaml_ba_serializecaml_ba_deserializecaml_unix_putenvcaml_stat_strconcatcaml_unix_unsetenvcaml_unix_renamecaml_unix_rmdirmemmovestrnlencaml_alloc_stringcaml_unix_string_of_inet_addrinet_ntopcaml_unix_time_unboxedcaml_unix_timecaml_unix_unlinkcaml_unix_acceptcaml_unix_cloexec_paccept4caml_unix_bind__fxstat64caml_unix_inchannel_of_filedescrcaml_ml_open_descriptor_incaml_unix_outchannel_of_filedescrcaml_ml_open_descriptor_outcaml_unix_closecaml_unix_connectcaml_unix_dupfcntlcaml_unix_environment_unsafecaml_unix_environmentgetauxvalcaml_unix_error_messagecaml_unix_code_of_unix_errorcaml_strerrorcaml_unix_getpeernamecaml_unix_getpidcaml_unix_getsocknamecaml_unix_gettimeofday_unboxedcaml_unix_gettimeofdaycaml_unix_isattycaml_unix_linklinkatcaml_unix_listencaml_unix_lockfcaml_unix_lseeklseek64caml_unix_lseek_64caml_copy_int64caml_unix_map_filecaml_invalid_argumentcaml_ba_element_sizesysconfmmap64pwrite64ftruncate64caml_unix_map_file_bytecodemsyncmunmapcaml_unix_openopen64caml_unix_cloexec_defaultcaml_unix_pipepipe2caml_unix_read__read_chkcaml_unix_read_bigarraycaml_unix_readlinkcaml_unix_realpath__fdelt_chkcaml_unix_selectmodfcaml_unix_recv__recv_chkcaml_unix_recvfrom__recvfrom_chkcaml_unix_send__memmove_chkcaml_unix_sendto_nativecaml_unix_sendtocaml_unix_shutdowncaml_unix_sleepnanosleepcaml_unix_socketcaml_unix_socketpaircaml_unix_getsockopt_auxcaml_unix_error_of_codecaml_alloc_somecaml_unix_setsockopt_auxcaml_unix_getsockoptcaml_unix_setsockoptnextaftercaml_unix_stat__xstat64caml_unix_lstat__lxstat64caml_unix_fstatcaml_unix_stat_64caml_unix_lstat_64caml_unix_fstat_64caml_unix_symlinkcaml_unix_has_symlinkcaml_unix_timesgetrusagecaml_unix_truncatecaml_unix_truncate_64caml_raisecaml_named_valuecaml_unix_set_cloexeccaml_unix_clear_cloexeccaml_unix_utimescaml_unix_writecaml_unix_write_bigarraycaml_unix_single_writecaml_unix_alarmcaml_unix_chowncaml_unix_chrootcaml_unix_closedircaml_unix_dup2dup3caml_unix_fchmodcaml_unix_fchowncaml_unix_set_nonblockcaml_unix_clear_nonblockcaml_unix_set_close_on_execcaml_unix_clear_close_on_execcaml_atfork_parentcaml_ev_lifecyclecaml_atfork_childcaml_runtime_events_post_forkcaml_unix_forkcaml_domain_is_multicorecaml_atfork_hookcaml_debugger_in_usecaml_debugger_fork_modecaml_debugger_cleanup_forkcaml_unix_ftruncatecaml_unix_ftruncate_64caml_unix_getegidcaml_unix_geteuidcaml_unix_getgidcaml_unix_getgrnamcaml_unix_getgrgidcaml_unix_getgroupscaml_stat_resizecaml_alloc_tuplecaml_unix_getlogincaml_unix_getppidcaml_unix_getpwnamcaml_unix_getpwuidcaml_unix_getuidcaml_unix_initgroupsceilcaml_unix_setitimercaml_unix_getitimercaml_unix_killcaml_convert_signal_numbercaml_process_pending_actionscaml_unix_mkfifocaml_unix_nicecaml_unix_opendircaml_unix_readdirreaddir64caml_raise_end_of_filecaml_unix_rewinddircaml_unix_setgidcaml_unix_setgroupscaml_unix_setsidcaml_unix_setuidsigemptysetsigaddsetsigismembercaml_rev_convert_signal_numbercaml_alloc_2caml_unix_sigprocmaskpthread_sigmaskcaml_unix_sigpendingcaml_pending_signalscaml_unix_sigsuspendcaml_unix_sigwaitcaml_unix_spawnposix_spawn_file_actions_initposix_spawn_file_actions_adddup2posix_spawn_file_actions_addcloseposix_spawn_file_actions_destroyposix_spawnposix_spawnpcaml_unix_tcgetattrcfgetospeedcfgetispeedcaml_unix_tcsetattrcfsetospeedcfsetispeedcaml_unix_tcsendbreakcaml_unix_tcdraincaml_unix_tcflushcaml_unix_tcflowcaml_unix_umaskcaml_unix_waitcaml_unix_waitpidlibm.so.6libpthread.so.0libc.so.6__environld-linux-x86-64.so.2_edata__bss_start_endGLIBC_2.3GLIBC_2.2.5GLIBC_2.16GLIBC_2.3.4GLIBC_2.15GLIBC_2.11GLIBC_2.10GLIBC_2.9GLIBC_2.4        ii  ui  ui   ii ti &2=Hii Sii ]ui ,!0i,!h,!p,!{,!,!-! -!(-!0-!8-!@-!`-! h-!p-!x-!-!6!6!7!7!x/! /!/!,/!%/!r/!_/!a/!i/!i/!/!/!/!f/!/!7!7!Y 7!(7!0! 0!(0!00!980!@0!H0!P0!X0!`0! h0! p0!x0! 0! 0!0!0!0!0!50!0!0!S0!0!M0!0!&0!0!0!1!1!1!1! 1!(1!01! 81!!@1!"H1!#P1!$X1!%`1!&h1!'p1!(x1!1!)1!*1!+1!-1!.1!Q1!/1!01!11!21!31!41!51!61!71!82!92!:2!;2! 2!<(2!=02!=82!@2!>H2!?P2!@X2!A`2!Bh2!Cp2!Dx2!E2!2!F2!G2!H2!I2!J2!2!K2!L2!N2!O2!P2!Q2!R2!S2!T3!U3!U3!V3!W 3!X(3!Z03![83!\@3!]H3!^P3!`X3!b`3!ch3!p3!dx3!e3!f3!g3!3!h3!j3!k3!l3!m3!n3!o3!p3!q3!r3!s3!t3!u4!v4!\4!w4!x 4!y(4!704!z84!{@4!|H4!}P4!~X4!`4!h4!p4!x4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!5!5!5!5! 5!(5!05!85!@5!H5!P5!X5!`5!h5!p5!x5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!6!6!6!6!l 6!(6!A06!86!@6!H6!P6!X6!`6!h6!p6!x6!6! 6!6!6!6!6!6!6!6!6!HH HtH52 %4 @%2 h%* h%" h% h% h% h% h% hp% h`% h P% h @% h 0% h % h % h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h %* h!%" h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6%z h7p%r h8`%j h9P%b h:@%Z h;0%R h< %J h=%B h>%: h?%2 h@%* hA%" hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV%z hWp%r hX`%j hYP%b hZ@%Z h[0%R h\ %J h]%B h^%: h_%2 h`%* ha%" hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv%z hwp%r hx`%j hyP%b hz@%Z h{0%R h| %J h}%B h~%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% fH= UH H9HtH Ht ]f.]@f.H= H5 UH)HHHH?HHtH Ht ]f]@f.=I u/H= UHt H= =H! ]fDUH]ffDAUATUSHHhH|$H4$dH%(HD$X1fH=B ffHH5cHHD$ H(HD$HD$LHHD$HD$(HHD$0Ld$H<$H5!H|$AHgDH AdHAt'HT$XdH3%(LuHh[]A\A]Ht$H=~fUSHH8dH%(HD$(12taHl$ H޿H9~%HmHL$(dH3 %(utHDBIfHP9|tHI9uHcHD DHDf.f.AVAUATUSLoI MHIHE1 fIH;%tjID$HI9uJHLd+HHIH)fH;HDHI9uKL[]A\A]A^ÿIHLUSHHH?Ht1DHcH|HuHH[]DATUHSH5zHZH5zH HHHIHrLZHRH=zHAUATIUSH5pzHHHH5ZzLH5KzHIHHLHIHLLHH=zH=f.ATUHSH5yHjH5yHHHHIHLjHbH=yHAVAUATIUH5ySHHH5zyLH5kyHIHHHLHIfLD0LHH5yHD@SHH$H|%t[H=x1 f.AUATUSHHHhHH|$H4$dH%(HD$X1fH= ffHH5xHHD$ L HD$HD$M$I$HD$HD$(HHD$0Ll$H|$zHRHQHt(HT$XdH3%(M$uHh[]A\A]Ht$H=w fDHHD@AWAVAUATUSHdH%(H$1H|$HHt$@HT$8fH= ffHHHaHD$HHH|$HHDŽ$HDŽ$H$HD$@HD$XH$HD$`H$HD$8HD$hHDŽ$HDŽ$H$H$H$H$HHD$XH$HD$`H$ HD$hH$(umDH+uHH$HRHHT$8t1HHD$`tHũ$fHL$pH$LLAMtLMtLEHD$XLl$pMfH= ffHAL0MDHH ^ HH$f.$$HH ^ HH$fHH L|$xL$H\$(Hl$0LLHD$H H$H$@HD$H$HD$H$HD$ HD$LpL$XHDŽ$PLHD$xHDŽ$HHD$HDŽ$L$@HDŽ$HH$`HD$ H$hDKpHsApAFIpDLPH{ H$H$zHHD1H$-Ht$HD$xIƋ{1ɺH4$I1ɋ{Lt$xIFHcC 1HTHD$xHPH$HD$xHPH$HD$xHP HD$xLHD$hHT$hHD$`HHT$XHD$`HPH[(HD$`HHD$XtSfH= ffHH(HJbfH|$@I8fDH|$HI fDH\$(Hl$0Ll$pL)HD$Xf.SHHHdH%(H$1Ht$HH$dH3%(uH[H=q1ifATUSHHpdH%(HD$h1fH= ffHH(HQHD$ LH$HD$HD$HHH;HD$8HD$HD$Ld$ HD$0HD$@HD$HD$(HD$HHD$HD$P.H{H$H8HD${HHsH=HE41HD$H$HHT$HPStKt6H@HT$HPLHL$hdH3 %(uKHp[]A\DH@fDH@fD1yHD$Lf.@HHATUSHH`'dH%(H$X'1HAH$HD$HL$DHA'PHD$PLD$PXZtHD$d@H|$HtH$X'dH3%(u,H`'[]A\foA H\$0)D$0ef.USHHX'dH%(H$H'1<HHHT$0Ht$LL$LD$'H#u8H0H|$Ht1H$H'dH3 %(uHX'[]@HD$Pf.S@HPHHdH%(HD$H1;HD$?>HT$HdH3%(uHP[AWAVIAUATIUSHdH%(H$1fH=. ffHHHJHD$ LHl$`HT$LHD$HHD$HHD$HD$L$HD$8HD$Ld$ HD$0HD$(HD$@HD$HD$HH53mLL$sAHLHAWt$AMxXZ|LLHD$1HD$HT$HD$HHD$HT$HPLH$dH3 %(HD$u!H[]A\A]A^A_D;VATUHSH`dH%(HD$X1fH= ffH5HHHD$LH$HD$HD$ HHH}HD$(HD$Ld$HD$HD$0H}H$1HD$uH$HHT$HPHcUHTHPLHL$XdH3 %(uH`[]A\;fDSHtHHt [H(HHHt HHf.@ATUHSHpdH%(HD$h1fH== ffHHHHD$ LHD$HD$HD$HHD$H}Ld$ HD$0HD$8HD$HD$(HD$@HD$HD$H}H}HD$H}HD$a1HD$HT$HHT$HPUfHTHPHT$HPLHL$hdH3 %(uHp[]A\vfDUSHHHt*HtHH$HtHH[]|f.fUSHHHHt(HHHfCHtHH[]@+f.S1H HcHTHHcSHTHPHcSHTHPHcS HTHPHcSHTHP HcSHTHP(HcSHTHP0HcSHTHP8{ HHHHP@[DHdH%(HD$1H,HH$ HtH>HL$dH3 %(uHH5fh1ҿHdH%(HD$1H,HH$+HtHHL$dH3 %(uHH5 h1ҿFAUATUSHHdH%(H$1fH= ffHH(H)HD$PLLl$H$HD$HHLHD$hHD$Ld$PHD$`HD$XHD$pHD$0HD$HCHD$HCHD$HCHD$HC HD$ HC(HD$$HC0HD$(HC8HD$,HHtlLfH$H*E1HD$tHT$HH$HPLH$dH3 %(u*HĨ[]A\A]@CH5f1ҿ"f.USH_HHCHtH(t.H[]HHH}HH[];HCHxHp'H{H[]AWAVAUATLcUSILcHdH4%(H$1EJ4 L1HHfHHDHH9uH= 1HxLpI1LoLHGfDHTHT HH9uHpLHHXH$dH3 %(LuBHĘ[]A\A]A^A_H= 1MHxLpILoLHGKf.ATUHSHtRHtFHdHH޿1HH}HILt[]A\H5`dHڿLH=DdH SHWtHt[H5dHڿ;H= dHf.fAUATIUSH5cHHH5cLHLHIzLHAwLHAtH[]A\A]H=xcHBfAUATUSHHhH|$dH%(HD$X1fH=f ffHH5f fAtDH5 Z1҉f.@USHHrHHpuHH[]H5Y1҉f.@SHH$H<%t[H=Y1 f.USHHHHHl$HT$ dH%(H$1HiT$ HH%t"H$dH3 %(uHĘ[]H=Y1y@SHEH1҉H1t HHD[H=X10Hq H8Ht L@11HHuH> H8Hu1HHHdH%(H$1HHH$dH3 %(uH f.SHHH\$HT$ D$ pdH%(H$1Ht-t$ HH$dH3 %(uHĐ[H=W1HGHHHDf.SHHH\$HT$ D$ pdH%(H$1HHt-t$ H"H$dH3 %(uHĐ[H=W1XH(1HdH%(HD$1ffHD$dH3%(H*D$^VH* $XuH(HHNf.@HHtHHHHÐAVAUATUSHpdH%(HD$h1H|$Ht$HT$fH=͛ ffHeHH)HD$ HH|$H5WHD$0HD$(HHD$Hl$ HD$8HD$HD$@HD$HD$H`H|$H5|WOH|$H|$IIHD$Ht}E1t^LLLAL,L$AtcHL$hdH3 %(HuXHp[]A\A]A^DLIEDE@LLAHt$H=V*DHHHt HH=T1@SHAH@dH%(HD$81HfDL$x/HD$HT$ H*HvTHcHHT$HHT$ f1H|$fT$_H|$HT$1RHL$8dH3 %(H@[f.1fD$HT$1H@AfDD$fH|$f|$h@ft$@HT$1fL$tf|$S H=QS1ATUISHHHKHDSHcLHHHH5HtH?H9HD[]A\H=R1H5R1ҿKEDATUHSHLfHHRHcHHLOHHt H[]A\EH=R1AWAVHAUATHUSHHIHHIi H<$AdH%(H$81AI@tH DxMpI IFHmMHL$ 1IcHL)Hx"HII9t&IHHJuH9tH=QMDHL$4$H$HL$%H5 H$Lc$J4HfDH HtLHH9uMcJ| N|%I9IX1HHH1EMID$I4II)1HHFIHL$ LDEH$8dH3%(HH[]A\A]A^A_@<$IOHt$D$}?8qH="Q1c[ofDH9tH)1HIJD IH9ulI4$H$tH l H$Lc$<$LaH=PH=:PuH=O)4H=UP1fDHOHWHwLO(LG H?$@USHHHzHu H[]fDH1HHH)HպHHwHHH[]fDAVAUATUSHpdH%(HD$h1H|$Ht$HT$fH=- ffHHHHD$ LH|$H5rOHl$HD$0HHD$HD$(Lt$ HD$8HD$HHD$@HD$HD$HH|$H5|O藿H|$H5+OA胿toAH|$>IDL1'HcLtWHL$hdH3 %(LHD-uLHp[]A\A]A^fuH t{f.kHt$H=`N%DHdH%(HD$1HE‰t;1Hc$HTHHcT$HTHPHL$dH3 %(uHH=xN1AWAVAUATIUSHHHhdH%(H$X1Ht$fH=& ffHL0MHD$MHHD$ HD$L|$PIHD$Ll$HD$(qHLHNӹHHcL۽HStSH|$HcHHLHeH$XdH3 %(MHDu)Hh[]A\A]A^A_@H=UM1xAWAVAUATUSHxdH%(HD$h1H|$Ht$HT$H $fH= ffHHHHD$ LLt$HD$0HD$(HHD$L,$L|$ Hl$IHD$8HD$IHD$@HD$HHD$HHHD$PHD$L`LK44HHt7HL$hdH3 %(LHD-u)Hx[]A\A]A^A_H=*L1HAVAUATUSH`dH%(H$X1H|$fH=я ffHiHHHD$LH|$H5KHD$ HD$HHD$Lt$PLl$HD$(sH|$)ILL1HLqtAHcLD,PH$XdH3 %(Lu(H`[]A\A]A^fkHt$H=K%DAUATUSHhdH%(HD$X1H|$fH= ffHQHHHD$LH|$H5JHD$ HD$HHD$Ld$HD$(`H|$1HHtAHHI艹HT$XdH3%(LLu%Hh[]A\A]@{Ht$H=,J5DAV1AUATIUHSHItiI]IHAHHv[I]HHwHHch ?)LHI HcEH9}]MmIu[1]A\A]A^D[]A\A]A^f.AWAVAUATIUSHHhdH%(HD$X1fH= ffH謽HHD$HD$ L0HD$HD$H$MIHHD$(HD$L|$HD$0AfDH$HXHH$tVHHHcHU ?)LHIt1轻HT-HHT$HPHD$DHD$Ht$XdH34%(MuHh[]A\A]A^A_DD@AWAVAUATIUSH(HL$H|$(H\$EJcHfHL$ HLD$HDDD$荲D$ HfDHL$ HLD$HDDLT$D$@LT$A HU>JcHHL$ HLD$HDDD$tXffH*D$(^;H*L$ X1Ht$xdH34%(LHĈ[]A\A]A^A_@H<$1腸DHcD$ HD@T$ D|$ 藸HHD$JtDHcD$$H|1[H4$1ҿ\藮ATUASHLH0dH%(HD$(1L$ HL$AHH $H,D$YT:HD$AH $T$ H,HD$HDHQH|$(dH3<%(ucH0[]A\f.IAHL$DL$L1ɃL$uIAHL$HD$AHL$q{H1ҿ,1HҶfHH | HHHcIH5q| H H2HT$XdH3%(L(Lu&Hh[]A\A]DHt$H=B̈́f.SHHt$HZHHtH{[H51ҿ @f.HH?HtHH5[1ҿ fHHt HH=51臍AUATUSHHLgI J,HkMIt!H|fDHHHHPH9uLLWL蝂tH[]A\A]H=1f.Hgt HHHDH=1ȌHHdt HH=]1藌USHHHHzfAWAVHAUATIUSHhL|$H4$H|$dH%(HD$X1LvL%f11H[Mt$;@H&H IEHcHHD4!HIHtMHsHHI}LLCHKHCDH+D IHLuL$$H |$LIMcB4迀5HT$XdH3%(Hh[]A\A]A^A_fDIELH{LC(HK H+C9H#A HcIHfDHH@IEHkHA2fDHHtNA A9HcutVuA4L}xtWHCH@LD!ɉfH5. 1ҿ]{DA4L1xH= 1HHHQ{t HH= 1贁@HHvt HH= 1臁HH HHcH4dxt HH= 1GHH HHcH4$t HH=I 1HHzHHDAVAUATUSHcH`dH%(HD$X1fH=I ffHyHD$HD$ L HD$HD$M$I$HD$HD$(Ll$AA@wDHD$|HHTHD$H1wHTHHT$HPM$HL$XdH3 %(uLH`[]A\A]A^Ð1wHD$H(DawHD$k-vHHf.SHdH%(HD$1V{H|$Uyt!t$eHT$dH3%(uH[H= 1!uf.fUSHH5HHdH%(HD$1(szHt$H߉B|xt"t$HL$dH3 %(uH[]H= 1~!uHHaccessinet_addr_of_stringchdirexecvexecveexecvpexecvpefsyncmkdirgetcwdgmtimelocaltimemktimeputenv=unsetenvrenamermdirstring_of_inet_addrunlinkacceptbindin_channel_of_descrout_channel_of_descrcloseconnectdupgetpeernamegetsockname.Alistenlockf0@XhlseekUnix.map_file: bad number of dimensionsUnix.map_file: negative dimensionUnix.map_file: file position exceeds file sizeUnix.map_file: file size doesn't match array dimensionsmap_fileopen@pipereadread_bigarrayreadlinkrealpathselectrecvrecvfromsendsendtoshutdownsleepeAsocket socketpairxx0x\LHt   )setsockoptsetsockopt_intsetsockopt_optintsetsockopt_floatsetsockopt_errorgetsockoptgetsockopt_intgetsockopt_optintgetsockopt_floatgetsockopt_errorlstatfstat@ `?symlinkUnix.Unix_errorException Unix.Unix_error not initialized, please link unix.cma  #!$% &' " srXYZ[\]^_`abcdefghijklmnopq(Kutimeswrite_bigarraysingle_writechrootclosedirdup2fchmodfchownset_nonblockclear_nonblockset_close_on_execUnix.fork may not be called after any domain has been spawnedforkftruncategetgrnamgetgrgidgetgroupsgetlogingetpwnamgetpwuidinitgroupssetitimergetitimerkillmkfifoniceopendirreaddirrewinddirsetgidsetgroupssetsidsetuidsigprocmasksigpendingsigsuspendsigwaitcreate_processtcgetattrtcsetattrtcsendbreaktcdraintcflushtcflow2Kn,X   `  %K @B  `  %& -g5 = @0 0@@     @  waitpid;XdqrsXxthuhvv w`w(xxyy y@zz H Ȃ\ ؂p ȃ ؄ xh x ؇  X< h 8 @ 8 Ȏ  ` `8Xxh@(pXx@`ؚtx <X8pȞx0X`XxؤX@ئ`8XHH8$Xxh,HtXxh(صXX(@84x0(P888,X(xXxPhX8xPhHHx8Xx$<8`8 x8 d 8 ( H 0!8\!!!!!"L"p"H"X"#@#`#8#h##($X $H$$H$$x%@%x%%,&8H&hd&&&&h& 'zRx $x^ FJ w?;*3$"Dk<\lBBA A(G (A ABBA ,xmAAGPN AAG <mBBA A(G (A ABBA < nBBA A(J (A ABBA LXoV<doBBB A(A0 (A BBBA $ p;AAG hDA8p]BAD $xpBBD A(Q0p]BAD ,4 qBBB D(H0dq5Ae A <qBBA A(J (A ABBA `r DLXrBBB B(A0A8G= 8A0A(B BBBH $,wgAL E AA 4TxBAA G;  AABF hy dy @`yBAA JOSOFOTOAO}  AABC ( zAAJN AAE $$zMAI`| AA \LzBBE B(D0A8G**H*a*A*m 8A0A(B BBBF 0|BAD D  AABI |(AZ H |"DT E 4|*BAD D   AABD (T}DAAJ i DAE (~EAAM g DAE 8~A~_D B A ~_D B A @4BBA A(JM (A ABBE <DhAAH T AAH S DAH YAAL5BBH B(D0A8M 8A0A(B BBBA ,BAD U FBA DA_ A <$0BBD A(N0\ (F ABBA <dBBA A(G (A ABBA (0AAG AAG   `LBBD A(J0c (A ABBD N (A ABBD E (A ABBA D\BBE A(D0G 0A(A BBBH $PAG`Q AF DODI<BBA A(G (A ABBA D< h@BBB A(D0J 0A(A BBBF , `AAPX AAA AP AF ( lBAAG _ DAE , BAAG _ DAE 4 5Ae A ,T ЉAAPd AAA  0@Ap A  P \9Dd H D xVGI A $ }AJ] AA $ DK$< }AJ] AA d pYD0O A  DI DRD BBB A(A0D& 0A(A BBBF  ,DY A $ AMP AK ,D p{BAD O ABA ,t YBAD | ABE L BBE B(D0A8S 8A0A(B BBBE  0 ZAAO N AAG eGAD< ؑ{BBB A(A0D" 0A(A BBBJ  D h A L p(BBB B(D0A8M 8A0A(B BBBE L P(BBB B(A0A8D 8A0A(B BBBH DD0BBB A(A0G! 0A(A BBBC <BBA A(D (A ABBE HBDG D(D0t (C BBBF A(F BBBL<BBB B(D0A8G  8A0A(B BBBF Ph BBB B(D0A8G 8A0A(B BBBA Lؙ@BBE B(D0A8M 8A0A(B BBBD ` ȚBBE B(D0A8MWWAt 8A0A(B BBBC Dp4BBE A(H0S 0A(A BBBA L̜BBE B(H0A8S 8A0A(B BBBA 9N\ A ,<AAH@ AAA ,l8hEAK @ FBA 4xBAD J0  AABA LIBBE B(D0A8M 8A0A(B BBBE 0$.BAD LP  AABK X7l(8<PBBD A(J (A ABBB @ABBB A(A0J 0A(A BBBA @ABBB A(A0J 0A(A BBBA (L(AAM| AAA @x BBB A(A0J 0A(A BBBA @ BBB A(A0J 0A(A BBBA (TAAJa AAA D,CBBB A(A0D  0A(A BBBG t-D_ E ,ЪAAQ DAA 8BBA A(J (A ABBA 8tBBA A(G (A ABBA <8FAf I U\h'(pABBD A(JAAJ (,AAJ M AAA (GBAC r ABA ((ܮGBAC r ABA <TBBA A(J# (A ABBG LBBE B(D0A8J3 8A0A(B BBBI LBBB B(A0A8GK 8A0A(B BBBJ D4HBBE A(D0J 0A(A BBBJ |DND BBB A(D0G 0A(A BBBF <BBA A(D (A ABBJ 4BAA D  AABD 4TPAAM h FAB yFA,HAAJ f FAA ,ȶMBAD o FBA IAy A IAy A $PKS<XKST` h\DP dAN A (зHAAJ f FAA (FAAJ d FAA DK DK,(DK4D02BAD D  AABE (|8^AAG { DAG (l^AAJ p DAO ,BAC  ABA 0-DQ E $@DK4<HBAA Ge  AABD (t^AAG { DAG (Ի^AAJ p DAO DK,VAAJ ` FAA (@sAAG0b AAA @]A[0\ؼBAD Jpm  AABA DfAJ@F AA ;Dh A < BBA A(D (A ABBG ,MAAJ _ HAD <DBBA A(D (A ABBF pEAg E .DV A )DV A <BBA A(G0_ (F ABBA $(DP F D )DV A $d0FAAM tAA@XBBB A(D0I 0A(A BBBA 0BAH Mu  AABA 0BAA G  AABA 8}AGV AA $\XAGg AA LoBBE B(D0A8T 8A0A(B BBBG H7BBE B(A0A8D 8A0A(B BBBE L MBBE B(D0A8D 8A0A(B BBBG p ,DY A  )DV A  9N\ A  9N\ A  @DN@ HUBBB A(C0G 0A(A BBBB @!ddAD J AA (d!AAQ0V AAA 0ihp{  Z ,!,!o*0 g 0!(FB oAoo>o-!ZZ[[&[6[F[V[f[v[[[[[[[[[\\&\6\F\V\f\v\\\\\\\\\]]&]6]F]V]f]v]]]]]]]]]^^&^6^F^V^f^v^^^^^^^^^__&_6_F_V_f_v_________``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFgVgfgvggggggggghh&h6hFh6!GCC: (Ubuntu 7.5.0-3ubuntu1~18.04) 7.5.0,@i,$Pj,j,_)k,*8lV<`A@mn;,P@n],_n<m0o]o,~~ p5,T`p,`q ,|pq,ܲ wglw0y @y Py@z,>{M,}P{L/|}( ~"LP~*DE\ __p<uhp5<6%@D,5,XD lR 0L,f0<2qЋ,V{,@, LhBЏB,J 5,"`,@<0P9,V,g},p,.}<Yp,W,$,k0@,,:p<D{pYL3SЗКZ,mP{,IzМ<P((,#,3РLp<lХ@Ъ, 9,0,h,P\{I`.7а8A`Ap  <8 Cp-,D<UhF'0A,G@G,}L6PH,@, ,, ,,pH,M\I`IL  <HF,n P,p, Lm)2^P^, 6,Ap-,@KLTP^^,a,j0V\ts]pf,φ;, ,M, ,0E,.,F),,"p(,)|UF p},9o|70M,)9 9,%`Lu.UdP   ;f intB ^ k ` # +) ) )g% .a)-d; l ma / fj }j  x  O0 7-MS .A  /A 0A 1A j2A 3A p4A  L    =y ";  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X Q`B Wh Bp Bth xI c q ]X ml % -+ .2 /9 0@ 20^D 3B$ 5s  : Q ] Q d W 2 B m;;  ?  @ Y A W W W B  |;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtpwy' {2 }= ) ' P C l|[ _ G  ? B(l/0N 8idB@ BH |PT X- T `Jhpx+` Jk  8 W BǴtv xˁ I ̆|  E ' F" G 8 HR p2@' ^'   Y - 8 dI  [ Ef q | L &2  j  Jj 7 |  |#A2U3&/3385 5 end5  5 ptr5  5 5/( 5/0j 7 v 8| m9 :|8< < end<  < ptr<  < R ?|mem@maxAj8C C endC  C ptrC  C C/( C/0! SMH TMHUMBVM [7 ] ;@   8 ;~ Z( =rMsMi ; "u  $C2B 7B ;B uB B4 6B 7B  I ; &  J3|@i!53|! 3|#"z 5F"{5' 5#5B$p6$ret7B""7BJ%j "B|&i 'Us'T &i+'T (i(i&ic'Us'T}(i&j'Us&Bj'U (Gj' )l)##G))*TT") )S)d d j+ 7 kPP ;f int ^ k ` %W '^ )e# +) ) )g%  s .a)-d; l ma l fe }e  x  O0 7 -  .~  /~  0~ 1~ j 2~ 3~ p 4~   /   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B  h Bp Bth xI ^ l X "l % -+ .2 /9 0@ 20^D 3B$ 5(  :  ]  d  2 BN";8;  ?8  @8 Y A8    B   <;?"; ;p BqB^"BQ %B  (M( +0 .82X@^ 6^H 9BP=BXAi`2CthFpIx L P T[{ `rt0wy{}) ' P l<[ _ G  ? B(ll08idB@ BH <PX- `Jhpx+J  8 W Bt x I BΨ < H SMd2o@ ^   ; z$  E  L &25  BK ; "W  $C2B 7B ;B uB   !        ; ; ;+ ڸ  U+  +  <PjR s< 2C  D @!jR "U2"Ts"Qv!j] "Uv!jR "U:"Ts"Qv#jh "Uv!njs % "Us!j D "U $j %aa:%P%::T&ww q%b'4 pl ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  wjC w!z C:!{" v"#B$pI$retB%k !$w>&hkO 'Us'T (rkZ(zke&kp 'Us(k|&k'Us&k5'U (k" )l))*) )S)d d j+k C^ k f ` int# +e e eg >% Za  .ae-d> l m* f7 }7  x  O 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y >  S e  S e i. 5 B ; >   U9 S d     1 () 0 8r @ H P X L`B Rh Sp Sth lxI 0 E XX hl %w -+ .2 /9 0@ 2^D 3S$ 5n  : L ] L d R 2 Sh>~>  ?~  @~ Y A~ R R R S  w >?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? S(l*0I 8idS@ SH wPO X- O `Jhpx+[ Jf  8 W Sǡtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  7  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] >@   3 >~ Z# =rHsHd > "p  $C2S 7S ;S uS S4 6S 7S  wkg 5wv w!z g!{" "#S$p m.$ret!Sw!"S%l !*w&lls 'Uv'T (vl~(~l&l'Uv'Ts(l&l:'Uv&lY'U (l" )l))*) )S)d d j+2  %  ;f intB ^ k ` # +) ) )g% .a)-d; l ma / fj }j  x  O0 7-MS .A  /A 0A 1A j2A 3A p4A    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    B[P [ v;? " p q^"Q %  (( +0 .82@^ 6!H 9P=XA,`2C7hFpIx L P T[{ `rtwyB{M}X) ' P ^l[ _ G d ? B(l/0p8idB@ BH PvX- v`Jhpx+J 8 W BǴtȘxˣI k    '22=HS k }EL & 2 lV/ nBUtbl/ TB3BR iBI5C  `l  ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 eg   :    X 7 -  .y /y 0y 1yj 2y 3yp 4y  L   = y7  Z; J B ) J B ) i .  5 B;_< >  \ U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 Bc;\; ? @Y A    B& & AQ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C' hFpIx L P T[{ `rtwyj {u } ) ' P  l[ _ G  ? B(l*0 8idB@ BH P X-  `Jhpx+ J  8 W Bǯtȹ x I 6  E ' Fe G 8 H p2" @j ^j    - p {    E   L &Q2  e J  j 7 |  |#A2U3&/3385 5 end5  5 ptr5  5 5*( 5*0j 7 v 8 m9 :8<^ <^ end<^  <^ ptr<^  <^ <*( <*0 > ?mem@maxAj8C C endC  C ptrC  C C*( C*0d SH THUBV [7 ]N ;@> N N { ;~ Zk =rs ;"  $C2B 7B ;B uB B4- 6B 7B - h(n; v( !i*B<" n#;n$UU %2 @m args&2!res '(8!i("{m )m$UF$T~(0\!i""m"*Hm+,Hm- ."m-)m-$U8/+0val1223S4wwq3h33OOZv  ^  ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  Nw@n] 5w, kwb !H !f% "Vn+r #Us#T "en6 #Uv#T "pnA #Us"~nL #U|#Tv"nX #U|"nc #Uv$nn#U #Ts%l%22r%&XX6%S%hhs%d d j u, ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  ~wn 5w kwP !envw "f "p "HT #n $Us$T  #n $U|$T  #n $Uv$T  #n $Us#n$U}$T|$Qv#o.$U}# oF$U|#o^$Uv%#o$U  $Ts&l&22r&'*&S&hhs&d d j j 4f  int[IgT-kT.k ^k ` # +| | |% .a|-d4 l ma K f }  x  O) 7 -io  .]  /]  0] 1] j 2] 3] p 4]  LT  I   = y  k34 # B | # B |  B i .  5 B ; >  6 U9 B d k k  k k 1 k() k0 k8r k@ kH kP kX n`B th Bp Bth xI ;  zX l % -+ .2 /9 0@ 2)^D 3B$ 5  : n ] n d t 2 B=T46T4  ?  @ Y A t t tBOB 1A4?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C hFpIx L P T[{ `rtwyZ {e }p ) ' P v l[ _ G  ? B(lK0 8idB@ BH P X-  `Jhpx+ J  8 W Btȩ x˴ I ̹&   E ' FU G 8 H p2 @Z ^Z     ` k |   E   L &A2    Jj 7 |  |#A2U3&/3 385 5 end5  5 ptr5  5 5K( 5K0 j 7 v 8 m9 : 8 ?mem@maxA j8C C endC  C ptrC  C CK( CK0T SiH TiHUiBVi [7 ]O> 4@. > > k 4~ Z[ =risi 4 " k $  $kC2B 7B ;B uB B 4) 6B 7B ) .o 5. k. !env. "f0X "p1 "H2 #err3B^$o %Us%T .$o*%U|%T .$o*+%Uv%T .$o5C%Us$o@g%U}%T|%Qv&oL$oW%U}$pb%U|$ pb%Uv'pm%U~%T .%Qs 0o] 5 k0 "f| "H $For%Us%T '$Uo*%Uv%T '$`o5%Us$nox%U|%Tv$voW%U|$~ob%Uv'o%U '%Ts(l(22r()Q(%(S(hhs(h)E(d d j  5 ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB% p5 v retB!fd!Bj,p 4p z Us;p !Up U 6 T0"#//" "d d j = }^ k f ` int# +e e eg >% Za  .ae-d> l m* f7 }7  x  O 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y >  S e  S e i. 5 B ; >   U9 S d     1 () 0 8r @ H P X L`B Rh Sp Sth lxI 0 E XX hl %w -+ .2 /9 0@ 2^D 3S$ 5n  : L ] L d R 2 Sh>~>  ?~  @~ Y A~ R R R S  w >?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? S(l*0I 8idS@ SH wPO X- O `Jhpx+[ Jf  8 W Sǡtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  7  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] >@   3 >~ Z# =rHsHd > "p  $C2S 7S ;S uS S4 6S 7S  Ew`pg 5w w!z g!{" +"#S$p ma$ret!S!"S%*q !*w.&ps 'Uv'T <(p~(p&q'Uv'Ts(q&q:'Uv&UqY'U <(Zq" )l))*OO=) )S)d d j+Y  d@ ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBU`q P nflqP UU1&^^^\ ~`Y 4f  intB`NgY ^k ` %z '; )# +e e eY Ł%   .ae-d4 l m'a ZO   f }   x  O) 7 -  . / 0 1j 2 3p 4  #3N3[  i .  52 B ;2   U9 B d     1 () 0 8r @ H P X '`B -h Bp Bth xI ;  3X Cl % -+ .2 /9 0@ 2)^D 3B$ 5I  : ' ] ' d - 2 BoYC4YY4 ?Y @YY AY - - -BT ]4?"\ \p cqc^"cQ %c  (n( +0 .282y@^ 6H 9cP=cXA`2ChF=pI=x L= P= T=[={ `2r=tQw=y{}) 2' 2P l]2[== =_ =G  ? B(l0 8idB@ BH ]P X-  `J=h=p2x2+2 J#  ==8 =2W= B22t. x9 I c ] i tn2 @ ^ 2 2 \ E    E ) 4 L &2V ? cl 4 ""  $C2B 7B ;B uBO;  ,  Y 4 8n& D  & Y6 4k  Z !6 FwՏ ׏  ؟  ٯ  4 4 4  e  U   0  Z  A  60 z@ 4 k , Z % p0 1 2 33 5@ :l 05F 7Bb8By9B::B x;l $<F = >L (  I] R "] #] !<]pq"\<]"<]"<]#z >#{>$P>}#>BS$?]|%v?]|%e?]|$ ?}#?B#]@#@$A |%resBL |#PCB{&r #F]'f(rxL )syM*D+,,-|-|- |-~,"--~,77)u .*m**.u/U|/Q~/Rp0B^v,C1u/U|/T~/Q 2u1u/U5/T01u,/T{/Q3/R0.v/Tw/Q4/R0.ov/U2/T0&tn#])Ps`U*v'*kL*`p1r/UU2r2r2s2s1s7/U}/T|/Q|/R|2s1s)\/U}1s)t/U|2%t42v?2v?1wJ/U}2wV3%]P4a%L 5z '5{'5(]5(]5[(]5 (5(B6sa) 6len* 759]8f;9;9;B9;)899U9): ;M;mm2;??,;  ;   O U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 BV  ;O  ; ? @Y A B  4 D ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C hFpIx L P T[{ `rtwy] {h }s ) ' P y l[ _ G  ? B(lZ0 8idB@ BH P X-  `Jhpx+ J  8 W Bǯt x I ̼)   E ' F G 8 H: p2 @] ^]   A  c n    E @ jmpA B]  uC  L &D2   )! ; g!R ' (B@ ) H ! b ;SR . buf/b m e  Jj 7 |  |#A2U3&/3 385k 5k end5k  5k ptr5k  5k 5Z( 5Z0 j 7 v 8 m9 : 8< < end<  < ptr<  < : ?mem@maxA j8C C endC  C ptrC  C CZ( CZ0 SxH TxHUxBVx [7 ]  ;@   ;~ Z =rxsx Q ;"]  $C2B 7B ;B uB B  4  6B 7B !& wg"5&#{9(_$ret)%!w*l&&'Kw(Us(T )Xw(Us)w(U B(T0*w +;,ȝ-ȝ-0.X/mm!2/d d j0; o 4f  int[IgT ^k ` %u '; )|# +` ` `T |%   .a`-d4 l ma  f| }|  x  O) 7 -  .  /  0 1 j 2 3 p 4    IE   i .  5( B ;(   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ;  X -l % -+ .2 /9 0@ 2)^D 3B$ 53  :  ]  d  2 BYT-4TC4  ?C  @C Y AC    BO  G4?"F Fp MqM^"MQ %M  (X( +0 .(82c@^ 6iH 9MP=MXAt`2ChF3pI3x L3 P3 T3[3{ `(r3t;w3y{}) (' (P lG([33 3_ 3G  ? B(l08idB@ BH GPX- `J3h3p(x(+( J  338 3(W3 B((t x# I Mγ G S ^Xo2z@ ^ ( ( F /  E   L &2@ ) MV 4 " "n  $C2B 7B ;B uB   !        4 4) 4B  ) UB  B - b Sd en  fB gB hn G@z 7Ghp  dh] !Z  errB" #rcB$|z%z &Us&T&Q&R '&X&Y$z%dz &Us%tz &Us%z &Us$zu $z$z] T '4'RPGPyu (aPG#adrRIin4S hpT  UB :VV %in6X) hv] !Z w !xB#rcxB%vy &Us$y%y@ &Us&Tv&Q|&R&X&Y '$y$y$yu $3z)A.GwsG.  z 0+ {0}!71G~!1G~!1Gadr1G!1 01B !2#res3G!*x` MGW$Bx$Xx$|x%x&U4&T0%y&U0$y($"y+GI,)G@y 9(a)I-My3&U@&TU,$G0y (a$I-=y3&U4&TU... /ww q..S.ZZk0/ p..mm2.3.yy8.??,/ .>.551;   j" ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7 -HN  .<  /<  0< 1< j 2< 3< p 4<      i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;?" p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL &2;@   " $C2B 7B ;B uBx{M 5%7  {p!  ^  %{ !Us!T@"2{* !Us#M{5  ;?$XB %X%X0&O'mm2(" z$ 4f  intB`NgY ^k ` %z '; )# +e e eY Ł%   .ae-d4 l m"a  f }  x  O) 7 -  .  /  0 1 j 2 3 p 4    "N"J   i .  5- B ;-   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ;  "X 2l % -+ .2 /9 0@ 2)^D 3B$ 58  :  ]  d  2 B^Y24YH4  ?H  @H Y AH    BT  L4?"K Kp RqR^"RQ %R  (]( +0 .-82h@^ 6nH 9RP=RXAy`2ChF8pI8x L8 P8 T8[8{ `-r8t@w8y{}) -' -P lL-[88 8_ 8G  ? B(l08idB@ BH LPX- `J8h8p-x-+- J  888 8-W8 B--t x( I Rθ L X c]t2@ ^ - - K 4   E  # L &2E . R[ 4 " "s  $C2B 7B ;B uBO; ,  Y 4 8n D   Y% 4k   I !% Fw~ ~  ؎  ٞ  4 4  4 T  U     I  0  6 z/ 4k{ , I %   p0 1 2 33 5/ :[ I 4  P$LP{ $L $L.!z &!{&'LU'LU'LU'V!'B(({ V:) U*"_+3W!,B`!P,B"| !'ZZk) $ !I' ;f int ^ k ` %W '^ )e# +) ) )g%  s .a)-d; l ma l fe }e  x  O0 7 -  .~  /~  0~ 1~ j 2~ 3~ p 4~   /   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B  h Bp Bth xI ^ l X "l % -+ .2 /9 0@ 20^D 3B$ 5(  :  ]  d  2 BN";8;  ?8  @8 Y A8    B   <;?"; ;p BqB^"BQ %B  (M( +0 .82X@^ 6^H 9BP=BXAi`2CthFpIx L P T[{ `rt0wy{}) ' P l<[ _ G  ? B(ll08idB@ BH <PX- `Jhpx+J  8 W Bt x I BΨ < H SMd2o@ ^   ; z$  E  L &25  BK ; "W  $C2B 7B ;B uBվ ׾      ; ; ; ڔ  U   ,DW FGW NHBV4< ~" P4<* sG6 c!,~q "UU1&#=~\ $B~} " 5+<}(\ 7+< sG- !} ) "Us!~ A "Us#~\ $~} %q<|k sG  z k z { &7<&<&z 0B 'res <$!(} (<Z!$}} $} !} P "U3"T0$} $} )``i*ZZk)ww q)??c*mm2*3*??,*>+ &' `) ;f int ^ k ` %W '^ )e# +) ) )g%  s .a)-d; l ma l fe }e  x  O0 7 -  .~  /~  0~ 1~ j 2~ 3~ p 4~   /   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B  h Bp Bth xI ^ l X "l % -+ .2 /9 0@ 20^D 3B$ 5(  :  ]  d  2 BN";8;  ?8  @8 Y A8    B   <;?"; ;p BqB^"BQ %B  (M( +0 .82X@^ 6^H 9BP=BXAi`2CthFpIx L P T[{ `rt0wy{}) ' P l<[ _ G  ? B(ll08idB@ BH <PX- `Jhpx+J  8 W Bt x I BΨ < H SMd2o@ ^   ; z$  E  L &25  BK ; "W  $C2B 7B ;B uBվ ׾      ; ; ; ڔ  U    c W B;<E$ ;<!P;<!sG=$ ;" 0 !__v?^^"!__x?^""F #Uv"R #Tv$ %^ " 1<D 71<"P1<#sG3$ ~#"F #Us"F #Uv"i #Us#Tv$ %^ & <P~*@ sG $ #z "@ ${"<$'7#<~'#<'P#<'#z0#Br$!res$<$(1 !__v,^$!__x,^%(M .<'%%~u % %u "  % #U4#T0%u %z )ww q)'*ZZk) *mm2*3*??,*>+ i) u, ;f int ^ k ` # +) ) ))g% z.a)-d; l ma @ fe }e  x  O0 7 -^d  .R  /R  0R 1R j 2R 3R p 4R      i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B"; ;  ?   @  Y A     Bla l ;?" p q^"Q %  (!( +0 .82,@^ 62H 9P=XA=`2CHhFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(l@08idB@ BH PX- `Jhpx+J 8 W BǺtxI |   '!82C@ ^    N  EL &2  ; "+  $C2B 7B ;B uBtm8  B n B  B  B g B B B B MB )( 0 ;  B)  B)V>p t>]%z @ %{@&A~,A~~ANABD& tmBh ~C|&!resD&"# V'#hn ; $U}#y S $U}%y # | $U2$T0%݂ # $U"$T u$Q0% &2_m t2D'4`!tm5m }'#5 ) $Uw%B #j _ $UF$T k$Q0%o h &3(_ t('*`!tm+m '#Հ $Uw% # $UF$T d$Q0% 'D n tmm "( resP(0 $U9$T0)``R)4)??,)>)h*){)==w+ o/ ;f intB ^ k ` # +) ) )g% .a)-d; l ma / fj }j  x  O0 7-MS .A  /A 0A 1A j2A 3A p4A    =y ;  B )  B ) i. 5 B ;p > {  U9 B d     1 () 0 8r @ H P X P`B Vh Bp Bth xI c q \X ll % -+ .2 /9 0@ 20^D 3B$ 5r  : P ] P d V 2 Bl;;  ?  @ Y A V V V B  p ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtdwy& {1 }< ) ' P B lp[ _ G  ? B(l/0M 8idB@ BH pPS X- S `Jhpx+_ Jj  8 W BǴtu xˀ I ̅p  E ' F@ G 8 Hp p2@& ^&   w, 7 XH  Z Ee p { L & 2   pj@ sw'K ^L eM N QT eR S V9T !UT dimVZ  i ;It i qt  j  @    4  I   j # ( $4 0 % 8 !B4 pp !I p: d pd d O ! p  P6Z h[ \ ] "j  Jj 7 |  |#A2U3&/3385 5 end5  5 ptr5  5 5/( 5/0j 7 v 8p m9 :p8<9 <9 end<9  <9 ptr<9  <9 p ?pmem@maxAj8C C endC  C ptrC  C C/( C/0? SMH TMHUMBVM [7 ]);@ ) )V;~ ZF=rMsM;"jg:;" p  ""j42#/ 7!$>pp5%V9>Bn(%>B(%e>(&dim>e)'d@)'0@*(resAp9*(bB*#C~)?(iHB*)5(iPB+*^+U 7!+Q0+R1,0*H+U|+R3*+U 7!+Q0+R1, ;-hR&vp:+(b +*3*+Us.E,Y.h/Cy0VCy1oldE282h2,32QQ43jg. # 1 4f intk ^ ` # +I I Ig% s  4 4a  I 4 g!A ' (;@ )H Q 4SA .aI-d4 lc mn   f B } B  x  O) 7 - . / 0 1j 2 3p 4  L  ]css Q= y    4  ; I  ; I i .  5y B ;y >   U9; d    1 ()08r @H PX`B h  ;p;th~xI^ e X  l% -+ .2 /9 0@ 2)^D3;$5  : ] d  2 ;6  4  4?  @ YA  ; u   4?"#  p # q# ^"# Q %#   (. ( +0 .y829 @^ 6? H 9# P=# XAv `2C hFpIx L P T[{ `yrtwy { } ) y' yP  ly[ _ G  ? ;(l0 8id;@ ;H P X-  `Jhpyxy+y J  8 yW ;yyǨt? xJ I # ΐ )  4 . Ev ' F G 8 H: pE 2| @ ^ y y A       E @? jmpA B  uC0 E L &2g P . buf/Qm B  Jj 7 |  |#A2U3&/3 385k 5k end5k  5k ptr5k  5k 5( 50# j 7 v 8 m9 : 8< < end<  < ptr<  < <( <0q >: ?mem@maxA j8C C endC  C ptrC  C C( C0 SH THUBV [7 ] 4@    4~ Z =rs # Q 4"]  $C2; 7; ;; u; ; 4 6; 7; !;@D"7;g,#ret=;,$I4%Us$UL%Us$u*v%UF%T %Qs&5%U %Ts!, "7,'val[-#s!-#p" .#ret#;b.$%Us$˄0%Uv$@`%U3%Ts%Q %Rv$Kx%Uv$V%Uv$a%U|$)*%UF%T |%Qs$1V%U|&@5%U |%TsE(ww q( )h)d d j)))S(66 |0 KP4 ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  bw` Tw. Cw.!\`C/!=`/"retB/#f $Us$T #f $U|$T #Åq $Us#΅q $U|%օ|#$Uv$T|%#&$U|#>$Uv&$U $Ts'l'''ll ' 'S'd d jw2 p6 ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  sw C 5w0!z CA0!{" }0"#B$pI0$retB0%ֆ !$wE1&O 'Us'T (Z(e&p 'Us(|&†'Us&5'U (" )l))*}}E) )S)d d j+ 4 > )9 4f  int[IgT ^k ` %u '; )|# +` ` `T |%   .a`-d4 l ma K   f | } |  x  O) 7 -  .  /  0 1 j 2 3 p 4  $I$L   i .  5( B ;( >3   U9 B d     1 () 0 8r @ H P X #`B )h Bp Bth xI ;  /X ?l % -+ .2 /9 0@ 2)^D 3B$ 5E  : # ] # d ) 2 BkT?4TU4  ?U  @U Y AU ) ) )BO N4?"X Xp _q_^"_Q %_  (j( +0 .(82u@^ 6{H 9_P=_XA`2ChF3pI3x L3 P3 T3[3{ `(r3tBw3y{}) (' (P lN([33 3_ 3G  ? B(l0 8idB@ BH NP X-  `J3h3p(x(+( J  338 3(W3 B((t* x5 I _ N e pj2 @ ^ ( ( X 6   E % 0 L &2R ; _h 4 " "  $C2B 7B ;B uBO;  ,  T 4 8n" D  " T2 4k  V !2 FwՋ ׋  ؛  ٫  4 4 4  a  U   ,  V  =  6, u< 4 k , V % p0 1 2 33 5< :h pNP adrpP}1!q 1!qB(2"z sV2"{s3#atN~$t"tBa3%resuN3& "yN3' (U0)\&82 "Y3"Y4'ي (U~(T}~'$ (T~)\*N +__v;+__x;&u %__v;4%__x;4& "N4'4 (U~'G (Ua(T (Q0'Y(Uv'm(U2(T1'w5(Uv)%)* ,*hNQ!5hN4"z iV5"{iQ5$i~"iB5#resjN~$j" jB5&ɇ"mN5'6(U1(T0))- 60Lq!6N/6 adr7P6!8q7."59: 8 p8ww q 7 K< ;f int ^ k ` %W '^ )e# +) ) )g%  s .a)-d; l ma l fe }e  x  O0 7 -  .~  /~  0~ 1~ j 2~ 3~ p 4~   /   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B  h Bp Bth xI ^ l X "l % -+ .2 /9 0@ 20^D 3B$ 5(  :  ]  d  2 BN";8;  ?8  @8 Y A8    B   <;?"; ;p BqB^"BQ %B  (M( +0 .82X@^ 6^H 9BP=BXAi`2CthFpIx L P T[{ `rt0wy{}) ' P l<[ _ G  ? B(ll08idB@ BH <PX- `Jhpx+J 8 W BtxI BΨ < H SMd2oz$  EL &2 "  $C2B 7B ;B uB  p !L ՚ ך  ت  ٺ  ; ; ; p  U   W<0 a<;res< Z 4 !M b "Us!h "U2"Ts"Qw"R@#u ! "U:# $ "U "T0 ;?% p&uu@&mm2'&d d j 9 w> 4f ^ k ` int# +p p ppg 4   ^ p   ^ p % e.ap-d4 l- m8a   f I } I  x  O) 7 - . / 0 1j 2 3p 4  "(88`  i .  5C B ;C   U9 ^ d     1 () 0 8r @ H P X ,`B 2h ^p ^th wxI B P 8X Hl % -+ .2 /9 0@ 2)^D 3^$ 5N  : , ] , d 2 2 ^tH 4^ 4 ?^ @^Y A^  2 2 2 ^  b 4?"a ap hqh^"hQ %h  (s( +0 .C82~@^ 6H 9hP=hXA`2ChFNpINx LN PN TN[N{ `CrNtVwNy{}) C' CP lbC[NN N_ NG  ? ^(l08id^@ ^H bPX- `JNhNpCxC+CJ NN8 NCWN ^CC"tx I h b n ys2J  E L & 2#  "5   $ C2^ 7^ ;^ u^bЋ 5b`<ً UU  5b<  U0!4!K; @ ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<  L    =y ;  B )  B ) i. 5 B ; >   U9 B d     1 () 0 8r @ H P X L`B Rh Bp Bth xI ^ l XX hl % -+ .2 /9 0@ 20^D 3B$ 5n  : L ] L d R 2 Bh;~;  ?~  @~ Y A~ R R R B  w ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtkwy" {- }8 ) ' P > lw[ _ G  ? B(l*0I 8idB@ BH wPO X- O `Jhpx+[ Jf  8 W Bǯtq x| I ́w  E ' F G 8 HM p2@" ^"   T ( 3 _D  V Ea l w L & 2  e  Jj 7 |  |#A2U3&/3385~ 5~ end5~  5~ ptr5~  5~ 5*( 5*0j 7 v 8w m9 :w8< < end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C C endC  C ptrC  C C*( C*0 SHH THHUHBVH [7 ] ;@   3 ;~ Z# =rHsHd ; "p  $C2B 7B ;B uB B4 6B 7B  wC 5w<!z C<!{" 1="#B$pIg=$retB=% !$w=&hO 'Us'T (rZ(ze&p 'Us(|&'Us&Ќ5'U (Ռ" )l))*<) )S)d d j+= C ;f int ^ k ` %W '^ )e# +) ) )g e%  s .a)-d; l m3a  fe }e  x  O0 7 -  .  /  0 1 j 2 3 p 4    3E   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X -l % -+ .2 /9 0@ 20^D 3B$ 53  :  ]  d  2 BY-;C;  ?C  @C Y AC    B9  B  G;?"\ \p cqc^"cQ %c  (n( +0 .82y@^ 6H 9cP=cXA`2ChF(pI(x L( P( T([({ `r(t;w(y{}) ' P lG[(( (_ (G  ? B(l0 8idB@ BH GP X-  `J(h(px+ J#  ((8 (W( Bt. x9 I c G i tn2@ ^   \ /    E ) 4 L &2V ? cl ; " "  $  $C2B 7B ;B uB4e B% xO^I , N $ ^ ; $ ^ i i s ~ ~     N         6`    kV ,  %,   [ f f p { {     l   8n D        I  n     %  0  ; V F k Q  \  g  r  }    ;k   ! Fw  ! !  !   ; ;, ;E  , UE  E Wp ;"p0 !1$ !2 !33 !5 :l #[G@$BG1>$ G>%z ?%{A?&aG~'~%Bw?%P B?(res!G?'"p ~':# ~(clo$B@)ٍ%7GQ@*n+Us,}*+U|1&+T~+Q~+Rs,*)+U~+Qs*ȍE+U2+T0, *v+U +T0, -v--- -M-??,->-d d j.{ @ E ;f int ^ k ` %W '^ )e# +) ) )g e%  s .a)-d; l ma w fe }e  x  O0 7 -  .  /  0 1 j 2 3 p 4   :   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X -l % -+ .2 /9 0@ 20^D 3B$ 53  :  ]  d  2 BY-;C;  ?C  @C Y AC    B  G;?"F Fp MqM^"MQ %M  (X( +0 .82c@^ 6iH 9MP=MXAt`2ChF(pI(x L( P( T([({ `r(t;w(y{}) ' P lG[(( (_ (G  ? B(lw08idB@ BH GPX- `J(h(px+J ((8 (W( BtxI Mγ G S ^Xo2z/  EL &2  " "&  $C2B 7B ;B uBO^ ,c   ; 8n Dc   ;k   ! Fw1 1  A  Q A ;Q ;a ;z  a Uz  z  c     6 W ;k. ,c  %a p0g 1n 2 33 5 : G T  ;G@2G@ retBA!. ~!:g ~"WT  #UT#Tv#Q~"f_ " #Us#Tv"j F #U #T0$u %  J%p%d d j&B G^ k f ` %) '0int )7# +>!7L7 >N 7!>   1 g 7 X >% {! v " ! qR jT \Uv;Vv (v W xi z!y7 zi |7 i ! W !W !a ( CJ c E  FJ ! G Z >'U! H > .- ! 0 ! 5 ! = ! >  @ j A e! Ci$ ) E( J0 & N8 1 P@ " [QH T \QX  ]Qh  j-x = >  L ^ p. a- d> le mp f7 }7  x  O;7-. /01j23p4SYiit iG=y   > i ii.5{ B;{  U9i d    1 ()08r @H PX`B h  ipithxI0 E X l% -+ .2 /9 0@ 2;^D3i$5 : ] d  2 i!  >   >?  @ YA  i ok`k   >?"  p  q ^" Q %   ( ( +0 .