ELF>`h@ @8@$# ,,!,!p --!-!$$