{82$ @^ 6* H 9 P= XA5 `2C@ hFpIx L P T[{ `{rtwyK {V }a ) {' {P g l{[ _ G  ? i(l0r 8idi@ iH Px X- x `Jhp{x{+{ J  8 {W i{{FtȚ x˥ I  {     0 2; F Q \ m   E   L &2  hZ  {{ +0 . fd/i m0 end1 2max3 4 ( ^5 P l5 X ^6` V97ih {98p 79x q ~ o >@    >~ Z =rs"%"  $C2i 7i ;i ui i4 6i 7ip  47$ B    %   !"x     & 6 D& > O6 > ZF > _ FU _ _!: #3!MЏB7$fdMUA%errOiA&ޏ{'(Us1&&)(UU*(Uv(T (Q0#CB$fdCB%errEiB&{'(Us1&&)(UU*(Uv(T (Q0+!%i',fd%i-buf'l./ 0i/^ 1z0:? iU1l!i1!Ul2{3B4~5'0)3H*C6<*Ύ(U1(Ts(Q~7Dm3cC8D9:D4~4~'](Us(T1(Q3(R~(X~&5&t;; ; ;h;!!q>^">Q %>  (I( +0 .82T@^ 6ZH 9>P=>XAe`2CphFpIx L P T[{ `rt,wy{{}) ' P l8[ _ G  ? B(lh08idB@ BH 8PX- `Jhpx+J 8 W BǯtxI >Τ 8 D OI`2kv   EL & 2 "<8P9 5<8Ee> T>r ^ UG!} U0" #"(n"80 58F"D $O U0%"" & %3 L "P R 4f  int[IgT ^k ` # +` ` `T% .a`-d4 l ma 5 f| }|  x  O) 7-SY .G  /G 0G 1G j2G 3G p4G  I  =y 4  B `  B ` i. 5 B ;   U9 B d     1 () 0 8r @ H P X 5`B ;h Bp Bth xI ;  AX Ql % -+ .2 /9 0@ 2)^D 3B$ 5W  : 5 ] 5 d ; 2 B}TQ4Tg4  ?g  @g Y Ag ; ; ; BO  k4?"j p jqj^"jQ %j  (u( +0 .82@^ 6H 9jP=jXA`2ChFpIx L P T[{ `rt_wy{}) ' P lk[ _ G  ? B(l508idB@ BH kPX- `Jhpx+J 8 W BǺtx I jk p {u2S EL &2  "0  $C2B 7B ;B uB B4 6B 7B  #kVQ errkUFbufQ w#BF b  !UU m 6 !Tw!Q "Ƒx " Tb #4$""e$""$mm2%n N 5#p T ;f int ^ k ` %W '^ )e# +) ) )g e%  s .a)-d; l ma w fe }e  x  O0 7 -  .  /  0 1 j 2 3 p 4   :   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X -l % -+ .2 /9 0@ 20^D 3B$ 53  :  ]  d  2 BY-;C;  ?C  @C Y AC    B  G;?"F Fp MqM^"MQ %M  (X( +0 .82c@^ 6iH 9MP=MXAt`2ChF(pI(x L( P( T([({ `r(t;w(y{}) ' P lG[(( (_ (G  ? B(lw08idB@ BH GPX- `J(h(px+J ((8 (W( BtxI Mγ G S ^Xo2z/  EL &2  " "&  $C2B 7B ;B uBO^ ,c   ; 8n Dc   ;k   ! Fw1 1  A  Q A ;Q ;a ;z  a Uz  z  c     6 W ;k. ,c  %a p0g 1n 2 33 5 : #G}G  GF PBF!. ~!:g ~"(G #UU1&#Ts#Q~">R  #Us#Q "h] 9 #U #T0$mh %)#)#%M%d d j&Q vP Y# V ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBH#pH 5 GyH R#R#wn Q g# X ;f int ^ k ` %W '^ )e# +) ) )g e%  s .a)-d; l ma w fe }e  x  O0 7 -  .  /  0 1 j 2 3 p 4   :   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X -l % -+ .2 /9 0@ 20^D 3B$ 53  :  ]  d  2 BY-;C;  ?C  @C Y AC    B  G;?"F Fp MqM^"MQ %M  (X( +0 .82c@^ 6iH 9MP=MXAt`2ChF(pI(x L( P( T([({ `r(t;w(y{}) ' P lG[(( (_ (G  ? B(lw08idB@ BH GPX- `J(h(px+J ((8 (W( BtxI Mγ G S ^Xo2z/  EL &2  " "&  $C2B 7B ;B uBO^ ,c   ; 8n Dc   ;k   ! Fw1 1  A  Q A ;Q ;a ;z  a Uz  z  c     6 W ;k. ,c  %a p0g 1n 2 33 5 : z#G}G  GYG PBG!. ~!:g ~"ȒG #UU1&#Ts#Q~"ޒR  #Us#Q "] 9 #U  #T0$ h %##t%M%d d j& S # Z ;f int ^ k ` # +) ) ))#)g% z.a)-d; l m  ;! ; ~HQ " # a   f e } e  x  O0 7 - . / 0 1j 2 3p 4   00;0X = yY   | ; l B ) l B ) i .  5 B ;   s U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 Bz  ;s  ; ? @Y A B 6=2= X h ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C hFpIx L P T[{ `rtwy {( }3 ) ' P 9 l[ _ G  ? B(l0D 8idB@ BH PJ X- J `Jhpx+V Ja  8 W BtȘ xˣ I M   2  # . ?  Q E\ @ jmpAF B  uCg  L &h2   ) ; g! ' (B@ )!H " ;S .F buf/" - "X  $C2B 7B ;B uB B 4 6B 7B  #p/ 5G!y/ ! "UU# #J Y 5H$tp,P!. "Uw"T0%i &4&##D'Z U # 9] ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB#Q fd:HQ UU1&$$ W 6P ^ ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    FV;? " p q ^ "Q %  (( +0 .8 2@^ 6H 9P =X A`2 Ch Fp Ix L P T [{ ` r t w yJ {U }`) ' P fl  [   _ G l ? B(l *0 x8id B@ BH P ~X- ~`J h p x +  J   8  W  B   ǯt Ƞx ˫I  ;   2@J ^J    P[ s EL &V 2; " $C2B 7B ;B uB)$A D$sHK$HQ$Hz A H{J.I8$ $BwIp1 Ip2! Jret"BgJ  V9,BJ G !U !T}!Q !R|"Д@ 9J#PS f !UT!T #aS !T $k^ $x^ $i $t # !U}# !U|#  !U}!T|$% #6 3 !U $; J%$$&l&&& &S%& >&d d j' Y p$p ` ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBW$@,  Kh$WKO m UU1&TT1&l U  T0 a$a$ d d j )[ $ b^ k f ` int# +e e e$Sg$ # $%L $&L ~$+w $,w $. > % Z.ae-d> l ma ~ f7 }7  x  O 7 -  .  /  0 1 j 2 3 p 4    $A   i .  5$ B ;$   U9 S d     1 () 0 8r @ H P X `B h Sp Sth lxI 0 E $X 4l %w -+ .2 /9 0@ 2^D 3S$ 5:  :  ]  d  2 S`4>J>  ?J  @J Y AJ    S  N>?"M Mp TqT^"TQ %T  (_( +0 .$82j@^ 6pH 9TP=TXA{`2ChF/pI/x L/ P/ T/[/{ `$r/tBw/y{}) $' $P lN$[// /_ /G  ? S(l~08idS@ SH NPX- `J/h/p$x$+$J //8 /$W/ S$$txI Tκ N Z e_v26  EL &2  "!  $C2S 7S ;S uS$Np fdNKcmdNK$N+Ll@retSdL $SL eM! "  #U#T7#Q@! "X A #T6#Q@" ^ #T5#Q@!ɖ "ݖ #U '#T0! ! $$]"]"$ $%$d d j%4] % d^ k f ` intS# +j j jg X| >% _qR jT \U;V (v_ W xS z!y7 zS |7 S ! L !L !a (C cE F !Gj  >'U!Hf .aj-d> l m " f 7 } 7  x  O7 -@F .4 /4 04 14j 24 34p 44  = y    >  S j  S ji . 5 B ;  U9S d    1 ()08r @H PX-`B 3h  SpSthqxI0 E 9X Il%| -+ .2 /9 0@ 2^D3S$5O :- ]- d 3 2 Su I > _ >?_ @_YA_3 33S   c >?"b  p b qb ^"b Q %b   (m ( +0 .82x @^ 6~ H 9b P=b XA `2C hFpIx L P T[{ `rtWwy { } ) ' P  lc[ _ G  ? S(l"0 8idS@ SH cP X-  `Jhpx+ J  8 W SDZt x I b c h  s m  2    K   E   L &2  h   + . fd/S m0F end1 2max3 4 ( ^5 P l5 X ^6` V97Sh {98p 79xQ q ~  >@   ; >~ Z+ =r@s@"h  $C2S 7S ;S uS S4 6S 7S  Z > !%& P %6cpY !fd6c_N!ofs6cN!cmd6cN"ret8F 0O#4%^ 0  U9B d        1  () 0 8r  @ H  P X`B h  BpBthxIc q X ,l% -+ .2 /9 0@ 20^D3B$52  : ] d  2 BX &,; &B;?B @BYAB   %;?"  ^p  q ^" Q %   (* ( +0 .S825 @^ 6; H 9 P= XAF `2CQ hF^pI^x L^ P^ T^[^{ `Sr^tw^y\ {g }r ) S' SP x l%S[^^ ^_ ^G ^ ? B(l0 8idB@ BH %P X-  `J^h^pSxS+S J  ^^8 ^SW^ BSS2t x I  Ό% %  0 * A 2L W b m  ~   E @ jmpA B\  uCR  L &2  !.j5$ *"}' I/ #$ q/ J )Z ;$o o ; ;Z g! '? (B@ ) H ;S . buf/  hX  SS +i . fd/B m0 end1  2 max3  4 ( ^5 P l5 X ^6^` V97Bh {98 p 79 x* q ~ ^ ;~ Z =rs"  jH2-&a%o%m4&w11%&. 4 K3 + L1 3c3P%?/%&3+"0S&/@2`/5)3g*),,1 93!{%"p2#3$n'%-&9.'-(4)3*>,+;),*+--).C5/+0a)1s/2.3.,4&5,6&7&8K/93:m3;*<~)<+=)>3?4@-A>1B*C*D+E4F`-Gx3H/Is-Jm+K'L'M[5NS.O5Pu&Q&R/S=*TK,U0V3WV3XA+Y,Z+[2\(]0^1_?'`(a(b(c(dF&e%f&g*h(i-j*kf&l(m)np)o)p/qP4r0-s*t(u.v0w(x@(y1z55{+|2}-~<0.4Z,,-/4/R*22)%0v( 2->-,))m,,02'**/11120)-9&G-N(,~2.'1]413'1d1'.(}4'.+5(%(/4^(%294s*'33/:%J)S++Z023-'+/q00.&1W2'4%O' $ C2B 7B ;B uB B >!.a !!0 !!5 !!= !!>  !@ j !A e!!CB$ ) !E( !J0 &!N8 1!P@ 6/!bH 4!cP 1!dX -!e` )!fh *!gp !jax q;%QZ&Q'len^tQ(.^Q(0^R)*UN)9*Us*Tv*Q1+J,.%К_&f R&_1BR+_,r.`%З('vfd`%S&,`%QS&1`%S&K.a%T&/a%T&&a%U-fdcB>V(V9cBV(P0cBW(L.cB]W(dSW.dime(}(%f W(*f )X($,f X.stg|~(P5h^#Y(.h^Y(0h^Z(iuZ/>_-itSZ0*U / -iSV[1nT2[34[51(q2[3(4[56p ~2\2\) *U1*Tw*Q~0P *U1*Tw*Q~68 2R\2H]7 8]}4fR])ә{*Uw*T}*Q1*R9+0{6*Uw*T9F)(*UN)dQ*U0*T|"*Q3*Xw*Yv9l`)k8*Us*T~*Q*R}9`)vi*U *T09`9;F9`)*U 9`)*U )*U `90ʚv*U *T0 S8;:)4Bp;fd4B<4 =c6&=p7B>:? B?l!B?!|:+5;val%@AA^^B11nC22"YC(("LC++dDC q!C DW/&W/C#%D0E0CE()"=(C C*Cd d jCbF| b 5 j ;f intB ^ k ` # +) ) )g% .a)-d; l ma / fj }j  x  O0 7 -MS  .A  /A  0A 1A j 2A 3A p 4A      i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    B[P [ v;?" p q^"Q %  (( +0 .82@^ 6!H 9P=XA,`2C7hFpIx L P T[{ `rtwyz{}) ' P l[ _ G  ? B(l/08idB@ BH PX- `Jhpx+J 8 W BǴtxI k    '22@z ^z   =  EL &2 ; "  $C2B 7B ;B uBIg ;W u5)g j1  9553g @5:P{ 5:u]V9:]:] z < ] {z_ ?B_#l W)`$ :P % w`% `&I 'U}'T|'Qv( & 'UU'T !( ) E 'T () d 'T @)24 ):? )QJ (YU 'U})` (Ɯk 'U !)˜v z*5)5B +5)+5)B,-55 5.l.##G... .S.>.d d j/I Pe 6 m ;f int ^ k ` # +) ) )B;g % z.a)-d; l m a E fe }e  x  O0 7-ci .W /W0W1Wj2W3Wp4W  i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;; ? @Y A    Bf [ f B f  ;? " p &q&^"&Q %&  (1( +0 .82<@^ 6BH 9&P=&XAM`2CXhFpIx L P T[{ `rtwyc{n}y) ' P l [ _ G  ? B(lE08idB@ BH  PX- `Jhpx+J 8 W BǿtȹxI &Ό   , 71H2S^it  EL & 2"$ $C2B 7B ;B uB5 М B `5 `fd`res /a UU! Uw- U2 T0K8  U  T0!PC "v#55"??,"d d j$.g r6` n 4f  int[IgT ^k ` # +` ` `36`T% .a`-d4 l m56 ma   R f | } |  x  O) 7 -pv  .d  /d  0d 1d j 2d 3d p 4d  I   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ;  X l % -+ .2 /9 0@ 2)^D 3B$ 5  :  ]  d  2 B)T4T4  ?  @ Y A BOshs 4?" p q^"Q %  ((( +0 .823@^ 69H 9P=XAD`2COhFpIx L P T[{ `rt wy{}) ' P l[ _ G  ? B(lR08idB@ BH PX- `Jhpx+J 8 W BtxI ΃  # .(?2J @ ^    U  EL &2 & 4 KW ^L eM N  Q eR S V9T !U dimV &  4 "  $C2B 7B ;B uB6(( vfd(ea m6(a =6)a ~6)a!z + a!{+-b"B6+U~!6+Bcb#ofs,b#len,b$ret,#buf-7c#fd2Bmc%l  !7c& B0 4X ' (d' Kd' d(P.)Uv)T|~")Q}*B=*XH*S+^ )U )T0*i6P( fddbuf eofsCelene!z  -f!{if"6U{!]6Bf!6`f#retBeg"-6 {%< !%g& ! ' h' :h' ]h(r)U|1&)T)Qs@<$s@<$,( $ &)R@<$&  $` '"h'h' h(+})T)Qs*ߝ=* H*eS+s^ )U )T0*xiT ,4-6" .l!"B.".6")-&..&.&.&)/66600 0>0d d j10R6R6/  i 6 q ;f int ^ k ` # +) ) )36)g% z.a)-d; l m56ma  E f e } e  x  O0 7 -ci  .W  /W  0W 1W j 2W 3W p 4W     i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B,;;  ?  @ Y A   Bvkv ;?" p  q ^" Q %   (+( +0 .826@^ 6<H 9 P= XAG`2CRhFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(lE08idB@ BH PX- `Jhpx+J 8 W BǿtxI  Ά  & 1+B2M @ ^    X  EL &2  ) ;9 ;@) 9 9 "b  $C2B 7B ;B uB6#V 5#"iz %V Ei{%i%X_%BiZ &\ _ len'Bi p(%j! c 1nj" #U~$m ) , % j% j%} j"_ #U|#T~#Q &= #UU#T 'G 'O 'g &o  #U|' &Ơ H #U 'ˠ m (;)6 *5**0+mm2,666+l+++ +S+>+d d j-I l D7P Kt ;f int ^ k ` # +) ) )g% z.a)-d; l ma / fe }e  x  O0 7 -MS  .A  /A  0A 1A j 2A 3A p 4A     i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    B`U ` {;?" p  q ^" Q %   (( +0 .82 @^ 6&H 9 P= XA1`2C<hFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(l/08idB@ BH PX- `Jhpx+J 8 W BǴtxI  p   ,27 @ ^    B  EL &2  ; "  $C2B 7B ;B uB 7Р pkz  3k{okT7B7Bk r!rpk" #Ll# P ? $ l$ l%\ &T0'P e &UU&T 'l } &Uv'w! &Uv(- '8 &U (C )*7% *7%*7%+*737*7,l,mm2-3,>,d d j.jn N8dv ;f int ^ k ` # +) ) ))#)g% z.a)-d; l m    ;, ;  ~H \ " # # +7 1) ; 7 C g ;G8 Fra   f e } e  x  O0 7 -  . / 0 1j 2 3p 4  kq _= y    ; B) B) i .  5 B;' > 2  U9B d    1 ()08r @H PX`B  h  BpBthxI^ l X #l% -+ .2 /9 0@ 20^D3B$5)  : ] d   2 BO # ; 9 ;?9 @9YA9    B   ' ;?"<  p < q< ^"< Q %<   (G ( +0 .82R @^ 6X H 9< P=< XA `2C hFpIx L P T[{ `rtwy { } ) ' P  l'[ _ G  ? B(l0 8idB@ BH 'P X-  `Jhpx+ J!  8 W BtX xc I < Ω' B  M G E ' F G" 8 H p^ 2 @ ^          E @X jmpA B  uCI' ^ L &2 i  ) ; g! ' (B@ ),H ;S . buf/  e2  Jj 7 | 2 |#A2U3&/3 385 5 end5  5 ptr5  5 5( 50< j 7" v 8' m97 :' 8< < end<  < ptr<  < <( <0 > ?'mem@7maxA7 j8C C endC  C ptrC  C C( C0 SH THUBV [7 ] s ;@c s s ;~ Z =rs < ;"  $C 2B 7B ;B uB !B "4R "6B "7B- R!7A'J"7A'l"{7A'm"7A'7m"h8B'Zm#z DJm#{D m$7D {%8DB$6E|$BE}$08E~$7FB{#G n&tvH7{'tvpIP'n#PJBJn'resK'n(x#e'o)ĤPW*Uo+P,{-xo.Ѥ/Us0q/U|/T~/Qs0-/T}/Qs0K/T|/Qs10 /T~/Q}/R|/Xs10)V/T~0;V/T}0MV/T|0^/U3/T00/UF/T /Q01.ʥ/U /T0 72780'p<"@80'o"u70o#z 2JCp#{2 p&l3'~&res3'~$73 ~%83B3 t'fd6Bp( :'__d7)q.+ /Uv4G.#78'bq.S/U2/T0(#>'q15k7#B~"@8#'q"u7#q"7#~r3p 67%B67%B+ 'l&'r+ 'fd')r4'__d*) s. /Us $ &B7778sec 68 6b7 9 8 8#n9977 e9 9??$,9h:9d d j9\8\8%qdq 9(z 4f  intB`NgY ^k ` %z '; )# +e e e36eY Ł%   .ae-d4 l' m256 ma k   f }   x  O) 7 -  . / 0 1j 2 3p 4  .4DNDl " i .  5= B ;=  U9B d    1 ()08r @H PX8`B >h  BpBthxI;  DX Tl% -+ .2 /9 0@ 2)^D3B$5Z  :8 ]8 d > 2 BYT4Yj4?j @jYAj> >>BT n4?"m mp tqt^"tQ %t  (( +0 .=82@^ 6H 9tP=tXA`2ChFHpIHx LH PH TH[H{ `=rHtbwHy{}) =' =P  ln=[HH H_ HG   ? B(l0 8idB@ BH nP X-  `JHhHp=x=+=) J4  HH8 H=WH B==t? xJ I t n z 2 @ ^ = = m V   $ E/ : E L &2g P t} 4 ""  $C2B 7B ;B uBO;  ,  Y 4 Ƶ 98>:894: 9@98:g99t8': :@9 |8 8 %9 8 9@ 8n D  Y 4k   ! Fw!C "C " S " c S 4c 4s 4 ӌ  s U         6 z 4 k@ ,  %s #p0y "1 "2 "33 "5 :} I 4 $L: %C9wnЪ &fwts&9wBs' (9an ) an){9an*ofsan*lenbn)V9bn)bn+retdB,"dB,6ee,-6f ,g@ ,:hy Y -4%[:OnO& Ons&{9OnQt.ofsOnt.lenOnt&V9PnHu/retRBu0"RBu06Sev$-6T {1f9Y2_v2v2vv3P4Uw4T Q1&T"4Qs4R@<$54UX4T 6U5i4Uv1&4Tw4Qs $ &4R|6q5A4U 4T06782n_& 2nw&{92nw.ofs2nw.len2n&x&V93nx0z 5_#y0{5_y$o95{0295By8adr6n{$86{086By/ret7Bz0"7B;z068ez$-69 {/res:n{$;@ {$:2vޅ3W4Uv4TQ1&~"4Qs4R@<$? 2 > 2! ;2, a27 2B @AAAAAA34U 4T05 @4UX4T 5!^i4U{4T4Q{6\5xi4U|1&4Tv4Qs $ &4R}4X66ŪB99 9C##GCCe:e:C Cd d jDC99/B CMC??,C>C\9\9C  JCM9M9 t j:Pr~ ;f intB ^ k ` # +) ) )g% .a)-d; l ma / fj }j  x  O0 7-MS .A  /A 0A 1A j2A 3A p4A    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    B[P [ v;? " p q^"Q %  (( +0 .82@^ 6!H 9P=XA,`2C7hFpIx L P T[{ `rtwyB{M}X) ' P ^l[ _ G d ? B(l/0p8idB@ BH PvX- v`Jhpx+J 8 W BǴtȘxˣI k    '22=HS k }EL & 2 " $C2B 7B ;B uBI ; :  z:9  ӆcmd  UU1& TT1& $ &2$ "!) U  T0"::"d d j v :: ;f int ^ k ` # +) ) ))1 )g% z.a)-d; l m! , " ! a  p f e } e  x  O0 7 -  .  /  0 1 j 2 3 p 4     3   = y4  W; G B ) G B ) i .  5 B ; C U9B d    1 ()08r @H PX{`B h  BpBthxI^ l X l% -+ .2 /9 0@ 20^D3B$5 :{ ]{ d  2 BJ;C; ?  @ YA B   (8;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtwy{} ) ' P  l[ _ G  ? B(lp0 8idB@ BH P X-  `Jhpx+& J1  8 W Bt< xG I ̰  2  ! E, 7 B L &82d M z ;@j z z  ;~ Z =rs "  $C2B 7B ;B uB B4I 6B 7B$ I : 0w : Esec" ~pi t&@ret'B!w T& " #$ @% &_ 'Us( ( ) ; 'Us'Ts( &Ы 'U ,'T0(ի *: +sec ,8 ,b7 - 8 8n-%--:: - -d d j. x :ς ;f intB ^ k ` # +) ) )g% .a)-d; l ma : fj }j  x  O0 7-X^ .L  /L 0L 1L j2L 3L p4L    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    B[P [ B [ ;? " p q^"Q %  (&( +0 .821@^ 67H 9P=XAB`2CMhFpIx L P T[{ `rtwyX{c}n) ' P tl[ _ G z ? B(l:08idB@ BH PX- `Jhpx+J 8 W BǴtȮx˹I ΁  ! ,&=2HS^i  EL & 2 " $ $C2B 7B ;B uB4j} B% xOc ,}    ;            N   ! ! + k6 6 @ K K U ` ` j u u  l   8                &  ;  P  e ! z ,  7  B  M Ih ;X h `I ; % P!;)h "B)C":)|"I*Ȉ"P*#P,B`$ty-B% ? &UU%) s &Us2$`"&Tv&Q|1&'H &U @&T0(v( ; ;f(d d j z ;Ԅ ;f intB ^ k ` # +) ) )B; g% .a)-d; l ma ? fj }j  x  O0 7-] c .Q /Q0Q1Qj2Q3Qp4Q     i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B  !;  ; ?  @ Y A     Bk` k ;? " p q^"Q %  ( ( +0 .82+@^ 61H 9P=XA<`2CGhFpIx L P T[{ `rtwyR{]}h) ' P nl[ _ G t ? B(l?08idB@ BH PX- `Jhpx+J 8 W BtȨx˳I {   &   72 B M X c   {  E   L & 2 "  $C2B 7B ;B uB4jk B% xIv k v v %;P B̉ : IQ P!svP"res"ty B# 1 $UU# W $Tv$Q|1&$Rw# s $U2$T0# $U l$T0% &v&/;/;l&??,&d d j'| @;`φ ;f int ^ k ` %W '^ )e# +) ) ))#)g e%  s .a)-d; l m(  i  i ;y ; T ~H  " # # +a   f e } e  x  O0 7-.  / 0 1 j2 3 p4  }q=y >  ; B) B) i. 53 B;39 >> D  U9B d    1 ()08r @H PX`B h  BpBthxI^ l %X 5l% -+ .2 /9 0@ 20^D3B$5;  : ] d  2 Ba 5 ; K ;?K @KYAK B   9 ;?"N  >p N qN ^"N Q %N   (Y ( +0 .382d @^ 6j H 9N P=N XA `2C hF>pI>x L> P> T>[>{ `3r>t-w>y { } ) 3' 3P  l93[>> >_ >G > ? B(l0 8idB@ BH 9P X-  `J>h>p3x3+3( J3  >>8 >3W> B33tj xu I N λ9 T  _ Y E ' F G 8 HF pp 2 @ ^ 3 3 M    !  # E. @j jmpA B  uC[9 p L &2 { e  Jj 7 |  |#>A>2>U3>&/>3> 385w 5w end5w  5w ptr5w  5w 5( 50N j 7 v 89 m9I :9 8< < end<  < ptr<  < <( <0} >F ?9mem@ImaxAI j8C C endC  C ptrC  C C( C0 SH THUBV [>7 ]>  ;@   >, ;~ Z =rs N ] ;h )x ; g! '] (B@ )yH x ;S . buf/  "  "  !$C!2B !7B !;B uB "B #4p #6B #7BK p!>$=$B >$Be%)N <_<;>">=i= ;}=<==!<)<.=/=2C>3O;\=^[;b9<g<l\=l<E<<"<#%x$%x$ %؈$ %٘  ;  ;  ; % %NU% %&: %=ea<0<q;=< =i< :;jB >kB <Q ; A&R<pQ  <{ ;k&=}{  < ;&;  < ;&< &};   ;<&; `-! 9 ;&;)  -!&(=) ,!'#<(iB(lg{(tv).>9а8P*vty9U+i;9+u=9ڋ*val9,ty_,opt-.UU1& 3$,!".TU1&.XT.YR)G= 97*vty 9,+i; 9e+u= 9,ty,opt%-ǰG.UU1& 3$ -!".TU1&.XT/=9`.G071tyO0:;Bڏ0>B90 ;91val9&!=c@2<Q3q04506@78.Uw9.Us.T|:u9-.UF.Tv.Q08.Uv.T0;;9Ik071tyC0:;B0>B0 ;9`2z k2{ res91&!=c~&<~?L299ӭ.Uv1&.T}.Q.R~.X~9 .Uv1&.T}.Q.R~.X~9s.Uv1&.T}.Q.R~.X~:9ۮ.Uw.T0::&:?9T].UF.Tw.Q0:Y @7Asec B8 Bb7 C 8 8'nC8>8>(DChCd d jCQ=Q=(C)4C;;dC==)?8} @?ъ ^ k f ` inta# +0L!ELE LN E!L 0 000 01 0g a X L% m ! t " !  q R j T \ Ut; Vt  ( v W xa z! yE  za  |E  a ! Z ! Z ! a ( CH c E  FH ! G0 XL'U! H > .+ ! 0x ! 5 ! = ! >  @ j A e! Ca$ ) Ex( J0 & N8 1 P@ " [OH T \OX  ]Oh  j+x ;L . a0- dL lB mM  fE }E  x  O97-. /01j23p406FFQ Fn$=yo c L a0 a0i.5X B;X >c  U9a d    1 ()08r @H PX`B h  apathxI> S X l% -+ .2 /9 0@ 29^D3a$5  : ] d  2 a  L L? @YA a LSHS n ~L?"  cp  q ^" Q %   ( ( +0 .X82 @^ 6 H 9 P= XAI `2CT hFcpIcx Lc Pc Tc[c{ `Xrctwcy { } ) X' XP  lX[cc c_ cG c ? a(l0 8ida@ aH P)X- )`JchcpXxX+X J  cc8 cXWc aXXDt x I  c     EI ' F G# 8 H p 2O @ ^ X X Z     E   L &~2  E3  Jj 7 | 3 |#cAc2cU3c&/c3c 385 5 end5  5 ptr5  5 5( 50 j 7# v 8 m9 : 8< < end<  < ptr<  < <( <0 > ?mem@maxA j8C CendC CptrC C C( C0 SH THUBV [c7 ]c LtL@dtt cL~ Z=rs LhX  XX +# .fd /a m 0end 1 2max 3  4( ^ 5P l 5X ^ 6c` V9 7ah {9 8p 7 9xq ~!" "$C"2a "7a ";a #ua $4" $6a $7a " h=L-!?/=  "f>T#fd֕$reta%bufj~&`'"'E(ʹ})U1)Ts1&)Qv**ѹ+)")U1)Tv+F)U )T0*,> -5l.z .{ ˖!Z }/a$reta%bufj~0p10.J(J))U1)T}&!_'B'6(')U1)Ts)Q}+)Us)T  ***/+7)Us+)U  * ,?p -5Ɨ.z .{ %!Z }/a$reta%bufj~0p[1.(:))U1)T}&O'pژ'd()U1)Ts)Q}+&)Us)T ***+'e)Us+u)U *z"0?#fd $reta%bufj~&p 'Y2(})U1)Ts)Qv*ڶ*+!)W)U0)Tv+L{)U )T0*Q(d)UK)T )Q0,N>`Al-5|.z .{ ۙ!Z }/a$reta%bufj~0p1@q.Z(K))U0)T}&!w'B'6()U1)Ts)Q}+)Us)T  ***+)Us+=)U  *()UK)T  ,>oA)-5o֚.z q.{q 5!qZ }/qa$retra%bufsj~0ptk1..~())U0)T}&O'xw'p'd ()U1)Ts)Q}+)Us)T ***+Ǵ)Us+6)U *;(Q)UK)T 3>H->Ha0#bufH.z J.{J @!?K~!1K~!)K~!mK~%vK~!>KZ />Ka4.lv&CWg''56"6X6*ų& 0X''9506s66*&NpY'P'5p6Ġ66X*ճ* *N*+Z)U<)T0+%)T  )Q7)R0*ڳ*0*j7>8)8sec8.9!80$s<)$n?)$tA)::? a!;l!a;!:X>^>aO;5F;!:> a};5F;!<>y>>=#l==S<>>>=#h?>>%=&4=??&,=  '=$$&6 ؃ q? m ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? B(l*08idB@ BH PX- `Jhpx+J 8 W BǯtxI f    "2-@u ^u   8{  EL & 2 ; "  $C2B 7B ;B uB?,p- 5,z . {.u / uL? C ?ǡK$Q$ z  0 {ul!?8 ^?B"p1ڢ"p2#"retBl#' )$ %UT%T H$Ѻ %T Hۺ   $ ! %U|%Tv $ F %U|$ ^ %UvM $^ %U Hc & >&l&&'??%& &S&d d j( B   Bf int ^ k ` # +0 0 00#01 0g% .a0-dB l m~H3 " # a w fl }l  x  O7 7 -  .  /  0 1 j 2 3 p 4   :   = y;  ^B N I 0 N I 0 i .  5 B ; >  U U9 I d     1 () 0 8r @ H P X `B h Ip Ith xI e s X l % -+ .2 /9 0@ 27^D 3I$ 5  :  ]  d  2 I\BUB  ?  @ Y A   I :JB?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C hFpIx L P T[{ `rtwyc {n }y ) ' P  l[ _ G  ? I(lw0 8idI@ IH P)X- )`Jhpx+ J  8 W Itȫ x˶ I /  E ' FW G 8 H p2 @c ^c    & i t   E   L &J2  l  Jj 7 |  |#A2U3&/3385 5 end5  5 ptr5  5 5w( 5w0j 7 v 8 m9 :8 ?mem@maxAj8C C endC  C ptrC  C Cw( Cw0V SH THUBV [7 ]@ B@0 @ @ m B~ Z] =rs B "  $C2I 7I ;I uI I4 6I 7I  ?@I H ? @!&g "YA(0"L@)!. "cA00"@1!4 "@60" @7!: "-@<0"@=!A "?C0"]@D!G"@I0"?J!M!"AO0"@P!T@"@V0"-AW!Z_"lA\0"@]!`~"#@b0"@c!f"?h0"@i!l"?n0"Ao!t"?v0"wAw!{"n@}0"?~{@s 6@" @$#H #g (# 0# 8# @# H#P#!X#@`#_h#~p#x##$ A%5&res!&'ru"~(P)LA'*?A')( )LA)*?A))(/)LA,*?A,)+w#`)LA.*?A.)@,л}-U4-T,ݻ-U0-Tv,=-U -Tv./??,/x@x@W0R A@l^ k f ` int# +e e eg Xw >% Z  > > qR  jT  \U ;V  (v W xS z!y7 zS |7 S ! L !L !a (CcEF!Ge  >'U!H . ae- d> l m  M f 7 } 7  x  O7 -kq ._ /_ 0_ 1_j 2_ 3_p 4_  = y   4 > $ S e $ S ei . 5 B; >  6 U9S d    1 ()08r @H PXn`B th  SpSthlxI0 E zX l%w -+ .2 /9 0@ 2^D3S$5  :n ]n d t 2 S=  >6  >? @YAt ttS   + >?"  p  q ^" Q %   ( ( +0 .82 @^ 6 H 9 P= XA `2C hFpIx L P T[{ `rtwyD {O }Z ) ' P ` l[ _ G  ? S(lM0k 8idS@ SH Pq X- q `Jhpx+} J  8 W SǬtȿ x I ̣      E ' Fk G 8 H p 2 @D ^D     J U vf  x E @ jmpA2 BD  uC  L &+2  7 ! !J!!j 7 |  |#A2U3&/3 385 5 end5  5 ptr5  5 5M( 5M0 j 7 v 8 m9 : 8 ?mem@maxA j8C C endC  C ptrC  C CM( CM0j SkH TkHUkBVk [7 ] T >@D T T  >~ Zq =rksk > e > g! ' (S@ )H  >S .2buf/h   + . fd/S m0bend1 2max3 48( ^5 P l5 X ^6` V97Sh {98p 79xmq ~  "& !$C!2S !7S !;S "uS #S $4 $6S $7Sv"#A0$50$~60%z 2ƥ%{2D &2 '2S(p38(ret4S(len5bʦ){n%>*:+UU+T n,D,L*W+Uv+T},_*g+Uv*+U n,D #A$5%$~6H%z !k%{!D &! '!S(p"ݧ(ret#S&(len$bo){%-*<+Uv+T n,F,N*YI+Uv+Ts,`*hn+Uv*+U n,-"l--.0A 0- -S-d d "j/ 'B ;f intB ^ k ` # +) ) )g% .a)-d; l m  ; ;a _ fj }j  x  O0 j:7 - . / 0 1j 2 3p 4 ,,7,"  = yU   x ; h B ) h B )i . 5 B ; >    U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B  ;  ; ? @Y A   B 2I>I d t ;?" p q^"Q %  (( +0 .82 @^ 6 H 9P=XA? `2CJ hFpIx L P T[{ `rtwy { } ) ' P  l[ _ G  ? B(l_0 8idB@ BH P X-  `Jhpx+ J  8 W BǴt x I Y   E? ' F GL 8 H p 2E @ ^    P      E @ jmpA B  uC  L &t20  j\  Jj 76 | \ |#A2U3&/3 385 5 end5  5 ptr5  5 5_( 5_0 j 7L v 8 m9 : 8< < end<  < ptr<  < <_( <_0 > ?mem@maxA j8CE CE endCE  CE ptrCE  CE C_( C_0 SH THUBV [7 ] 2 ;@   ;~ Z =rs  ; ) ; g!M ' (B@ )H  ] ;SM . buf/] h   "  $C2B 7B ;B uB B !4' !6B !7B ' IB ;C2!AB "qB" P7!# I H7!$B[@G;%fd[B&2[,A&EB['V9]B(Z)Us)T1)Q0(r )Us)T2*)Uv)T|$ASG%fdSB"&2S,&EBS'V9UB?( )Us)T1)Q0(")Us)T2*7)Uv)T|+KB#,BKU$D,&5Db&2D,()y)Us*)U2)Tv)Qs-d ?&2?, &EB?V.5*)Ts)Qv/$0A&_B$B&2$,¬&EB$'z &'{& "7'~0err'~0arg'~"'P 10'B2res(2exn) )3p"+ P7!4+ 5E ='LB1Ѯ'A1 (@U)U}(/m)U|(K)U4)T0.1V(=a)U P(]@)U *ql)U `  +"B'/& 6;e7_BB4gBB8err9/F:@l;L??*K)U1)T0*̾w)Us)T )QD)R @]"]""Aww q@#%@mm$2@??$,@:B:B[@AA%<@++d@  &. B ;RKKf nnK~KYg!'0(@)~H intKS K ^ k ` # +R R RR#R  Wg W% . aR- dK ln my 9~H " 9# D# +Da f} Ox O O 7-7 =.+ /+0+1+j2+3+p4+   ^  =y QK R R i.O 5 B;Z > eU9dQ QQQ 1 Q()Q0Q8r Q@QH QPQX:`B @h  pth#xI   FX Vl%. -O+ .O2 /O9 0O@ 2^D3$5\ ::]:d @2    WVK WlK?l @lYAl@ @@  ZK?"o  p o qo ^"o Q %o   (z ( +O0 .82 @^ 6 H 9o P=o XA `2C hFpIx L P T[{ `rtNwy { }& ) ' P , lZ[ _ G  ? (l07 8id@ H ZP)X- )`Jhpx+B JM  8 W ńƄctȄ xˏ I o  Z u   z E ' FO  G 8H p  2  @ ^        ! B 2  = E H @ jmpA B uC| S   L &2  . buf/    Jj 7 |  |#A2U3&/3385 5 end5 5 ptr5  5 5(50 o j 7 v 8Zm9j :Z8 ?Zmem@jmaxAjj8C C endC C ptrC  C C(C0 N S7H T7HU7BV7 [7 ]8 K@ ( 8 8 e K~ ZU =r7s7o K" Q $QC 2 7 ; u !"4"6 "7  !BZo"5Z"?Z!"1ZD#z  og#{  $ % &tv!u~'t!ٰ'p"Q'ret#X'at$)'mt$)ױ(!#5Z!)0+n*Y+0,~-|./Us),*+,~-ֲ./aw)/Us0,/Us/T 1p1x0!/Us/T}10F/Us1> .O/U   K 273sec)48)4b7)5 8 8#n5l555BB"5 5S65d d j Bߟ 4f  int[IgT ^k ` # +` ` `T% .a`-d4 l ma  < f| }|  x  O) 7 -Z`  .N  /N  0N 1N j 2N 3N p 4N  I   i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ;  X l % -+ .2 /9 0@ 2)^D 3B$ 5  :  ]  d  2 BT4T4  ?  @ Y A    BO]R ] x4?" p q^"Q %  (( +0 .82@^ 6#H 9P=XA.`2C9hFpIx L P T[{ `rtwy|{}) ' P l[ _ G  ? B(l<08idB@ BH PX- `Jhpx+J 8 W BǺtxI m    )24 @| ^|    ?  EL &2 4 KA ^L eM N  Q eR S V9T !U dimV   4 "  $C2B 7B ;B uBB_H fd_buf_X =6_{ ~6`!z b e!{b|"6b?{!]6bB#ofsc`8#lenc`!6dB#retdB"-6e {$~ %r&|*PlK '(')B*U}*T Q1&T"*Qs*R@<$+G,X~ *U|1&*T}*Qs+`++)*U *T0|T -4B: vfd:S m6:v =6; ~6; B;߷!z = !{=|>"B6=?~!6=B#ofs>ָ#len> !B>B#ret>#buf?ֹ#fdDB .  %T+,' *Uv*T|~"*Q+++U+a+f)t*U *T0BP|fdZbufϺ =6 ~6g!z ! ܻ!{!|d"6!?{!]6!Bȼ#ofs"`#len"`6!B"`!6#Bݽ#ret#BP"-6$ {$r%7&|'+''')=*Uv*Q}*R@<$+B,P#*U|*Tv*Q}+X+c+,n*U *T0+/&0&0&0&)199923BBq2 2>42d d j2%Y  C ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBCP tP UU1& C CI  C ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? B(l*08idB@ BH PX- `Jhpx+J 8 W BǯtxI f    "2-@u ^u   8{  EL & 2 ; "  $C2B 7B ;B uBC  5Suidvgidz  J{u8B p retB=! !"x C #UU#T $ $ " #U}#Tv1&#Q|1&$ "" #U}$- "8 #U $C u%l%%&#C#C% %S% >%d d j' " )C ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? B(l*08idB@ BH PX- `Jhpx+J 8 W BǯtxI f    "2-@u ^u   8{  EL & 2 ; "  $C2B 7B ;B uB2C 5z  {u8BSpretB  !! % "UU"T # # ! W "Uv# ! | "Uv# ! "U # u$l$$%$d d j&  CC  ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? B(l*08idB@ BH PX- `Jhpx+J 8 W BǯtxI f    "2-@u ^u   8{  EL & 2 ; "  $C2B 7B ;B uBDIR] ]CiCu vdUz u x{u|C8NCB d{ "! %X" # $ $U|" " # g $U9$T $Q0" uR %%sCsC% % >%h&6  C@b ;f int ^ k ` # +) ) )g% z.a)-d; l ma 5 fe }e  x  O0 7-SY .G  /G 0G 1G j2G 3G p4G    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V B V ;? " p q^"Q %  (!( +0 .82,@^ 62H 9P=XA=`2CHhFpIx L P T[{ `rtwyS{^}i) ' P ol[ _ G u ? B(l508idB@ BH PX- `Jhpx+J 8 W Bǯtȩx˴I |   '!82CNYd | EL & 2 " $ $C2B 7B ;B uBC Bfd1fd2+ UsT Q0 ( = UvTsP# U T0 U. !AA~!v"CC!d d j!BB М C`^ k f ` int# +e e eg >% Za  .ae-d> l m* f7 }7  x  O 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 S d     1 () 0 8r @ H P X `B h Sp Sth lxI 0 E X l %w -+ .2 /9 0@ 2^D 3S$ 5  :  ]  d  2 S >>  ?  @ Y A    SVK V q>? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? S(l*0k8idS@ SH PqX- q`Jhpx+}J 8 W Sǡtȓx˞I f    "2-8CN f xEL & 2 " $C2S 7S ;S uSCpH fdS% !Us!Tv1& " !U !T0#$CC%# #d d j  Cխ ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBCM fdnuidgidBe  Us Tv1& Q|1& ! U  T0"#CC" "d d j! y DD| ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB&D6c fd6 UU1&T Q0C0 fd0 UU1&T Q0C&`IZ fd& P(BY w  UsT3Q0  9 UsT4 U T0DI fd|PB ' UsT3Q0 ? UsT4Y U T0!BB!AA~!]"]"!d d j * Dt ;f int ^ k ` # +) ) )$Bg% z.a)-d; l m$b  ;! ;a  p f e } e  x  O0 7 - . / 0 1j 2 3p 4     3 = y4   W ; G B ) G B ) i .  5 B ;   N U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 BU  ;N  ; ? @Y A B   3 C ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtwy{ } ) ' P  l[ _ G  ? B(lp0 8idB@ BH P% X- % `Jhpx+1 J<  8 W BǺts x~ I ̻(  2   , E7 @s jmpA\ B uCB y L &C2  DBLDBDe?  EDDCEEEDDtEtE"  $C2B 7B ;B uB B 4 6B 7Bj SH THUBV [7 ] ) ; g!( ' (B@ )!H 8 ;S( .\ buf/8 C !RE$ - "5$#ret&B$& $0 $A- $i %wp &Us%  &U h&T0' &U ((Ep $ ) &U5&T0(aE  "EG) &U4&T U $ &**E*EL+EE*EE&*d d j*b+dDdD8+DDG[c E0^ k f ` int# +e e eg Xw >% Z  > > qR  jT  \U ;V  (v W xS z!y7 zS |7 S ! L !L !a (CcEF!Ge  >'U!H  e > g !)  '  (S@  )H 9 > S) . ae- d> lK mV   f 7 } 7  x  O7-. /01j23p49?OOZOw-=yx l  > Se Sei.5a B;a   U9S d    1 ()08r @H PX`B h  SpSthlxI0 E X l%w -+ .2 /9 0@ 2^D3S$5  : ] d  2 S  >  >? @YA S U\Q\ w  >?"  lp  q ^" Q %   ( ( +0 .a82 @^ 6 H 9 P= XA& `2C1 hFlpIlx Ll Pl Tl[l{ `arltwly< {G }R ) a' aP X la[ll l_ lG l ? S(l0c 8idS@ SH Pi X- i `Jlhlpaxa+au J  ll8 laWl SaaǬtȷ x I  l     ! 2, 7 B M ^  p E{ @ jmpA B<  uC   L &2  . buf/9 h  aa + . fd/S m0. end1 2max3 4 ( ^5 P l5 X ^6l` V97Sh {98p 79x9 q ~ U >@   l# >~ Z =rs"P  $C2S 7S ;S uS S 4 6S 7S !E(F "fd("len(#*S$ofs+. N%-& 8W 'Us'Tv%'H(FS'U m'T0!EH-"fd"len# S%-&8 'Us'Tv1&%H(S'U m'T0)*0E0) )d d jQ  E`Ӷ ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBFPH 5eYH  F FQ  &Fe ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBFpH 5yH FFQ  AF ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB0FH 5H :F:F   F ;f int ^ k ` # +)Le ) )g% z.a)-d; l ma 5 fe }e  x  O0 7-SY .G  /G 0G 1G j2G 3G p4G    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    BaV a |;? " p  q ^" Q %   (( +0 .82!@^ 6'H 9 P= XA2`2C=hFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(l508idB@ BH PX- `Jhpx+J 8 W BǺtxI  q   -28@ ^    C  EL & 2  ; "  $C2B 7B ;B uBdF * JF, F- F. }F/ F<P^9 gid<sG>9 Ia' r2 Us= ! "H U  T0] jF,^ #7,sG.9 S Us' _ Us(= !> "NH U w T0$RF2! #sG9 :z ! {%7~%F&mem%C0B 'resC( )ySj oj }u   U4 T0  )%)FFe)ZZk)d d j*ww q)tFtFk)mm2)3)??,) >+ i F ;f int ^ k ` # +)Le ) )g% z.a)-d; l mNAa  @ f e } e  x  O0 7 -^d  .R  /R  0R 1R j 2R 3R p 4R      i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B"; ;  ?   @  Y A    Blal ;?" p q^"Q %  (!( +0 .82,@^ 62H 9P=XA=`2CHhFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(l@08idB@ BH PX- `Jhpx+J 8 W BǺtxI |   '!82C@ ^    N  EL &2  ; "+  $C2B 7B ;B uBF 5F n!BG!B res"X!p i2B" %# #, # $? %U0%T0" 0*g #, # 2$? %Us%Tv&O 'Z %Uv%T s $ &2$' e %Us $ &'@p %Uv'Up %Uv$c{ %U %T0(G B9 ) B)! 9 *GFG+%+FF+FF.+S+d d j  /GY ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBGp- 5U7y  !U2!T !Q0"&G&GS#mm2#hQ v LG ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB:GH 5H DGDGz  G ;f int ^ k ` # +)!eLe ) )g% z.a)-d; l ma @ fe }e  x  O0 7-^d .R  /R 0R 1R j2R 3R p4R    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B"; ;  ?   @  Y A     Bla l ;? " p q^"Q %  (!( +0 .82,@^ 62H 9P=XA=`2CHhFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(l@08idB@ BH PX- `Jhpx+J 8 W BtxI |   '!82C@ ^    N  EL & 2  ; "+  $C2B 7B ;B uBF01 G3 G4 G5 VG6 G7 G8 ]G9(yGB^h uidBsGDh 6  - Us !% " U  T0h G2P^% #72sG4h ^ Usg x Us !% " U  T0$fG #sGh 'z  {%7~%F~%G~&dir%`G%N0B'res0( /f      m U7 T0= B )%)GGm)ZZk)d d j*ww q)GGs)mm2)??,) >+Q H G@C ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBGH 5H GG Ѷ G` ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBG0V GdF4A a UvS  UvTsx UFT Qv U T0 ww q!HH!h!d d j Hu  Bf intI ^ k ` # +0 0 00#0g% .a0-dB l m  B- B ~H] " # a   f q } q  x  O7 7 - . / 0 1j 2 3p 4  &,<<G<d = ye    B x I 0 x I 0 i .  5 B ; >    U9 I d     1 () 0 8r @ H P X `B h Ip Ith xI j x X l % -+ .2 /9 0@ 27^D 3I$ 5  :  ]  d  2 I   B  B ? @Y A I BTIT o  B?" p q^"Q %  ( ( +0 .82 @^ 6 H 9P=XAJ `2CU hFpIx L P T[{ `rtwy { } ) ' P  l[ _ G  ? I(l0 8idI@ IH P)X- )`Jhpx+ J  8 W It x I d    EJ ' F> G 8 Hn p 2P @ ^   u [     E @ jmpA B  uC  L &24  E 0U B g! ': (I@ )-H U BS . buf/  q  Jj 7 |  |#A2U3&/3 385 5 end5  5 ptr5  5 5( 50 j 7 v 8 m9 : 8<7 <7 end<7  <7 ptr<7  <7 <( <0 >n ?mem@maxA j8C C endC  C ptrC  C C( C0= SH THUBV [7 ] B' B@ ' ' T B~ ZD =rs  B"  $C2I 7I ;I uI I  4  6I 7I !Hq X5H,HH WH hZ H k8 H m8 Pj BZ"OH1j #;H=fA$&H=%val?5@&@'UU1& $ &2$"'Ts&MJ'Us&q3'U 'T0(v#H3pJ$&H3$H3%new55%old55&'Uv&'Uv&'Us2$"'Tv'Q|&J'U|&<'U 'T0()H']*tp'g%res*P+#',LA+-?A+)+J!,LA,-?A,).#'U2'T5/pHs*tv/*sec)"8)P-b7)&'a)'Uw((80EHEH z0d d j10HH 0??!,0 8 8"n2kHaH kH 0 H ;f int ^ k ` # +) ) )g% z.a)-d; l m  ;  ;a Z fe }e  x  O0 7 -x~ .l /l 0l 1lj 2l 3lp 4l   = y   A ; 1 B ) 1 B ) i .  5 B ;   8 U9 B d     1 () 0 8r @ H P X p`B vh Bp Bth xI ^ l |X l % -+ .2 /9 0@ 20^D 3B$ 5  : p ] p d v 2 B?  ;8  ; ? @Y A v v vB   - ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA`2ChFpIx L P T[{ `rtwy{}) ' P l[ _ G  ? B(lZ0 8idB@ BH P X-  `Jhpx+ J&  8 W Bǯt] xh I ̥  2   E! @] jmpA B uC, c L &-2 n  ) ; g! ' (B@ ) H ;S . buf/  "  $C2B 7B ;B uB B 4 6B 7Bm   ;@   ;~ Z =rxsx#I; pid!2I%"sigB^# d $UT1&# | $Us% & $U $T0'HHc'-I-Ip'II"'d d j? % PI^ k f ` int# +e e eg >% Za  .ae-d> l m* f7 }7  x  O 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 S d     1 () 0 8r @ H P X `B h Sp Sth lxI 0 E X l %w -+ .2 /9 0@ 2^D 3S$ 5  :  ]  d  2 S >>  ?  @ Y A    SVK V q>? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? S(l*08idS@ SH PX- `Jhpx+J 8 W SǡtxI f    "2-@u ^u   8{  EL & 2 > "  $C2S 7S ;S uS9I  5JIz  {u8S9pqretS_DS  (V!S C "UU"T #] #e !o { "U|"Tv#v !~ "U|## !. "U #9 u$l$$%CICIZ$ $S$ >$d d j&  YI  ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBeIM `IretB  n Us! U  T0"%#oIoIY"d d je  tI0 ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwyu{}) ' P l[ _ G  ? B(l*08idB@ BH PX- `Jhpx+J 8 W BǯtxI f    "2-@u ^u   8{  EL & 2 ; "  $C2B 7B ;B uBDIR] ]C~I  5z  {u\8B d res  p!I! ," B #UU#T $ $ " t #Uv$( "3 #Uv"> #U1#T$ I "T #U $#_ uR %l%%%II% %S%??,% >%d d j&  IP ;f int ^ k ` # +)J; ) )g% z.a)-d; l ma 5 fe }e  x  O0 7-SY .G  /G 0G 1G j2G 3G p4G    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B;;  ?  @ Y A    BaV a |;? " p  q ^" Q %   (( +0 .82!@^ 6'H 9 P= XA2`2C=hFpIx L P T[{ `rtwyH{S}^) ' P dl[ _ G j ? B(l50v8idB@ BH P|X- |`Jhpx+J 8 W BǺtȞx˩I  q   -28CNY q EL & 2 " $C2B 7B ;B uBI_ I I I^ I W I!_ o ;DIRz ]CI I0EI vdd!I *e"O ` >U !F` "Us No #]z !p ; "U9"T "Q0 u o  $%III$ $mm2$h$IIi  Jp ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBDIR ]CJ. vdd  !U9!T !Q0 "'J'J"h  1JF ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uB:J)v gidBv U UU1& U T0 DJDJ!d d jJ ; _J ;f int ^ k ` # +)Le ) )g% z.a)-d; l mNAa  @ f e } e  x  O0 e}   :    X 7 -  . / 0 1j 2 3p 4  #  i .  5 B;_< >   U9 B d     1 () 0 8r @ H P X -`B 3h Bp Bth xI ^ l 9X Il % -+ .2 /9 0@ 20^D 3B$ 5O  : - ] - d 3 2 BuI;_; ?_ @_Y A_ 3 3 3 B  M;?"b bp iqi^"iQ %i  (t( +0 .82@^ 6H 9iP=iXA`2ChFpIx L P T[{ `rtAwy{}) ' P lM[ _ G   ? B(l@0 8idB@ BH MP X-  `Jhpx+ J)  8 W BǺt4 x? I i M o zt2@ ^   b 5    E$ / : L &2\ E ir ;"~  $C2B 7B ;B uBKJM  GM{F! "c n#BF!- i'c" %r # $ % & '! (Uv'9, (U|(T}'C7 (U})fB (U (T0*+X +valM,- -.OOZ.UJUJ.S.d d j  kJ ;f int ^ k ` # +) ) )$Bg% z.a)-d; l m$ba @ fe }e  x  O0 7 -^d  .R  /R  0R 1R j 2R 3R p 4R      i .  5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B"; ;  ?   @  Y A     Bla l ;?" p q^"Q %  (!( +0 .82,@^ 62H 9P=XA=`2CHhFpIx L P T[{ `rtwyS{^}i) ' P ol[ _ G u ? B(l@08idB@ BH PX- `Jhpx+J 8 W BǺtȩx˴I |   '!82CNYd | EL &2 " $C2B 7B ;B uBtJp( 5pidy  U  T0!~J~J"d d j C J  ;f int ^ k ` # +) ) )g% z.a)-d; l ma * fe }e  x  O0 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI ^ l X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 B ;;  ?  @ Y A    BVK V q;? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? B(l*0k8idB@ BH PqX- q`Jhpx+}J 8 W Bǯtȓx˞I f    "2-8CN f xEL & 2 " $C2B 7B ;B uBJ)v uidGv U UU1& U T0 JJ!d d j Jp9^ k f ` intS# +j j jg  > >  >@   >a  % _.aj-d> l@ mK  f 7 } 7  x  O7 -  .  /  0 1 j 2 3 p 4 '-==l   = y[  a ~ > n S j n S ji . 5V B ;V >a  U9S d    1 ()08r @H PX`B h  SpSthqxI0 E X l%| -+ .2 /9 0@ 2^D3S$5 : ] d  2 S  >  > ?  @ YA S J?J e u >?" ap q^"Q %  (( +0 .V82 @^ 6 H 9P=XA@ `2CK hFapIax La Pa Ta[a{ `Vratway { } ) V' VP  lV[aa a_ aG a ? S(l0 8idS@ SH P X-  `JahapVxV+V J  aa8 aVWa SVV5t x I Z  E@ ' F; G 8 Hk p 2F @ ^ V V E Q      E @ jmpA B  uC  L &u21  B jR >g! '7 (S@ )H R >S . buf/  7  Jj 7 |  |#aAa2aU3a&/a3a385 5 end5  5 ptr5  5 5( 50j 7 v 8 m9 :8<4 <4 end<4  <4 ptr<4  <4 <( <0 >k ?mem@maxAj8C C endC  C ptrC  C C( C0: SH THUBV [a7 ]a a$ >~ Z =rs U > "a  $C2S 7S ;S uS S 4  6S 7S Z > !K5 P"Kd#Jd$setf~%PgS!0KgS~&'UU'Ts(*&*5'Us'T~(1@(>K&qV'Us'T H'Q0(va" KXp}#6KX$setZ~%P[S;&r'UU'Ts(*&j'Us(@(u&'U ='T0(a"JH#5H!! J~% Ka)B*iMS) +N+Na,3*jPS?-"'Uw'Ts&'Uw&8V'Uw&e 'U 2'T0(jaa"J7V#vK7#6K7*how9S$set:}!gK:~%P;Sn&X'UT'Ts(]*&k'U|'Ts'Qv(r@(w&V'Uv&VH'Us'T &'Q0(a.J' /set'%z )%{) R$res*~!*Q 0 *S1@U*i+S)":%nK-&K 'Us-'U0'Q~-'Uv'Ts)z%2(a 2JF*#6K/setP)*sig"S(-'Uv-'Uv33KK3 3HKHKd3h43KK3!%3d d j3KK3JJ3 K K"3II"3;K;K#3~K~K3HHc3JJ{  bL-4:g:.4int^ k f ` # +  $Q$b m% a  .a-dm l mA  a f f } f  x  O 7 -  .s  /s  0s 1s j 2s 3s p 4s  $   i .  5 B ;   U9 Q d 4 4  4 4 1 4() 40 48r 4@ 4H 4P 4X `B h Qp Qth xI _ t X  l % -+ .2 /9 0@ 2^D 3Q$ 5  :  ]  d  2 Q8: m:"m  ?"  @" Y A"   QwQ &m?"; ;p BqB^"BQ %B  (M( +0 .82X@^ 6^H 9BP=BXAi`2CthFpIx L P T[{ `rtwy{}) ' P l&[ _ G  ? Q(la08idQ@ QH &PX- `Jhpx+J  8 W Qt x I BΨ & H SMd2o @ ^   ; z  E  L &25  BK m "W 4 $W  $4C2Q 7Q ;Q uQQ mP+ K-Q +L.Q K/  L0 2L L1 K&o K&k &ZK!&K"&DjL#&|f%W p&W :5'pid(~ src)Q r)QXact* ~!L0!LB " dst6Q#XT+ i=Q$T O %Uv%T~%Q}$ m %Uv%T~& %Uv%T~$ %U|%T \$( %Uv%T \$3 %Uv$>  %Uv$I  %U~$I 6 %U~$-T p %U~%T|%Qv%R0%X~%Y~$8> %Uv$BI %U~'_ $( %T \$j %U%T \%Q|'u ( L L(LL(l(22r(KK(ALAL(hhs(sLsLH(LLT(h)Z %M!) @f intG ^ k ` # +) ) )g% .a)-d@ l ma 4 fo }o  x  O5 7-RX .F  /F 0F 1F j2F 3F p4F    i. 5 B ;   U9 G d     1 () 0 8r @ H P X `B h Gp Gth xI h v X l % -+ .2 /9 0@ 25^D 3G$ 5  :  ]  d  2 G!@ @  ?   @  Y A     Gk` k @? " p q^"Q %  ( ( +0 .82+@^ 61H 9P=XA<`2CGhFpIx L P T[{ `rtwyR{]}h) ' P nl[ _ G t ? G(l408idG@ GH PX- `Jhpx+J 8 W GǹtȨx˳I {   & 72BMXc { EL & 2 " $C2G 7G ;G uGMaMoMoM< M5 /M5  M 5  pM!5 L"  M#  L$* 4 M%* 8 @o NMZMEndo MM0 @p N)  ]N M^* M_G- N c @S _M`c N @} !M0 "IMW N @ !Nb #Mf 9y $fdf %+fF&<X 'UU1&'TT1& $ &2$"(Y'U 'T0#L[9 $fd[%7M[& 'UU1&'TT1& $ &2$"('U 'T0#.NP) $fdP&_ 'UU1&('U 'T0#`NE, $fdE*%MEc& 'UU1&'TT1&('U 'T0#@N40MC$fd4%M4$arg45!6@ ~)$s =*;*0+ ,F-M .N/ ...&-!.&'U(d'U0@."/X`!`.]E.h{-t!.y.&.^..(S'UF'T u'Q0&j'U~'T&1('U~'T|2$"'Q1o3(}'U u'T0#xM$7$$fd$2res&X!'@ ~) *0,* *L-+0.,0d.w/6p.;.F/RX.W.b .mi.x-.-0 .\./` .&<'Uv(G'Uv&'UU1&'Tv&=R'U&&"'U k'T01'33M4dst4src5ok67pc8t9M7msk5 89M7ofsG7numG:msk5 :iG8"&H G" M G:res G6:i G6"&HG@ 05 3vN4dst4src67pc8R9jM7msk5 89jM7ofsG7numG7msk5 67iG89&HG9M* 67iG69&HG;MM^;d d j;LLZ;8N8NV;jNjNP;LL6; N N9;h;MMB;JNJNF<;=M=M0;TNTN3;FF.[  N@"$^ k f ` int# +e e eg >% Za  .ae-d> l m* f7 }7  x  O 7-HN .<  /< 0< 1< j2< 3< p4<    i. 5 B ;   U9 S d     1 () 0 8r @ H P X `B h Sp Sth lxI 0 E X l %w -+ .2 /9 0@ 2^D 3S$ 5  :  ]  d  2 S >>  ?  @ Y A    SVK V q>? " p q^"Q %  ( ( +0 .82@^ 6H 9P=XA'`2C2hFpIx L P T[{ `rtwy={H}S) ' P Yl[ _ G _ ? S(l*0k8idS@ SH PqX- q`Jhpx+}J 8 W Sǡtȓx˞I f    "2-8CN f xEL & 2 " $C2S 7S ;S uSN`R {lR UU1&NN4> O`" ;f intB ^ k ` # +) ) )g% .a)-d; l m  ; ;a _ fj }j  x  O0 7 -} .q /q 0q 1qj 2q 3qp 4q  " = y#   F ; 6 B ) 6 B ) i .  5 B ; >   H U9 B d     1 () 0 8r @ H P X `B h Bp Bth xI c q X l % -+ .2 /9 0@ 20^D 3B$ 5  :  ]  d  2 BO  ;H  ; ? @Y A   B  - = ;?" p q^"Q %  (( +0 .82@^ 6H 9P=XA `2C hFpIx L P T[{ `rtwyV {a }l ) ' P r l[ _ G  ? B(l_0} 8idB@ BH P X-  `Jhpx+ J  8 W BǴt x I ̵"   E ' F G 8 H3 p2 @V ^V   :  \ g x   E @ jmpA BV  uC  L &=2   ) ; g!K ' (B@ )H  [ ;SK . buf/[ f j  Jj 7 |  |#A2U3&/3 385d 5d end5d  5d ptr5d  5d 5_( 5_0 j 7 v 8 m9 : 8< < end<  < ptr<  < <_( <_0j >3 ?mem@maxA j8C C endC  C ptrC  C C_( C_0 S}H T}HU}BV} [7 ]  ;@    ;~ Z =r}s} J ;"V  $C2B 7B ;B uB B 4 6B 7B I ; !OV p"NZP#V9Z# OZ$pid\B9!M\BT%"\B&x-'UU'T p(8&C'Us'TT'Qv(N&'Us&Y 'U h'T0(d"NEd#5E$pidGB!MGBd(8&m'Ud( N&'Us&?Y'U K'T0(Dd)N*U'*pid*BM#M*B%z ,'%{,V Z+st-~!N- ,N-B$res.-Z%B&!x'U1'T1(.&Ix'U2'T0&x'U1'T0&x'U1'T2(dV .## G..NN!d. .d d j/.NN!M.?? ,.HKHKd% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I4: ; I .?: ; 'I@B!: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I U 4: ; I!1"B#1$1%.?<n: ; &.?<n: ;'.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I: ; I U 4: ; I% U$ > : ; I$ >   I&I : ;  : ; I8 > I: ;  ( : ;I '4: ;I?<'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I.?: ; '@B : ; I!4: ; I"1#B1$B%.?: ; 'I@B&: ; I'4: ; I( U)1*1X Y +1, 1-41.41/.: ; 'I 0: ; I1 24: ; I3.?<n: ; 4.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"1#B$1%.?<n: ; &.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!: ; I"4: ; I#1$B%1&.?<n: ; '.?<n: ;% U: ; I$ > $ >  I&I4: ; I?<  : ;  : ; I8 : ;I ' 4: ;I?<'II!I/  : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!: ; I"4: ; I#4: ; I$1%B&1'1(.?<n: ; ).?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U: ; I$ > $ > &I I 7I &  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ;   : ;!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I& ' U(4: ; I)1RUX Y *1+ U,41-41.1/B0 111213.: ; 'I 4: ; I54: ; I64: ; I7 8.?: ; 'I 49: ; I:.?<n: ; n;.?<n: ; <.?<n: ;=.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%1RUX Y &1'1(B)1*1+!I/,.?: ; 'I 4-: ; I..?<n: ; n/.?<n: ; 0.?<n% U: ; I$ > $ >  I&I  : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I 4: ; I!4: ; I" U#4: ; I$1%1&B'!I/(: ; I).: ; 'I@B* +'I,.: ; 'I@B-B1..?<n: ; /.?<n: ;0.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1RUX Y 1 1!B"1#1$.?: ;'I 4%: ;I&.?<n: ;n'.?<n: ; (.?<n% U: ; I$ > $ > &I I  : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; 4: ; I.?: ; 'I@B : ; I!4: ; I" #1$B%1&!I/'.?<n: ; (.?<n: ;).?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ;.?: ; 'I@B: ; I 4: ; I!1"B#B1$1%.: ; 'I@B&4: ; I'4: ; I( ).?<n: ;*.?<n: ; +.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I U!4: ; I"1#B$B1%1&.: ; 'I@B'4: ; I( ).?<n: ;*.?<n: ; +.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I!4: ; I" #1$B%1&.?: ; 'I@B'.: ; 'I@B(1).?<n: ; *.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( : ; I8 !I!'I"> I: ; #4: ; I$.?: ; 'I@B%: ; I&: ; I'4: ; I(4: ; I) *1+B,1-.: ; '@B.B1/.: ; 'I 0: ; I14: ; I2.?<n: ; 3.?<n4.?<n: ;% U: ; I$ > $ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$1%B&1': ; I(.?<n: ;).?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#1$B%1&1'.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B : ; I!: ; I"4: ; I#4: ; I$4: ; I%4: ; I& '1(B)1* +4: ; I,.: ; 'I@B-.?: ; '@B. U/1RUX Y 011121X Y 3.?: ; 'I@B4B15.?: ; 'I 46: ; I7.?<n: ; 8.?<n: ;9.?<n:.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I 4: ; I!1"B#1$1%.?<n: ;&.?<n: ; '.?<n% U: ; I$ > $ >   I&II !I/ 4: ; I?<  : ;  : ; I8 : ;I'4: ;I?<'I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1BB1 1!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((7I  : ; ! : ; I" : ; #.?: ; 'I@B$: ; I%4: ; I&4: ; I'4: ; I(4: ; I) *1+B,1-.?<n: ; ..?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8  : ;  : ; I I !I/ : ;I'4: ;I?<'I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I> I: ;  ( !("(#.?: ; 'I@B$: ; I%4: ; I&1'1(B)B1*1+.: ; 'I ,: ; I-4: ; I. /4: ; I0.?: ;n'I 1: ;I2.1@B3144151RUX Y 617 18 941: 1;.?<n: ; <.?<n: ;n=.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I1 B!1".?<n: ; % U$ > : ; I$ >   I&I4: ;I?< 4: ; I?<  : ;  : ; I8 : ;I ''I : ;I8 : ; I!I/ <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1X Y 1 B!B1"B1#.: ; 'I $B1%.?<n: ; &.?<n: ;% U: ; I$ > $ >  I&I  : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 7I.?: ; 'I@B: ; I4: ; I4: ; I 1!B"1#!I/$.?<n: ; %.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I.?: ; 'I@B : ; I!1"B#B1$4: ; I%1&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I U 1!B" #1$1%.?<n: ;&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ; % U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I4: ; I 4: ; I!1"1#B$.?<n: ; %.?<n% U$ > $ > &I: ; I  I : ;  : ; I8  : ;  : ; I I !I/ : ;I'4: ;I?<'I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I4: ; I .?: ; 'I@B!: ; I"4: ; I#4: ; I$1%1&B'B1(1).?<n: ; *.?<n: ;n% U$ > : ; I$ > &I 7I I  : ;  : ; I8  : ;  : ; I I!I/ > I: ; ( : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I !> I: ; "(#!$ : ; %.?: ; '@B&: ; I': ; I(4: ; I)1*B+B1,.?: ; 'I@B-4: ; I.4: ; I/ 0111X Y 213 144154161RUX Y 7 U84191:.: ; 'I ;: ; I<: ; I=4: ; I>.?: ;n'I ?: ;I@ A4: ; IB.?<n: ;C.?<n: ; D.?<n: ;nE.?<n: ; nF.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 4: ; I> I: ; ( .?: ; 'I@B: ; I 4: ; I!4: ; I"4: ; I# $1X Y %1&1'B(1)1*.?: ; n'I 4+: ; I,-.?<n: ; n..?<n: ; /.?<n% U$ > : ; I$ > I!I/   I &I  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I1 B!1".?<n: ; #.?<n: ;$.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 !I.?: ; 'I@B: ; I : ; I!4: ; I"4: ; I#4: ; I$4: ; I% &1RUX Y '1(1)B*1+1,!I/-.?: ; 'I 4.: ; I/.?<n: ; n0.?<n: ; 1.?<n% U$ > : ; I$ >   I7I&I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! U"1#B$1RUX Y %1&1'1(!I/).?: ; 'I 4*: ; I+.?<n: ; ,.?<n: ; n-.?<n% U$ > : ; I$ >   I7I&I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I!4: ; I" #1RUX Y $1%1&B'1(1).?: ; 'I 4*: ; I+.?<n: ; n,.?<n: ; -.?<n: ;..?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I &4: ; I'4: ; I( )1RUX Y *1+ U,41-41.1/B01112.: ; 'I@B3 U4 5.: ; 'I@B64: ; I7.: ; 'I 8: ; I9.?<n: ; :.?<n% U: ; I$ > $ > &I I 7I &  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( (! : ; " : ; I# : ; $4: ; I%.?: ; 'I@B&: ; I'B1(.?: ; 'I ): ; I*: ; I+4: ; I,4: ; I-!I/.: ; I/4: ; I04: ; I11RUX Y 21314B51617.?: ; 'I@B84: ; I9 :.?: ; 'I 4;.1@B<41=41>1? 1@ A41B.?<n: ; nC.?<n: ; D.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 4: ; I.?: ; 'I@B: ; I: ; I1 B!1".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 7I.?: ; 'I@B: ; I4: ; I U 4: ; I!1RUX Y "1# U$41%41&1'B(1)1*.: ; 'I +: ; I,4: ; I-.?<n: ; ..?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((7I 4: ; I?!.?: ; 'I@B": ; I#4: ; I$4: ; I%1&B'1(.?<n: ; % U$ > : ; I$ > &II!I/   I  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((.?: ; 'I@B : ; I!4: ; I"4: ; I#1$B%1&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I! : ;"(# : ; $ : ; I%> I: ; &4: ; I' : ; ( : ; I).?: ;'I@B*: ;I+: ;I,4: ;I-B1.B/.?: ; 'I@B0: ; I1: ; I24: ; I31RUX Y 415 U6417418191:1;.?: ; 'I@B<4: ; I=4: ; I >4: ; I? @.: ; 'I A: ; IB4: ; IC.?<n: ; D.?<n% U$ > $ > &I: ; I  I4: ;I?<  : ;  : ; I8  : ;  : ; I I!I/ : ;I''I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1RUX Y '1(1)B*1+1,.?: ; 'I@B-: ; I.4: ; I/4: ; I 04: ; I1 U213.: ; 'I@B4 5 U6417.: ; 'I 8: ; I9: ; I:.?: ;n'I ;: ;I<.?<n: ;n=.?<n: ; >.?<n?.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I 1 4: ; I!4: ; I"4: ; I# $1%B&.?<n: ; '.?<n: ;(.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I> I: ;  ( ! : ; " : ; I# I8 $.?: ; 'I@B%: ; I&4: ; I'4: ; I( U)4: ; I *4: ; I+ ,1-B.1/.?<n: ; 0.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 I !I/  : ;   : ;  : ; I: ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; !( "7I#.?: ; 'I@B$: ; I%4: ; I&4: ; I'4: ; I (4: ; I) *1+B,1-.?<n: ; ..?<n: ;n/.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  > I: ; ( : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I!4: ; I"4: ;I#4G: ;$.?: ;'@B%: ;I&: ;I'4: ;I(1)B*1+.?: ;'I@B,: ;I-.?: ;'@B.1/.?: ;'@B04: ;I14: ;I 24: ;I3 U44: ;I5 6.?: ;'I 7: ;I84: ;I9.1@B:1;41<41= 1> ?41@.?<n: ; A.?<n: ;% U$ > : ; II!I/  : ;  : ; I8  : ;  $ >    I &I : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I &4: ; I'4: ; I( )1RUX Y *1+ U,41-41.1/B01112.: ; 'I 3: ; I44: ; I5.?<n: ; 6.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 !I.?: ; 'I@B: ; I : ; I!4: ; I"4: ; I#4: ; I$ %4: ; I&1RUX Y '1(1)1*B+1,1-!I/. U/.?: ; 'I 40: ; I1.?<n: ; n2.?<n: ; 3.?<n: ;4.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I4: ; I 4: ; I! "1#B$1%.?<n: ; &.?<n: ;'.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I !1"B#1$.?<n: ; %.?<n: ;&.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! "1#1$B%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I1B 1!.?<n: ; ".?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I1 1!B"1#.?<n: ; $.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B4: ; I 1!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$1%1&B'1(.?: ; '@B)B1*.?<n: ; +.?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 I !I/  : ;   : ;  : ; I: ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%1&1'B(1).?<n: ; *.?<n: ;n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!B1"1#: ; I$.: ; 'I@B%4: ; I&4: ; I'4: ; I( ).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I 4: ; I! U"1RUX Y #1$1%B&1'1(.?: ;'I 4): ;I*.?<n: ;n+.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1B1 1!B".?<n: ;#.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!B1"1#: ; I$.: ; 'I@B%4: ; I&4: ; I'4: ; I( ).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!> I: ; "4: ; I#.?: ; 'I@B$: ; I%4: ; I&1'B(1).: ; 'I@B*: ; I+ ,4: ; I -4: ; I.1/.: ; '@B0.?<n: ; 1.?<n2.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I.?: ; 'I@B : ; I!: ; I"4: ; I#1$B%1&1'.?<n: ; % U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I !1"B#1$.?<n: ; %.?<n: ;&.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! "1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; : ; I.?: ; 'I@B: ; I4: ; I 1!1"B#B1$.?<n: ; %.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I1 1!B".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 > I: ;  ( : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I 4: ; I! U"1X Y #1$ 1%41&41'1(B)1*.: ; 'I +: ; I, -4: ; I..?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!.?<n: ;".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > $ > &I: ; I  I : ;  : ; I8 I !I/ ' 4: ;I?< : ; : ;I'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1'B(1) *4: ; I+4: ; I, -1..: ; 'I@B/: ; I04: ; I 1 U2.: ; '@B3.?<n: ; 4.?<n% U4: ; I?< I$ > &I$ > : ; I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! : ; " U# $1%B&1'1(.?<n: ; ).?<n% U$ > &I: ; I$ >   I : ;  : ; I8 : ;I ' 4: ;I?< 'I5I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( 4: ; I  : ; !4: ;I"4: ;I#.?: ;'I@B$: ;I%: ;I&1'B(1)1RUX Y*1+ U, 1- 1U.41/ 1U0 11124: ;I3.: ; ' 4: ; I5 : ;6 74: ; I8 94: ; I:4: ;I;.?<n: ; <.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1'B(1).: ; 'I@B*: ; I+4: ; I,4: ; I - ..?<n: ; /.?<nL /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysaccess.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h @i3?YW=YYiu /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/arpaaddrofstr.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hinet.hsocketaddr.hfail.h Pj*kSA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syschdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h jY7YYYhuL /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syschmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstat.h k8AYYYZՃgA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcst2constr.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tbl lK)ZV! ../../runtime/caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/includecaml/usr/include/x86_64-linux-gnu/syscstringv.cmlvalues.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hstdatomic.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h @m~JK#v:>XZ n(uLI=-5 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecv.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h @nwq?Y;=Y;=: /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecve.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h npY=Y;=Ye=i /usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecvp.cerrno.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h 0owq?Y;=Y;= o.o kY=Y;=Z>Y\8@Y| /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfsync.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h  p A>V?uYZrL /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysmkdir.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstat.h `p8AYYYZՃn /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlexit.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h `qKM /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetaddrinfo.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hnetdb.halloc.hcst2constr.hsignals.h pq<#yX%F<C0Y;Y;pXJpJt|u=-Y .YYXX;gu!nWo^z<BVv XI/sZVG?WYLJt@XtYYWY=OSAS<+"zt3'# /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysgetcwd.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h  w& ~Xt~f.~XY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgethost.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hsignals.hfail.halloc.h w.Wu$8C[GMGYrZYu˄usutX 0y$=  @y)=  Py6v.W f;misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblsignal.hunistd.hgetopt_core.hunixsupport.halloc.h { }XJ}f}X;YY1 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetnameinfo.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hnetdb.hfail.h P{$f=W|yQy<  v0YY%Z;YYsYYWY=ui/X_ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgetproto.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hfail.halloc.h |Wu$GYIKYsYYuuu X }+ >Z  ~4LY=IW /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgetserv.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hfail.halloc.h P~ Wu'G0YIYYIYYsYY/us X 1ZI=-U ;Z:vKZI=-U /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescamlgmtime.cstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hstruct_tm.htime.halloc.h  ",>0 (JY;KYYH0 2JY;KYYH0 p>=WtrXr<&DxuYI=/IKsYYui%X5i /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlmmap_ba.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hbigarray.hcustom.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hroots.hmemprof.hstdlib.hcamlatomic.h /IMyyyJCy.Mc p> .-"/KHA,KK/Ku(/KH?KKw /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysputenv.cstddef.htypes.hstdint-intn.h__sigset_t.hsetjmp.hsetjmp.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstdlib.h tA;=Y]vB @; ?\tt <9 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysrename.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h pxY;=YYiA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysrmdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h  Y7YYYhu0 /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetsocketaddr.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hstring.h rgY-YWY=ut] !A   ->  08/wXJX=YH==jt`J#t]<#XJa fuX =`8 JWwH1l)fo YYDuX(/zJP. J\z6X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/arpastrofaddr.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hin.hinet.halloc.h 03Ys V /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamltime.cstddef.htypes.htime_t.htime.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h KIY ЋKYIB /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysunlink.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h Y7YYYhu9 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/x86_64-linux-gnu/sysaccept_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hin.hun.hsocketaddr.hsignals.hsocket.halloc.hsocket_type.h J=Wz7  vXvZ"Y\sYYuf(X - /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetbind_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h  zmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hin.hsocketaddr.hsocket.herrno.hsocket_type.h % |..|Xt|X.|XYWEtiwv YYLI=-W ЏYYLI=-W /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlclose_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h   =>V?uYZr@ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetconnect_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsignals.hsocket.h `ymisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hfcntl.h  @W\u) /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/sysenvir_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hunistd.hgetopt_core.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblauxv.halloc.h 0 P<nJ[0HF /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syserrmsg_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hmath.htime.hsys.halloc.h t0Yg 6  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetpeername_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h &zmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pKuIY6  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetsockname_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h &zmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hsetjmp.hsetjmp.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h LVY  pKYIu /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlisatty_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KI{ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamllink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h <YW=YuOYhus>V>zvtX /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syslisten_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.h @K /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamllockf_unix.ctypes.hfcntl.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.hfcntl.herrno.h p&>xfJ ;g2ZzY!.Yu Xw)u/^fN4WYsYYYt$ /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamllseek_unix.ctypes.htypes.hstddef.hstdint-intn.hthread-shared-types.hpthreadtypes.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h *tj:YYgYU p6tAL;YYg=IW ../../runtime/caml/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/bits/typescamlmmap_unix.cmlvalues.hstat.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hthread-shared-types.hpthreadtypes.hmisc.htime.hlibio.hstdio.hdomain_state.hdomain_state.tblfail.hbigarray.hsetjmp.h__sigset_t.hsetjmp.hplatform.hio.hsignals.hunistd.hstdatomic.hconfname.hgetopt_core.hunixsupport.hmath.hstat.hmman.herrno.h З Jv< Jw< .vf <v< tI-Ns< .tJ-KJJK;UgIK.Z]X}Jݛ[[9Y-=h9?gY!-YX-fY)b\=-=KWlX}J_TsYY_;T К VLZ`w=>Hh,/ /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlopen_unix.cfcntl2.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.halloc.hsignals.h P:U-9Y=YQvlX Y]ջntMvqJX~ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlpipe_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h МJ ȻtJ  /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlread_unix.cunistd.hstring_fortified.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hbigarray.hunistd.hgetopt_core.hunixsupport.hsignals.h P7 rX_Y4zXlYYb@Vst X )$SzJ_V7z<y<yX`xJ Yhջst Xi /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlreadlink_unix.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hsignal.hunistd.hgetopt_core.hunixsupport.halloc.hsignals.h #XYX.YY=;YYus< X /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlrealpath_unix.cstdlib.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.halloc.hstdlib.h РY(Xp<pmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.halloc.hselect2.h #/-/Wg;!Kgc>v"7/] p0<H=Guh!g'uvX t < uX u= v u 1YW=W=KK,KfuXYYɁYYYYsYYul%.wXFX /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscaml/usr/include/netinetsendrecv_unix.csocket2.hstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hsocket.h Х z<(Y*\b3Ygzlz<`rf X 3 v<Wp.[NY1iYafa< XsYYh'X oy73Y=O<1XOJ2YgYZ yt_y<`xX5Y=Z<XX.YYZ: Ъ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysshutdown_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.h K11 caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/types/usr/include/x86_64-linux-gnu/syssleep_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hstruct_timespec.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.herrno.h 0 0HKIfl~J~yYYXg /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssocket_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hsocket.hsocket_type.h *:> h>r>=;=;]/YzJ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssocketpair_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.halloc.hsocket_type.h P?9Z:r>=;=; 任u  caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/types/usr/include/x86_64-linux-gnu/sys/usr/include/netinetsockopt_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hunistd.hgetopt_core.hmath.htime.hsocket.hin.hsocketaddr.hmathcalls.hsocket.halloc.h KzJ=u^ yX zw 2SIKubtY;Ytp<# `.Q^u5YgI=kj(;Y[/9xX  ==:>/sKeK  а=;==g /usr/include/x86_64-linux-gnu/sys/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlstat_unix.cstat.htypes.htypes.htime_t.hstddef.hstdint-intn.hstruct_timespec.hthread-shared-types.hpthreadtypes.hstat.hstdint.hconfig.hmisc.hmath.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hplatform.hio.hunistd.hgetopt_core.hunixsupport.htime.hmathcalls.halloc.hcst2constr.h .u J=qJyutfyXQvHMhXJeXR}nGMgXJdXR}nGM\8\fsYY;[!u!!uJWJ\8\fgt)  X}X=7YX}.Yg<uV ` X}X=7YX}.Yg<uV \8t}<1Y<}YYV p X}X=7YX}.Ygu  X}X=7YX}.Ygu .}misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h  <YW=YYiupX p,YL /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/systimes_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hstruct_timeval.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstruct_rusage.halloc.hresource.hresource.h 4z|xX4ZV>YN8TdHLYd# /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamltruncate_unix.ctypes.htypes.hstddef.hstdint-intn.h__sigset_t.hthread-shared-types.hpthreadtypes.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hplatform.hio.hunistd.hgetopt_core.hunixsupport.hmath.htime.h 8AYYY[Ճ 0?KYYYiu0 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysunixsupport_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hstdatomic.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hplatform.hunistd.hgetopt_core.hunixsupport.hmath.htime.hfcntl.herrno.halloc.hcallback.hcst2constr.h  vt <Z_z i 0.=u/u;=5Y;YY;YYsYY@8=rX;=18   s i =- gs/YY-[W  @=- gs/YY-[W ! caml/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/caml/usr/include/x86_64-linux-gnu/sysutimes_unix.cunixsupport.hsetjmp.h__sigset_t.hsetjmp.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hstruct_timeval.hselect.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.h #KYZKYIK=;QYYu~Xu~XyXQyX^u~X~V$ /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlwrite_unix.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hbigarray.hunistd.hgetopt_core.hunixsupport.hsignals.herrno.h P^;?x<9j7 >:=uy<9Y ===vYg misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlchown.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h  Y(YYYYZuu X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlchroot.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h Y(YYYhuu X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlclosedir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hdirent.h Y4YYYZuux.Z4n /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamldup2.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h /KMg=uXwWzX  /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysfchmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.hstat.h p;YYZ} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfchown.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h ti;YYYZz /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfcntl.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hfcntl.h "YY-\r `&"YY-\r 0sK  6sK B /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/sys/usr/include/x86_64-linux-gnu/bits/typescamlfork.cstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hdebugger.hunistd.hgetopt_core.hunixsupport.hmath.htime.hdomain.hsetjmp.hsetjmp.hruntime_events.h   KYuI  $"ZKZZYw.wtz s /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamlftruncate.ctypes.htypes.hstddef.hstdint-intn.h__sigset_t.hthread-shared-types.hpthreadtypes.hsetjmp.hsetjmp.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h ;YYZ (\8LKYYZq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetegid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h PKuIYq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgeteuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pKuIYp /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetgid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetgr.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hgrp.herrno.hfail.halloc.h Wu'G0[G[/IYYsYYuqX ,Y;YYb I=-o P<[9LY;YYiI=-F /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlgetgroups.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.herrno.halloc.h =- ~<~.2~X<~X<~.5-=!-ZpX} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetlogin.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h pLYY=IWq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetppid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetpw.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hpwd.herrno.hfail.halloc.h Wu'9VYIYZHZ\F\YIYYsYYujX P2Y;YYb I=-o [9LY;YYiI=-p /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlinitgroups.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hgrp.h 02>  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysitimer.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hstruct_timeval.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.hmathcalls.h :[g=eK. '"V>' p38N:YWY ="dJVD" /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/syskill.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hsetjmp.hsetjmp.hunistd.hgetopt_core.hunixsupport.hmath.htime.hsignal.hsignals.h : ?;Zq' /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysmkfifo.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hstat.h G+9\YYY[ust Xy /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlnice.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.herrno.h \8LZ:\ZIudt  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlopendir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hdirent.halloc.h  Y(YYYY=uq  X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlreaddir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hdirent.hsignals.halloc.hfail.hdirent.h 0#=YYYYKS2 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlrewinddir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hdirent.h K=YZp /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlsetgid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h K ../../runtime/caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/syscamlsetgroups.cmlvalues.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hgrp.hstdatomic.h ~JK;=Z:0YZ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlsetsid.cstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pLYY3E]z p /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlsetuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h K /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssignals.ctypes.h__sigset_t.hsigset_t.hsignal.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.herrno.hsigthread.halloc.h Y;uY  'UJ=ՃYSՃ 7Ao%73=>KYZYK c1Yuۃv  pc1YYYZ T2YYKu5 /usr/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/camlcamlspawn.cerrno.htypes.htypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hspawn.h #6xt|Z=1;=+vg;=/LB[ JxXYewYYvh-=" /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamltermios.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.htermios.htermios.halloc.h N8bXY-=<&<;KYKFOf*II?+=0/-ɝzo.+Lo28\FYuy< 0Pz<zXPzXX*t.=+K=pIK?+?up*@ .tz6JyX K K K1  K1 /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysumask.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hstat.h `KIY~ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/syswait.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.hwait.h **=Ճjḥ;Y>q#=  XYYYV P[v7JuYYYdslice_targetc_stack_linkallocated_words_resumedmark_stackcaml_verb_gcdependent_size_IO_2_1_stderr_backtrace_slotmemprof_IO_save_endcaml_minor_gc_end_hook_sys_siglistextra_heap_resources_IO_write_basecaml_finalise_end_hookstderrshared_heapcaml_heap_state_IO_save_baserequested_major_slicecaml_ref_table_chain_cur_columncaml_minor_heaps_endcaml_custom_tablecaml_gc_mark_phase_requestedstat_promoted_wordscaml_leave_blocking_section__environlocal_rootstrap_barrier_offstat_forced_major_collectionscaml_unix_check_pathcaml_convert_flag_list_IO_markercaml_intern_statestat_blocks_markedcaml_finalise_begin_hookcaml_major_cycles_completedcaml_final_infomemprof_domain_scompare_unorderedGNU C11 7.5.0 -mtune=generic -march=x86-64 -g -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fno-tree-vrp -ffunction-sections -fPIC -fstack-protector-strongcaml_minor_tablesntables_IO_FILEcaml_extern_state__timezonetrap_sp_off/home/teraram/ci/builds/workspace/parallel-build/flambda/false/label/ocaml-manycores/otherlibs/unixcaml_enter_blocking_section_hookunsigned charbacktrace_last_exncaml_custom_eltPhase_mark_finalcaml_minor_gc_begin_hookcaml__roots_path__tzname_Bool_IO_FILE_pluscaml_gc_policycaml_ephe_ref_table_IO_lock_textra_paramscv_flagsmajor_work_done_between_slicesPhase_sweep_and_mark_main_IO_read_ptryoung_startfp_offsetstdincaml_enter_blocking_section_markerssweeping_done__va_list_tagreserveaccess_permission_tablecaml_leave_blocking_section_hookcaml_exception_contextcaml_minor_collections_countoptindcaml_unix_accessoo_next_id_localminor_heap_wszcaml__frame_IO_2_1_stdin_caml_major_slice_begin_hookcaml_runtime_warnings_flags2dependent_allocatedcaml_fatal_error_hook_IO_read_baseslice_budgetcaml_stat_free_unused2uintptr_tcaml_timing_hookcaml_domain_stop_hookyoung_end_old_offsetexternal_raisec_stacktz_minuteswestgc_regs__stack_chk_failcaml_atfork_hooklong long intmarking_donetrap_barrier_blockcaml_ephe_infocaml__dummy_pathcaml_minor_heaps_start_IO_write_endgc_phase_tcaml_domain_external_interrupt_hookgp_offsetcaml_domain_terminated_hookfloatswept_wordscaml_stat_strdupthreshold_IO_buf_basecaml_major_slice_epochcaml__temp_resultcaml__roots_blockgc_regs_bucketscaml_major_slice_end_hook__pad2__pad3__pad4__pad5requested_external_interrupt_sbufPhase_sweep_ephecurrent_ramp_up_allocated_words_diffoverflow_arg_areanitemsallocated_wordsyoung_limitlong doublePhase_sweep_mainunique_idoptoptallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningbacktrace_bufferlong long unsigned intreg_save_areasigngam__off_tallocated_words_suspendedephe_refinside_stw_handleropterrcaml_minor_heap_max_wsz_IO_backup_base_shortbuf_IO_2_1_stdout_char_os__off64_tbacktrace_activestat_major_wordsmemprof_young_triggerrequested_minor_gc_IO_buf_endcaml_pending_signalscurrent_stackatomic_uintnatshort intrequested_global_major_sliceatomic_intnat_vtable_offsetpermsextra_params_areaexn_handler__daylight__int64_textra_heap_resources_minorcaml_domain_initialize_hookcaml_uerroryoung_ptrcaml_local_roots_ptr_IO_read_endasize_tdls_rootmlsize_tstack_infostat_minor_wordslocked_filenotz_dsttimecaml_unix_cloexec_defaultoptargshort unsigned intstdoutmajor_ref_IO_write_ptrparser_tracecaml_domain_statestack_cachecaml_ephe_ref_eltcaml_gc_phaseaccess.c__pad1__in6_u__uint8_tin_addr_taddress6__u6_addr16__u6_addr32in6addr_loopback__uint32_ts_addrcaml_unix_inet_addr_of_stringcaml_unix_alloc_inet_addraddresscaml_unix_alloc_inet6_addrin6addr_anyinet_ptonaddrofstr.ccaml_string_is_c_safe__uint16_t__u6_addr8caml_failwithcaml__dummy_dirnamechdir.ccaml_unix_chdircaml__roots_dirnamevpermcaml_unix_chmoddefltcaml_unix_cst_to_constrcst2constr.ccmdnamememory_order_acquirecaml_stat_allocheader_tcaml_unix_cstringvect_free__atomic_load_ptrmemory_order_acq_relmemory_order_consumememory_order_seq_cstmemory_order_releasecaml_unix_errormemory_order_relaxed__atomic_load_tmpcstringv.cHd_valcaml_unix_cstringvectwpathcaml_unix_execvexecv.cargvargsenvpexecve.ccaml_unix_execve_sys_nerr__errno_locationcaml_unix_execvpeprogram_invocation_nameprogram_invocation_short_name_sys_errlistgetdate_errcaml_unix_execvpexecvp.ccaml_unix_fsyncfsync.cmkdir.ccaml_unix_mkdircaml_unix_exitexit.csockaddr_in6ai_addrlensin_familyai_flagssin6_addrai_nextvaddrai_canonnamevoptss_unixs_gencaml_bad_caml_statesin6_scope_idsock_addr_unionsockaddr_insin_portsin6_port__socklen_tsa_familysin_zerocaml_alloc_smallcaml__roots_vnodeai_familyfreeaddrinfoai_socktypes_inet6sun_path__builtin___memcpy_chkcaml_unix_socket_type_tablecaml__dummy_vrescaml__dummy_vnode__chhintsconvert_addrinfosin_addrsocklen_param_typeai_addrsin6_familysockaddr_unsun_familysa_family_tvcanonnamememsetcaml_copy_stringgetaddrinfo.ccaml_string_length__src__lencaml_unix_alloc_sockaddrcaml_unix_socket_domain_table__destvservcaml_unix_getaddrinfomemcpycaml__roots_vressa_datasin6_flowinfos_inetai_protocolin_port_tretcode__getcwd_alias__jmp_buf_tagexn_bucketlongjmp_buffer__mask_was_saved__sizesigjmp_buf__buf__saved_maskgetcwd.c__jmpbuf__jmp_bufcaml_unix_getcwd__val__sigset_talloc_one_addr_16caml_unix_gethostbynamehostentcaml_alloc_initialized_stringh_namecaml_raise_not_foundgethost.ccaml_alloc_arrayh_addrtypegethostbyaddr_ralloc_one_addr_4caml_atomh_aliasesh_addr_listh_errnopgethostbyname_rcaml_copy_string_arraycaml__roots_nameaddr_typealloc_one_addrcaml__dummy_namealloc_host_entrycaml_unix_gethostbyaddrgethostname.ccaml_unix_gethostname__gethostname_alias__buflencaml__roots_vhostcaml_unix_getnameinfogetnameinfo_flag_tablegetnameinfo.ccaml__dummy_vhostcaml_unix_get_sockaddrgetproto.cprotoentcaml_unix_getprotobynamep_protocaml_unix_getprotobynumberalloc_proto_entryp_aliasesp_namealloc_service_entrys_aliasesserventgetserv.cs_portcaml_unix_getservbyportcaml_unix_getservbynames_prototm_hourtm_ydaytm_zonecaml_copy_doubleclkvalcaml_unix_gmtimealloc_tmtm_isdstcaml_unix_mktimetm_montm_mingmtime.ccaml__roots_tmvaltm_yeartm_gmtofftm_wdaycaml__dummy_tmvaltm_mday__time_ttm_seccaml_unix_localtimeclockcaml_ba_mapped_opscaml_ba_byte_sizecaml_int64_opsscanning_actionCAML_MEMPROF_NUM_SOURCE_KINDScaml_custom_major_ratiocaml_int32_opsCAML_BA_MANAGEDdimcopycustom_operationsmmap_ba.cCAML_MEMPROF_SRC_MAP_FILEcaml_ba_managedcomparecaml_ba_element_sizecaml_scan_roots_hookcaml_alloc_customcaml_unix_mapped_allocmem_wordsSCANNING_ONLY_RECENT_FRAMEScounterrefcountSCANNING_ONLY_YOUNG_VALUEScaml_nativeint_opscaml_atomic_counter_decrcompare_extcaml_ba_arrayCAML_MEMPROF_SRC_NORMALnum_dimscaml_ba_mapped_finalizecaml_ba_opsdeserializecaml_ba_proxyCAML_BA_MAPPED_FILEscanning_action_flagscaml_ba_unmap_fileasizebsize_32CAML_BA_EXTERNALCAML_MEMPROF_SRC_MARSHALcaml_memprof_sample_blockbsize_64custom_fixed_lengthhashCAML_MEMPROF_SRC_CUSTOMidentifiercaml_stat_strconcatcaml_unix_unsetenvputenv.ccaml_unix_putenvp_newnewnamerename.coldnamep_oldcaml_unix_renamecaml_unix_rmdirrmdir.cclose_on_errormladrstrnlen__builtin_memmovecaml_alloc_stringpath_lengthstruct_offsetcaml__dummy_aadr_lencaml__roots_rescaml__dummy_rescaml__roots_aalloc_unix_sockaddrsocketaddr.cstrofaddr.ccaml_unix_string_of_inet_addrinet_ntopcaml_unix_time_unboxedcaml_unix_timecaml_unix_unlinkunlink.csockaddr_atSOCK_RAWsockaddr_x25sockaddr_inarpsockaddr_ipxsockaddr_dlsockSOCK_DCCPsockaddr_isoSOCK_SEQPACKET__socket_typeSOCK_STREAMsockaddr_eoncaml_unix_acceptsockaddr_nsSOCK_NONBLOCKaccept4accept_unix.cSOCK_DGRAMSOCK_CLOEXECSOCK_PACKETSOCK_RDMsockaddr_ax25caml_unix_cloexec_pbind_unix.ccaml_unix_bind__glibc_reservedst_ctim__kindst_blksizest_blocks__pthread_list_t__gid_tst_mtim__next__data__prev__pthread_internal_listchannels_unix.c__ownercaml_unix_inchannel_of_filedescr__dev_tcaml_plat_mmap_alignmentcaml_plat_mutex__nusers__blksize_tst_uid__pthread_mutex_s__spinsst_rdev__syscall_slong_t__fxstat64__mode_t__lockso_type_lenst_gidcaml_all_opened_channelsso_typest_sizechannelcurrfstat64file_offset__blkcnt_t__ino_tcaml_ml_open_descriptor_outcaml_plat_futex_wordcaml_plat_pagesizecaml_unix_check_stream_semanticscaml_unix_outchannel_of_filedescrpthread_mutex_t__pad0__fd__fxstat__countst_nlinkst_devtimespec__listcaml_ml_open_descriptor_in__aligntv_nsec__elisionst_mode__uid_tst_ino__nlink_t__statbuftv_secst_atimcaml_unix_closeclose_unix.cconnect_unix.ccaml_unix_connectcaml_unix_dupfcntldup_unix.ccaml_unix_environment_unsafeenvir_unix.cgetauxvalcaml_unix_environmentsecure_environcaml_strerrorerrmsg_unix.ccaml_unix_code_of_unix_errorcaml_unix_error_messageerrnumcaml_unix_getpeernamegetpeername_unix.ccaml_unix_getpidgetpid_unix.cgetsockname_unix.ccaml_unix_getsocknamecaml_unix_gettimeofdaygettimeofday_unix.ccaml_unix_gettimeofday_unboxed__suseconds_ttv_usecisatty_unix.ccaml_unix_isattylinkatcaml__dummy_followcaml_unix_linkcaml__roots_followpath1path2caml_unix_listenbackloglisten_unix.cl_startl_typel_pid__pid_tfildeslockf_unix.cl_whenceflockspanl_lencaml_unix_lockflseek64caml_unix_lseekcaml_copy_int64caml_unix_lseek_64lseek_unix.cseek_command_tableofs_c_SC_LEVEL3_CACHE_SIZE_SC_MAPPED_FILES_SC_CHILD_MAX_SC_CLK_TCK_SC_SIGQUEUE_MAX_SC_THREAD_ROBUST_PRIO_INHERIT_SC_DEVICE_IO_SC_JOB_CONTROLstartpos_SC_CHAR_MAX_SC_TRACE_INHERIT_SC_MEMLOCK_RANGE_SC_PII_SOCKET_SC_CHAR_MIN_SC_SAVED_IDS_SC_ARG_MAX_SC_TIMEOUTS_SC_CHAR_BIT_SC_AIO_LISTIO_MAX_SC_MB_LEN_MAX_SC_THREAD_PRIO_PROTECT_SC_PII_INTERNET_SC_THREAD_PROCESS_SHAREDvstart_SC_TRACE_NAME_MAXpwrite_SC_PII_SC_MEMORY_PROTECTION_SC_OPEN_MAX_SC_THREAD_THREADS_MAX_SC_READER_WRITER_LOCKS_SC_STREAMS_SC_2_C_VERSION_SC_THREAD_ROBUST_PRIO_PROTECT_SC_BC_DIM_MAXCAML_BA_FORTRAN_LAYOUT_SC_THREAD_ATTR_STACKADDR_SC_V7_ILP32_OFF32_SC_V6_ILP32_OFFBIG_SC_2_PBS_LOCATE_SC_LEVEL1_DCACHE_LINESIZEmunmap_SC_TRACE_EVENT_FILTER_SC_NL_LANGMAX_SC_V6_LP64_OFF64_SC_NL_MSGMAX_SC_USER_GROUPS_SC_LEVEL1_ICACHE_ASSOC_SC_DEVICE_SPECIFIC_R_SC_NZERO_SC_XOPEN_XPG2_SC_XOPEN_XPG3_SC_XOPEN_XPG4_SC_ULONG_MAX_SC_XOPEN_ENH_I18Nmmap64_SC_INT_MIN_SC_2_UPEcaml_grow_file_SC_PAGESIZE_SC_FILE_SYSTEM_SC_2_VERSION_SC_RE_DUP_MAX_SC_LEVEL3_CACHE_ASSOC_SC_2_FORT_DEV_SC_SCHAR_MAX_SC_IOV_MAX_SC_THREAD_CPUTIME_SC_SYSTEM_DATABASEmmap_SC_PII_INTERNET_DGRAM_SC_SSIZE_MAXst_ctime_SC_FILE_LOCKING_SC_SCHAR_MINst_ctimensec_SC_INT_MAX_SC_UIO_MAXIOV__syscall_ulong_t_SC_NPROCESSORS_ONLN_SC_C_LANG_SUPPORT_R_SC_VERSION_SC_LEVEL1_DCACHE_ASSOCfile_size_SC_SPIN_LOCKS_SC_UINT_MAXCAML_BA_C_LAYOUT_SC_THREADS_SC_THREAD_SAFE_FUNCTIONS_SC_WORD_BIT_SC_REGEXPcaml_invalid_argument_SC_ASYNCHRONOUS_IO_SC_CHARCLASS_NAME_MAX_SC_XOPEN_VERSION_SC_LEVEL3_CACHE_LINESIZE_SC_THREAD_STACK_MIN_SC_2_C_DEV_SC_XOPEN_UNIX_SC_NL_TEXTMAX_SC_PII_INTERNET_STREAM_SC_GETGR_R_SIZE_MAX_SC_V7_ILP32_OFFBIG_SC_SEMAPHORES_SC_LEVEL4_CACHE_SIZE_SC_MULTI_PROCESSdata_size_SC_2_LOCALEDEF_SC_LINE_MAX_SC_PHYS_PAGES_SC_XOPEN_REALTIME_SC_MONOTONIC_CLOCKvkind_SC_RTSIG_MAX_SC_FILE_ATTRIBUTES_SC_USER_GROUPS_R_SC_XOPEN_XCU_VERSION_SC_PII_XTI_SC_XOPEN_REALTIME_THREADSmmap_unix.c_SC_LONG_BIT_SC_FIFO_SC_XBS5_ILP32_OFFBIG_SC_UCHAR_MAX_SC_PIPE_SC_TYPED_MEMORY_OBJECTS_SC_LOGIN_NAME_MAX_SC_THREAD_KEYS_MAX_SC_ADVISORY_INFO_SC_RAW_SOCKETSst_mtimensec_SC_COLL_WEIGHTS_MAX_SC_PII_OSI_M_SC_SYSTEM_DATABASE_R_SC_BC_SCALE_MAX_SC_TRACE_EVENT_NAME_MAX_SC_USHRT_MAX_SC_HOST_NAME_MAX_SC_BC_STRING_MAXvshared_SC_THREAD_PRIORITY_SCHEDULINGcaml_unix_map_filepage_SC_2_SW_DEV_SC_REALTIME_SIGNALScaml_unix_map_file_bytecodecaml_ba_layout_SC_XBS5_LPBIG_OFFBIG_SC_2_PBS_ACCOUNTINGvdim_SC_THREAD_DESTRUCTOR_ITERATIONS_SC_TRACE_LOGst_atime_SC_MEMLOCK_SC_PII_OSIpwrite64_SC_DELAYTIMER_MAX_SC_2_FORT_RUN_SC_V7_LP64_OFF64_SC_NPROCESSORS_CONF_SC_SHRT_MAX_SC_AIO_MAX_SC_BARRIERS_SC_REGEX_VERSION_SC_LEVEL2_CACHE_LINESIZE_SC_C_LANG_SUPPORT_SC_DEVICE_SPECIFIC_SC_SHARED_MEMORY_OBJECTS_SC_XBS5_LP64_OFF64major_dim_SC_LEVEL4_CACHE_ASSOC_SC_V7_LPBIG_OFFBIG_SC_NL_ARGMAXftruncate64_SC_SINGLE_PROCESS_SC_AVPHYS_PAGES_SC_XOPEN_SHMdelta_SC_THREAD_SPORADIC_SERVER_SC_SS_REPL_MAX_SC_NL_NMAX_SC_SIGNALS_SC_2_PBS_MESSAGE_SC_SEM_NSEMS_MAX_SC_T_IOV_MAX_SC_PRIORITIZED_IOargn_SC_V6_ILP32_OFF32_SC_STREAM_MAXvlayout_SC_TZNAME_MAX_SC_2_PBS_CHECKPOINT_SC_SPAWNst_mtimesysconf_SC_TRACE_SYS_MAX_SC_SYMLOOP_MAX_SC_2_CHAR_TERM_SC_SHELL_SC_FD_MGMT_SC_XOPEN_CRYPT_SC_LEVEL1_ICACHE_LINESIZE_SC_AIO_PRIO_DELTA_MAX_SC_TRACE_USER_EVENT_MAX_SC_TIMER_MAX_SC_2_PBS_SC_CPUTIME_SC_SPORADIC_SERVERmsync_SC_CLOCK_SELECTION_SC_XBS5_ILP32_OFF32_SC_NETWORKING_SC_LEVEL4_CACHE_LINESIZE_SC_ATEXIT_MAX_SC_IPV6_SC_PII_OSI_COTS_SC_MQ_PRIO_MAX_SC_SEM_VALUE_MAX_SC_TIMERS_SC_PASS_MAX_SC_FSYNC_SC_SELECT_SC_TTY_NAME_MAX_SC_POLL_SC_MESSAGE_PASSING_SC_LEVEL2_CACHE_ASSOC_SC_BC_BASE_MAX_SC_LEVEL2_CACHE_SIZE_SC_EXPR_NEST_MAX_SC_SYNCHRONIZED_IOst_atimensec_SC_PII_OSI_CLTS_SC_XOPEN_STREAMS_SC_LEVEL1_DCACHE_SIZE_SC_SHRT_MIN_SC_2_PBS_TRACK_SC_NGROUPS_MAX_SC_V6_LPBIG_OFFBIG_SC_LEVEL1_ICACHE_SIZE_SC_EQUIV_CLASS_MAX_SC_BASE_SC_PRIORITY_SCHEDULING_SC_GETPW_R_SIZE_MAX_SC_XOPEN_LEGACY_SC_THREAD_PRIO_INHERIT_SC_MQ_OPEN_MAX_SC_TRACE_SC_NL_SETMAX_SC_2_C_BINDarray_size_SC_THREAD_ATTR_STACKSIZEopen_flag_table__open_aliasopen_unix.c__path__oflagopen_cloexec_tableKEEPEXECclo_flagsopen64caml_unix_openvunitpipe2caml_unix_pipepipe_unix.c__read_aliascaml__dummy_vfdiobuf__ssize_tvofscaml__roots_vfd__read_chkcaml__dummy_bufvbufread_unix.cvlen__nbytescaml_unix_readcaml__roots_bufnumbytescaml_unix_read_bigarraycaml_unix_readlinkreadlink_unix.c__readlink_aliascaml__dummy_p__resolved__namecaml_unix_realpath__realpath_aliasrealpath_unix.ccaml__roots_pfrac_secfdlist_to_fdsetwritefds__fds_bitsmaxfdcaml__roots_lcaml_unix_select__fd_maskexceptfds__d0__d1caml__roots_readfdscaml_timeval_of_secnewresint_secmodfcaml__dummy_lcaml__dummy_readfdsexceptfdset_to_fdlistfd_setselect_unix.c__fdelt_chktimeout_secMSG_RSTMSG_WAITFORONEMSG_PEEKMSG_CTRUNCcaml_unix_recvMSG_FASTOPENMSG_WAITALLcaml__roots_adrcaml_unix_recvfromcaml__dummy_adrMSG_BATCHMSG_CMSG_CLOEXECMSG_EORMSG_OOBMSG_ZEROCOPYcaml__dummy_buffcaml_unix_sendto__flags__recv_chkMSG_SYNcaml__roots_buffargc__recvfrom_chkcaml_unix_sendto_nativeMSG_CONFIRMMSG_MOREsendrecv_unix.c__builtin___memmove_chkMSG_DONTWAIT__addrMSG_PROXYMSG_NOSIGNALMSG_FIN__addr_lenMSG_ERRQUEUEMSG_TRUNCMSG_DONTROUTEmsg_flag_tablecaml_unix_sendshutdown_unix.ccaml_unix_shutdownshutdown_command_tablenanosleepduration_seccaml_timespec_of_secsleep_unix.ccaml_unix_sleepsocket_unix.cdomaincaml_unix_socketsocketpair_unix.ccaml_unix_socketpairlevelsockopt_unix.cIPPROTO_MTPIPPROTO_ENCAPvsocketTYPE_LINGERsockopt_unix_errorIPPROTO_UDPsockopt_tablegetsockopt_fun_namecaml_unix_getsockopt_auxsockopt_lingerIPPROTO_IGMPcaml_unix_error_of_codeIPPROTO_IPIPPROTO_IPV6option_valueTYPE_INTIPPROTO_PIMIPPROTO_MPLSsockopt_boolIPPROTO_ICMPIPPROTO_UDPLITEcaml__roots_errIPPROTO_MAXIPPROTO_RAWTYPE_UNIX_ERRORoptsizeIPPROTO_RSVPIPPROTO_COMPcaml__dummy_errTYPE_BOOLsockopt_timevall_onoffIPPROTO_DCCPIPPROTO_ESPoptvalsetsockopt_fun_nameIPPROTO_TPcaml_unix_getsockoptIPPROTO_SCTPIPPROTO_PUPvoptionIPPROTO_IDPoption_typeIPPROTO_GREIPPROTO_EGPTYPE_TIMEVALcaml_unix_setsockopt_auxsockopt_intcaml_alloc_someIPPROTO_BEETPHsocket_optionl_lingerIPPROTO_IPIPIPPROTO_TCPcaml_unix_setsockoptIPPROTO_AHcaml_unix_lstatlstat64caml_unix_fstat_64__lxstatstat_timestampstat_auxcaml_unix_stat__lxstat64__xstat64caml_unix_lstat_64nextafter__xstatuse_64caml__dummy_atimecaml__roots_atimefile_kind_tablecaml_unix_stat_64caml_unix_fstatstat_unix.ccaml_unix_symlinkcaml__dummy_to_dirsymlink_unix.ccaml__roots_to_dircaml_unix_has_symlink__ru_nivcsw_wordru_nvcswru_minfltRUSAGE_SELFru_msgrcvru_nsignals__ru_majflt_wordru_stime__ru_idrss_wordru_majfltru_msgsndru_isrssru_utime__rusage_who__ru_maxrss_word__ru_minflt_wordru_nivcswgetrusage__ru_nswap_word__ru_msgsnd_word__ru_oublock_word__ru_isrss_wordru_inblock__ru_ixrss_wordru_idrssRUSAGE_CHILDREN__ru_msgrcv_wordcaml_unix_times__ru_nsignals_word__ru_inblock_wordcaml__temp_dcaml__temp_iru_maxrssru_ixrssru_oublock__ru_nvcsw_wordru_nswapcaml_unix_truncate_64caml_unix_truncatetruncate_unix.cerror_table__atomic_store_tmpcaml_unix_set_cloexeccaml_named_valuecaml_unix_clear_cloexecunixsupport_unix.ccaml_raisecmdarg__atomic_store_ptrerrcodeerrconstrcaml_unix_error_exnutimes_unix.ccaml_unix_utimeswrite_unix.cvsinglewrittencaml_unix_single_writecaml_unix_writecaml_unix_write_bigarraycaml_unix_alarmalarm.ccaml_unix_chownchroot.ccaml_unix_chrootclosedir.ccaml__dummy_vd__dirstreamcaml_unix_closedircaml__roots_vddup2.cdup3caml_unix_dup2fchmod.ccaml_unix_fchmodcaml_unix_fchownfchown.ccaml_unix_set_close_on_execcaml_unix_clear_nonblockcaml_unix_set_nonblockcaml_unix_clear_close_on_execfcntl.ccaml_debugger_fork_modecaml_runtime_events_post_forkcaml_debugger_in_usecaml_ev_lifecyclefork.ccaml_event_countEV_RING_STOPEV_RING_PAUSEEV_DOMAIN_TERMINATEEV_DOMAIN_SPAWNchild_pidEV_RING_STARTcaml_atfork_childcaml_domain_is_multicoreEV_RING_RESUMEcaml_unix_forkcaml_atfork_parentatomic_uint_fast64_tEV_FORK_PARENTEV_FORK_CHILDcaml_debugger_cleanup_forkftruncate.ccaml_unix_ftruncatecaml_unix_ftruncate_64getegid.ccaml_unix_getegidcaml_unix_geteuidgeteuid.ccaml_unix_getgidgetgid.cgr_namealloc_group_entrygroupcaml_unix_getgrnamgr_memgr_passwdcaml_unix_getgrgidgetgr.cgr_gidpassgidset__getgroups_aliascaml_stat_resizegetgroups.ccaml_alloc_tuplecaml_unix_getgroupsngroups_maxcaml_unix_getlogingetlogin.ccaml_unix_getppidgetppid.cpw_gidpw_shellalloc_passwd_entrycaml_unix_getpwuidcaml_unix_getpwnampw_passwdpw_uidpw_dirpw_gecospw_namegetpw.ccaml_unix_getuidgetuid.cinitgroups.cusercaml_unix_initgroupsit_interval__itimer_whichITIMER_VIRTUALcaml_unix_getitimeritimersitimerval__builtin_ceilcaml_unix_set_timevalitimer.cnewvalITIMER_PROFcaml_unix_setitimercaml_unix_convert_itimerITIMER_REALit_valuecaml_convert_signal_numberkill.ccaml_process_pending_actionscaml_unix_killsignalcaml_unix_mkfifovmodemkfifo.cnice.cincrcaml_unix_niceopendir.ccaml_unix_opendird_reclend_namecaml_unix_readdird_offreaddir.creaddir64direntd_inod_typedirectory_entrycaml_raise_end_of_file__ino64_trewinddir.ccaml_unix_rewinddirsetgid.ccaml_unix_setgidcaml_unix_setgroupssetgroups.csetsid.ccaml_unix_setsidcaml_unix_setuidsetuid.csigemptysetsigscaml_unix_sigpendingcaml_unix_sigprocmaskencode_sigsetdecode_sigsetsignals.csigaddsetcaml_unix_sigsuspendpthread_sigmasksignovsetcaml_alloc_2caml_rev_convert_signal_numberoldsetnewconsvactionsigismembercaml_unix_sigwaitsigprocmask_cmdposix_spawn_file_actions_initoptenv__actionsusepath__allocatedcaml_unix_spawnexecutableposix_spawn_file_actions_adddup2__used__spawn_actionposix_spawn_file_actions_destroyspawn.credirectposix_spawnposix_spawn_file_actions_addcloseposix_spawnpdontclose__padposix_spawn_file_actions_tcfsetospeedc_linecaml_unix_tcflushc_ispeedtermioscaml_unix_tcflowbaudtermios.cc_oflagqueuecfgetospeedqueue_flag_tableCharspeedtablesrc_pc_lflagcaml_unix_tcgetattrspeed_twhentcflag_tcc_tOutputc_iflagc_ospeeddst_pSpeedInputc_ccdelaydecode_terminal_statusc_cflagwhen_flag_tablecfsetispeedEnumterminal_io_descrcaml_unix_tcdraincaml_unix_tcsetattrcfgetispeedcaml_unix_tcsendbreakencode_terminal_statusaction_flag_tablecaml_unix_umaskumask.ccaml_unix_waitcaml__dummy_stcaml__roots_stcaml_unix_waitpidalloc_process_statuspid_reqwait.cwait_flag_table@iuiU@iuiTi,jv1jGjvi.j\1jGj\iiPi+jS1jGjSiiPi0j]1jGj]iiPii] j1j1BjGj1PjmjUmjjSjjUjjSj!kU8kkvkkvMkk\kk\ukykPykkSkkSkkPkk]kk]kk1kk1klUklT2ll|ll|Hll]ll]yl}lP}llVllVllPllSllSbllSllT1&ll1ll1llQl&mQ&m6mQll0lmPm%mP&m6m0n nU n6nV6n:nU:n;nUnn0n-nS@mgmUgmmVmmSmmUmmUmmUmmV@mgmTgmm^mmTmmTmmTmm^mmPmm^mmPmmPPmm]mm]Pmgm0gmsmPsmm\mmPmm0mm\mm0mm0@mLmU@mLmux@nUnUUnnS@nNnTNnknVknnTvn}nP}nn\knonPonnVnnUn#oSnnTnn\n#oTnnQnnVn#oQnnPn#o\nnPn#oVnnPn#o]ooUopSooToo\opTooQooVopQooPop\ooPopVooPop]0oEoUEooS0o>oT>o[oV[ooT[o_oP_ooVfomoPmoo\ p+pU+pUpU6p:pP:pFpSGpUpS$p+pu1&+pUpU1&`ppU`ppTpAq|DqZq|pCq]DqZq]ppPp?qVDqZqV qqPq>qSDqZqSp qS qZqT1&qDq1UqZq1`qgqUgqlqUpqqUpqqTpqqQqrsrts%ttsttstv{#vvsvv{#qrVrtV%ttVttVtv{vvVvv{Ert0%tw0rt0%tw0rs]%tt]vv]vvP st\%tt\tt\vvPssPst^tt^rr1st]tu]uvSvvSst]tu]uevSvvSuvvvvvuev]uv0vv0uuYuu^uu ~ uuTuu\Yvevtt| s/s0 s/s0 s/s| w3wU3wwUFwKw FwKwS@zczUczwzSwzzUwz{zP{zzSzzSzzSzzPzzVzzVzzVPyuyUuyySyzUz$zS$z3zUyyS)z.zSqyy2y z\z.z:.z3z\qyy4y zVz.z@.z3zVyyPy zS.z3zSwwUwxSxxUx"ySwxvxyvy"yvwx\xy\y"y\=xy0y"y0wx{xUxxPy!yPxxPy!yP@yHyUHyLyTLyMyU0y8yU8yY0YQQ6p0ۘ0kp0Xxx(,X(,xx~Q~;F~FOQOP~w;Pw_p{_wp{wәPPUPTPQss˜s^^˜^0˜0P\\˜\!PPpP59P9]˜]LVLQ1&V˜Q1&^ v $ &1$#Ɯ˜ v $ &1$#:L\:L]МUPUМTPT=PKOPUTQR͞ssٞ__400=^Q1&^=]R1&]=\\=SVSU1&U1&^xv1$#xPPv1$#BS]BK|~"KOTOS|~"BSVPUU\U\U\x\PTPQV\Q\sVsxQPRS\R\eSexRY~ex~W]WY~ex]ڝ\0ex0ڝs@<$-(\R1&@<$-(exR1&@<$-(RSexS+Hs1$#H\PswPwxs1$#ߝs@<$-( $ &ߝ_ߝ|1&+S+_v1&u"& Q1&u"&*UUsˠs]ˠ]80ˠ0bVˠVJNPN\ˠ\PƠʠPOb Ob^Ob\РU ss\\K00rvPv]PP]w]PP]Pb0P[~UTQRʥ{vʥvB_ʥ_ФaSyP\{ {p"PSʥS^PPxPPĤФaѤؤapUSSpT\T\~~֢__SV kSkuVV # s $ &#uVSkPu~~ԡUԡ]١TQHVHSQS_V_fQ١P]Sc]SHSSYS s $ & s $ &UH s $ &ЪUUЪܪTܪTUVUVTE]ETQ9^9QR%S%+R+RXXlSS(OPO\\+6R6lSlR1&@<$R1&@<$,(6PS69~1&}"9B Q1&}"BOTOP Q1&T"6PWTUT4]4UŨ]ŨبUTTTQTPVPQӨVӨبQTRT{S{RŨSŨبRTXT_ߧUߧXŨ_ŨبXa|Ũب|n^Ũب^0Ũب0ۧ0Ũب04]Ũب]P{Ũب{ s@<$-( R1&@<$-(ŨبR1&@<$-(PӨרPPӨרP{0P04{4_4{ s@<$-( $ & 4R1&@<$-( $ & { 4S4}1&M^]M^SMPv1&u"PY Q1&u"Y]UХU\U\UХTХQVQ V QХR:S:RSRХXj^jX^X!-]]b00\\jnPn^^js@<$-(R1&@<$-(R1&@<$-(Ħ|1$#P P|1$#o^os@<$-( $ &R1&@<$-( $ &o{So|1&Ħ\ĦSv1&u" Q1&u"æUکUک\UŪ\ҩTҩ^TŪ^Q:V:ŪQR)S),R,ŪRXŪXYŪ{{SŪS P ]Ū],7R7{S{ŪR1&@<$R1&@<$,(7WS7L{LWV\QRX{U)UT)T0ZUZիU>^a}VPV«ЫVT^a_eaUHUTSHTQHQR9\9:R:H\)6P:GP7V:HVPUUPTSTPVQVQPR\R\PP~VVаUUаְTְXTаQQаRYRܰTU1&Q$Q1& $ &3$t 3$`-!""'Q1& $ &3$U1& 3$`-!""UǰUTưXưǰTQǰQưPưǰU1&°Q°ư$Q1& $ &3$p 3$`-!""ưǰ'Q1& $ &3$U1& 3$`-!""`UVUpUpuVuUV`TTpTpuTuxTxT`lQl\Q\`RQRpQpuRuzQzRR`XSXpSpuXuSX`YY#Y#5Y5pYpuYuYYX545p8yaPUPw̮~̮YwPTPŮ\Ů̮T̮Y\PQPǮ]Ǯ̮Q̮Y]PRPˮ_ˮ̮R̮Y_PXPîVî̮X̮YVj®s̮Ysɮ^̮Y^̮PP&+P?DPTXP̮PTXPU̹S̹U̹V̹s1&Uոmvtvo\t\PlStSJtPP*]*SpUŷ]vdzvڷ_\dz\P\SdzS:dPuyP]SٶUٶdUڶV`Unvuvʵp\u\PmSuSKuPP ] SNUev%Qvz \%Q\PS%QS%P6:P]SBUB]U ] UBTBSTSSvv\\~ Psijssijsbijbs0))eAijs0))eAaijaųʳaIssIss5Ibb5Is0))eAs0))eA=Iaa aWsʳԳsWsʳԳswbʳԳbws0))eAʳԳs0))eAaʳԳapUU ZU ZT ZQg:sMcss?]Mc]B0Mc0P=\Mc\P;VMcVPA^Mc^B1^c1UUػܻPܻSPSݻ~0)).Av0)"8~0)).A~0)"=w~0)).Av0)"w~0)).A~0)"UTss\\GKPKVVZ^P^]]5Z]m11UT||]]IMPMVV[_P_SS2[S[T1&m11@YUYxSx|U|S@QTQyVy|T|V@SQS{\{|Q|\ZbP U (S(,U,7ST)V),T,7VQ+\+,Q,7\ PUSUSTVTVUSTV0bUbq\0bTbq]0bQbݿVݿ1Q1`V`eQeqVxpQpؿq1<q0PпؿPؿ1S1<P<CSCQPQeSepPpqSEQ P7!EOP U U'UǾUǾ׾S׾UϾPSUTQvOv\O\f]49]swPwS9OSP]9O]>faaKfcc9w19>1aaawaU\U\TQ']'Q]QR S RSRvvv^^^ 00 '}1&'7]7Q1&}1&Q1& $R$R1&RR1&$r@<$-($mR1&@<$-(R1&@<$-( [0[mS0S*BS*7{7B])U)T)Q)R)X6B}Ut}glPl<w<G~UtwG0Ut0D^Ut^F_Ut_0SU\0atSPP@\Ut\>V>GU1&UtVPU\U\UPTPQ_Q_QPR^R^Rpr {#r {#Pr{{00__^ ^^0rS0S~@<$-(m~@<$-(~@<$-(]Sr]]2=]25t"5<T2=VUU&U&T&VTVT&Q&\Q\3ss?^^s00P]]PVV11.U;ssG\\{00PVVP]]11,U9ssEVVm00u\\11UU'U'aUTaTQQ'Q'aQpUUpTVTVPSSU UTVT VQ\Q \PS SUUUU`rUrUwP"U"YU'/P %U%U3oSpSUTUUFUTFT"&P&6S8FS7V8FVUUTVTVPSSPXUXeUpxUxUUUP`U`UrPPPU8S8>U>NS#P(=P>MPUVUVss\\N00PPPPUcU0VPEVHcVPQG\GHP00PVSpxUxUyPPUUUUPP PP]U]SUSxPPPU1S15U5BS2v=Bv4\=B\50=B05P=AP5P=APU%U0@U@cVcdUdV0@T@HSHdTdxSxTUvUpUUpT\TUlSlmU#Js0)).As0)"Jks0)).As0)"USUSa)aUUTTPUTss ]]N00`dPd\\quPuVVNqVqT1&T1&11UUPP NU[s #sg\ #\0 #0P] #]P"PPV #VP"P0=U=]U]kUkuU4IS]pSIMPMXSX\umpuSUUUUUUUUSfU PW]Xf]U\Xf\>BPBRSXfS 0uxpxUxUyPPUUUvU,0P0`SavSpUUPSSUjUTVejV)0)W1ej1!P!'s')SUUPTPWQWTM\U1& $ &2$P"\mqPqSS SUSVUVi||]]1SSP~USTVTPU\~\~\~TVTVTQSQSQR~X^ S ~^~P~~P~\~\~\~^^^T\PP_07P7_PP_0 ] $}$1P8]P]X\}\iPi}P} 4U4YU #T#YTUUTTUUUUTT07U7}U0eTeWwWb~b}w0iQi]}Qs] }x ]bj]s_bj_s ssSssXbosows wXSsSs$V$7XSjV TS\TfjTPYScYfjP0PSd0dfPfj00pupPfj0TT$7TR s xx$*R*0r 07xxoTosxhsU{Rr s xx~psPU'UBGPGI\I^P^"&P&'^EV~V"'VEGPG\|x\\"'\EI IdsdkskSssSss s DXDLSLTsT\S\fsf_XS_"'Sd|Q q"ssxQ!P!LYY LTT Rs #sp#Lxxxx #0#=PPfQQf0P0 P0qtqQt`gUgxUPwUwUP\T\_S_TPSSz~P~VVUDU P 0S1DSUwSwUT=VVVVTz|||]]IPPZPP@iGjrjjjjPjjjkkllm0m6ml6mPmmmmmmmm@mmn;n@nnn#o0ooop pUp`pZq`qlqsss/ss tuvs tu"v)vYv^vevvvuu(u+uuupqw!w&w-w3wFwKw wwwzzzzw"y0y=y@yMyPy3z@zz{{ {{ {%{{M{P{||}}~ ~B~P~z ophp@@ T|# -0|*0ɋЋՌ ɎΎtЏ U`00OPmp ip;@lpkpɗ;Pp{ЗʚКJP˜МPĝ#&+BGKSPx).ObwzˠP\_bР¡ġơˡѡԡա١١HY^ߡ>Y^uĤfpʥĦ4PVY^9>BP:?DWХبŪЪ)T«ЫTmq0իHPįׯY`ǰаCGaenvг I NRWгճ', w| AK\c¶ݶ-:KR*=J[b¹Ź̹Q`dpz cpݻ8=Vgwɿпӿֿ'0q7@  %*9O'/5=)0*/2BPtap Y` FPepNP 8cpBP%0mpv #0u .fp+0 jpv*8EP =`sz|hjsz(XjszXj (@h@X'0} Y`xDP0*>ABF Z Z Ph `h x8,!,!,!-!x/!0!6!@7!   `h h! h7@7!F,!m 0iy,!$-7 wH 0y Y @y kyP | P~*  h 7!@ )2:G [gp~ 1ESan{P <@<  p</? N^ u`-!( -!(,!( P02> G WfvP7!(19 2KWblt  s ] )2;E FS aP qy   Up6!"-!+x>@7!J0!` q k E     @  I,  Х@;  S p  ,      *  }@  Y u       p   p  .  YM  h^  P^q  @i     {M   `p  }  )  'F [  @mq  К        $ @7!+  ;: J W p       M d-C\ lVt p}  j" @G:N pe P(t  5`  o' 9 `q H^v @, o pY . wg? n;Z 0o]k | H7! Py `.-A#Tk 7 p(  , (.BX P{g З  ` а8 @D " 0M6Phx  0A { H/H^k ЏB  0V  V(:N ]p p! P Z *A p-W p5n 0 p- p P{';Q_ Cq  `I  P' pq=O a ^t @n] ~"   _ I4HX7!M Pbx H }(  М 7. GD]y   )+ p5;R@7!^p D  - .AUi~ A @ f 9 `A(?Tk Р~ Ћ ^ Ъ#:N_t  n  0L2  C \  k  _  9  )  F   `  ! Pj#! 9!Q! c! s! @z! !! P9!! !!" )"B"W"l" "" " " 0" M" 0E#P# 6# PF#V# k### pH# ##$1$ 0N$ a$y$ $$$$$ )$ p$  % F "%">%P% ZV% ph%%%  %% B%% P^& 9&,&crtstuff.cderegister_tm_clones__do_global_dtors_auxcompleted.7698__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entryaccess.caccess_permission_tableaddrofstr.cchdir.ccst2constr.ccstringv.cexecv.cexecve.cexecvp.cfsync.cmkdir.cexit.cgetaddrinfo.cgetcwd.cgethost.calloc_host_entryalloc_one_addr_4alloc_one_addr_16gethostname.cgetnameinfo.cgetnameinfo_flag_tablegetproto.calloc_proto_entrygetserv.calloc_service_entrygmtime.calloc_tmmmap_ba.ccaml_ba_mapped_finalizecaml_ba_mapped_opsputenv.crename.crmdir.csocketaddr.calloc_unix_sockaddrstrofaddr.cunlink.caccept_unix.cbind_unix.cchannels_unix.ccaml_unix_check_stream_semanticsclose_unix.cconnect_unix.cdup_unix.cenvir_unix.cerrmsg_unix.cgetpeername_unix.cgetpid_unix.cgetsockname_unix.cgettimeofday_unix.cisatty_unix.clisten_unix.clockf_unix.clseek_unix.cseek_command_tablemmap_unix.copen_unix.copen_flag_tableopen_cloexec_tablepipe_unix.cread_unix.creadlink_unix.crealpath_unix.cselect_unix.cfdlist_to_fdsetfdset_to_fdlistsendrecv_unix.cmsg_flag_tableshutdown_unix.cshutdown_command_tablesleep_unix.csocket_unix.csocketpair_unix.csockopt_unix.csockopt_tablegetsockopt_fun_namesetsockopt_fun_namesockopt_boolsockopt_intsockopt_lingersockopt_timevalsockopt_unix_errorstat_unix.cstat_auxfile_kind_tablesymlink_unix.ctruncate_unix.cunixsupport_unix.cerror_tablecaml_unix_error_exnutimes_unix.cwrite_unix.calarm.cchroot.cclosedir.cdup2.cfchmod.cfchown.cfcntl.cfork.cftruncate.cgetegid.cgeteuid.cgetgid.cgetgr.calloc_group_entrygetgroups.cgetlogin.cgetppid.cgetpw.calloc_passwd_entrygetuid.cinitgroups.citimer.ccaml_unix_set_timevalcaml_unix_convert_itimeritimerskill.cmkfifo.cnice.copendir.creaddir.crewinddir.csetgid.csetgroups.csetsid.csetuid.csignals.cdecode_sigsetencode_sigsetsigprocmask_cmdspawn.ctermios.cterminal_io_descrspeedtablewhen_flag_tablequeue_flag_tableaction_flag_tableumask.cwait.calloc_process_statuswait_flag_table__FRAME_END____dso_handle_DYNAMIC__GNU_EH_FRAME_HDR__TMC_END___GLOBAL_OFFSET_TABLE_caml_unix_getuidinet_ntop@@GLIBC_2.2.5caml_unix_chmodcaml_unix_getservbyportcaml_named_valuecaml_unix_unlinkcaml_unix_recvfromcaml_unix_timesfree@@GLIBC_2.2.5caml_unix_dupcaml_unix_set_nonblockcaml_unix_recvcaml_unix_sendto_nativepthread_sigmask@@GLIBC_2.2.5caml_unix_tcsendbreakcaml_runtime_events_post_forkcaml_ev_lifecycleposix_spawn_file_actions_init@@GLIBC_2.2.5localtime@@GLIBC_2.2.5__errno_location@@GLIBC_2.2.5unlink@@GLIBC_2.2.5caml_unix_getpeernamecaml_unix_write_bigarray_ITM_deregisterTMCloneTablecaml_atfork_parentcaml_convert_flag_list_exit@@GLIBC_2.2.5chroot@@GLIBC_2.2.5caml_domain_is_multicorecaml_unix_stat_64caml_unix_setitimer__read_chk@@GLIBC_2.4mkdir@@GLIBC_2.2.5caml_unix_gettimeofday_unboxedcaml_unix_socketcaml_unix_getgrgidcaml_unix_accessisatty@@GLIBC_2.2.5caml_alloc_tuplecaml_unix_alloc_inet6_addrcaml_unix_gethostnamesetsockopt@@GLIBC_2.2.5caml_unix_mkdircaml_unix_getsocknamecaml_unix_closedircaml_unix_code_of_unix_errortcdrain@@GLIBC_2.2.5caml_unix_cstringvectcaml_unix_map_file_bytecodecaml_atomreadlink@@GLIBC_2.2.5fcntl@@GLIBC_2.2.5write@@GLIBC_2.2.5getpid@@GLIBC_2.2.5cfgetispeed@@GLIBC_2.2.5caml_pending_signalscaml_stat_free_edatacaml_unix_killdup3@@GLIBC_2.9caml_alloc_2getpeername@@GLIBC_2.2.5caml_stat_resizecaml_alloc_initialized_stringposix_spawn_file_actions_destroy@@GLIBC_2.2.5__xstat64@@GLIBC_2.2.5opendir@@GLIBC_2.2.5getpwuid@@GLIBC_2.2.5caml_unix_nicecaml_unix_waitshutdown@@GLIBC_2.2.5cfsetospeed@@GLIBC_2.2.5caml_unix_cst_to_constrmsync@@GLIBC_2.2.5gethostbyname_r@@GLIBC_2.2.5caml_unix_sigsuspendrmdir@@GLIBC_2.2.5_finicaml_atfork_hookcaml_unix_chdirchdir@@GLIBC_2.2.5__stack_chk_fail@@GLIBC_2.4caml_unix_clear_cloexecgetuid@@GLIBC_2.2.5caml_unix_gettimeofdaycaml_unix_readcaml_unix_renamecaml_unix_closeaccept4@@GLIBC_2.10send@@GLIBC_2.2.5caml_string_lengthexecvpe@@GLIBC_2.11caml_unix_socket_domain_tabletcflush@@GLIBC_2.2.5caml_unix_execvpecaml_unix_sigwaitcaml_unix_exitgetgrgid@@GLIBC_2.2.5__fdelt_chk@@GLIBC_2.15symlink@@GLIBC_2.2.5modf@@GLIBC_2.2.5nanosleep@@GLIBC_2.2.5caml_unix_listencaml_unix_spawncaml_unix_lseek_64gettimeofday@@GLIBC_2.2.5caml_unix_getgidgetservbyname@@GLIBC_2.2.5caml_unix_getcwdcaml_unix_cstringvect_freecaml_unix_execvpcaml_unix_putenvgeteuid@@GLIBC_2.2.5caml_unix_time_unboxedcaml_unix_cloexec_defaultcaml_alloc_smallcaml_unix_gethostbyaddrcaml_unix_setsockopt_auxstrnlen@@GLIBC_2.2.5getcwd@@GLIBC_2.2.5sendto@@GLIBC_2.2.5alarm@@GLIBC_2.2.5rewinddir@@GLIBC_2.2.5setgroups@@GLIBC_2.2.5caml_unix_getsockoptcaml_memprof_sample_blockcaml_unix_setsidcaml_unix_bindcaml_unix_check_pathnextafter@@GLIBC_2.2.5getnameinfo@@GLIBC_2.2.5caml_unix_read_bigarraysetsid@@GLIBC_2.2.5closedir@@GLIBC_2.2.5caml_unix_opencaml_convert_signal_numbercaml_unix_map_filecaml_unix_selectcaml_unix_umaskcaml_process_pending_actionscaml_unix_setsockoptread@@GLIBC_2.2.5caml_unix_unsetenvcaml_raise_not_foundcaml_unix_tcsetattr__tls_get_addr@@GLIBC_2.3getsockopt@@GLIBC_2.2.5caml_alloc_somecaml_debugger_cleanup_forkcaml_unix_getgroupsexecve@@GLIBC_2.2.5utimes@@GLIBC_2.2.5caml_unix_errorcaml_unix_lseekputenv@@GLIBC_2.2.5caml_unix_ftruncate__fxstat64@@GLIBC_2.2.5tcsendbreak@@GLIBC_2.2.5getpwnam@@GLIBC_2.2.5caml_ba_hashcaml_unix_outchannel_of_filedescrcaml_unix_linkcaml_unix_initgroups__memmove_chk@@GLIBC_2.3.4__memcpy_chk@@GLIBC_2.3.4sigemptyset@@GLIBC_2.2.5caml_unix_utimescaml_unix_error_messagecaml_ba_byte_sizemkfifo@@GLIBC_2.2.5__gmon_start__umask@@GLIBC_2.2.5caml_unix_getpidcaml_unix_waitpidcaml_leave_blocking_sectionrealpath@@GLIBC_2.3caml_ba_unmap_filesocketpair@@GLIBC_2.2.5getgrnam@@GLIBC_2.2.5caml_unix_chown__recv_chk@@GLIBC_2.4inet_pton@@GLIBC_2.2.5caml_unix_has_symlinkcaml_unix_mapped_allockill@@GLIBC_2.2.5caml_unix_sleepcaml_unix_getlogingetprotobynumber@@GLIBC_2.2.5caml_copy_int64caml_ml_open_descriptor_outgetgid@@GLIBC_2.2.5caml_unix_lockfcaml_unix_getnameinfoselect@@GLIBC_2.2.5pwrite64@@GLIBC_2.2.5caml_strerrorcaml_unix_symlinkgetgroups@@GLIBC_2.2.5caml_unix_readlinkmmap64@@GLIBC_2.2.5caml_copy_string_arraycaml_unix_clear_nonblockcaml_unix_set_close_on_exec__recvfrom_chk@@GLIBC_2.4caml_unix_getegidcaml_unix_getaddrinfonice@@GLIBC_2.2.5caml_atfork_childcaml_unix_getpwuidcaml_unix_execvcaml_unix_getprotobynumbercaml_unix_fstat_64caml_unix_sigprocmaskcaml_copy_doublecaml_unix_gmtimecaml_invalid_argumentcaml_ml_open_descriptor_incaml_unix_getsockopt_auxlisten@@GLIBC_2.2.5_endcaml_unix_socketpairgetlogin@@GLIBC_2.2.5caml_unix_single_writecaml_unix_getprotobynamegetegid@@GLIBC_2.2.5caml_unix_clear_close_on_execcaml_unix_pipemktime@@GLIBC_2.2.5caml_enter_blocking_sectioncaml_unix_tcgetattrcaml_unix_set_cloexecposix_spawnp@@GLIBC_2.15getprotobyname@@GLIBC_2.2.5sigsuspend@@GLIBC_2.2.5caml_debugger_in_usecaml_ba_deserializecaml_unix_forkcaml_unix_setgroupscaml_unix_tcdraincaml_raisecaml_rev_convert_signal_numbercaml_ba_serializecaml_unix_fsyncsetitimer@@GLIBC_2.2.5__bss_startlinkat@@GLIBC_2.4munmap@@GLIBC_2.2.5getauxval@@GLIBC_2.16caml_unix_getservbynameftruncate64@@GLIBC_2.2.5cfgetospeed@@GLIBC_2.2.5fchmod@@GLIBC_2.2.5caml_unix_rmdircaml_unix_lstat_64bind@@GLIBC_2.2.5caml_unix_rewinddiropen64@@GLIBC_2.2.5caml_stat_strconcatmemmove@@GLIBC_2.2.5readdir64@@GLIBC_2.2.5caml_unix_statfsync@@GLIBC_2.2.5caml_unix_acceptcaml_unix_getitimersetgid@@GLIBC_2.2.5caml_unix_shutdownwaitpid@@GLIBC_2.2.5caml_unix_lstattcgetattr@@GLIBC_2.2.5caml_ba_element_sizetcsetattr@@GLIBC_2.2.5caml_unix_realpathaccess@@GLIBC_2.2.5fchown@@GLIBC_2.2.5caml_unix_timecaml_unix_getgrnamcaml_bad_caml_statecfsetispeed@@GLIBC_2.2.5gethostbyaddr_r@@GLIBC_2.2.5caml_unix_sendtogetrusage@@GLIBC_2.2.5tcflow@@GLIBC_2.2.5caml_copy_stringsysconf@@GLIBC_2.2.5getitimer@@GLIBC_2.2.5posix_spawn@@GLIBC_2.15caml_alloc_arrayrename@@GLIBC_2.2.5sigpending@@GLIBC_2.2.5gmtime@@GLIBC_2.2.5unsetenv@@GLIBC_2.2.5caml_unix_execvecaml_unix_get_sockaddrcaml_unix_isattygetsockname@@GLIBC_2.2.5caml_unix_dup2caml_unix_localtimecaml_unix_tcflowcaml_unix_setgidcaml_unix_ftruncate_64execvp@@GLIBC_2.2.5caml_unix_connectsigwait@@GLIBC_2.2.5caml_alloc_stringcaml_unix_inet_addr_of_stringcaml_unix_truncate_64__lxstat64@@GLIBC_2.2.5caml_unix_opendircaml_unix_fstatcaml_unix_gethostbynamecaml_unix_chrootgethostname@@GLIBC_2.2.5caml_unix_environmentcaml_stat_alloccaml_unix_sendpipe2@@GLIBC_2.9__environ@@GLIBC_2.2.5caml_raise_end_of_filesigismember@@GLIBC_2.2.5getppid@@GLIBC_2.2.5connect@@GLIBC_2.2.5caml_unix_cloexec_plseek64@@GLIBC_2.2.5caml_unix_mkfifo_ITM_registerTMCloneTablecaml_unix_string_of_inet_addrcaml_unix_fchowncaml_unix_readdircaml_unix_socket_type_tablecaml_unix_alloc_sockaddrcaml_unix_writecaml_ba_comparecaml_unix_sigpendingsetuid@@GLIBC_2.2.5posix_spawn_file_actions_addclose@@GLIBC_2.2.5caml_unix_fchmodcaml_unix_alarmposix_spawn_file_actions_adddup2@@GLIBC_2.2.5getservbyport@@GLIBC_2.2.5getaddrinfo@@GLIBC_2.2.5caml_unix_environment_unsafecaml_unix_truncatecaml_debugger_fork_modecaml_uerrorcaml_stat_strdupinitgroups@@GLIBC_2.2.5ceil@@GLIBC_2.2.5caml_string_is_c_safecaml_unix_setuidcaml_unix_mktimecaml_unix_getppidcaml_unix_error_of_code__cxa_finalize@@GLIBC_2.2.5caml_alloc_custom_initcaml_unix_geteuidsigaddset@@GLIBC_2.2.5execv@@GLIBC_2.2.5caml_unix_alloc_inet_addrfork@@GLIBC_2.2.5caml_unix_inchannel_of_filedescrcaml_failwithcaml_unix_getpwnamcaml_unix_tcflushfreeaddrinfo@@GLIBC_2.2.5socket@@GLIBC_2.2.5.symtab.strtab.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment.debug_aranges.debug_info.debug_abbrev.debug_line.debug_str.debug_loc.debug_ranges$.o@8 00X#@**gHo>>UoAAdBBnBFF(xZZsZZ ~PhPh`h`ho  xx88!,!,,!,,!, -!-x/!x/x0!06!6` @7!@70@7)i7 IO@M'h30U*O>I " 5" 8 @&x W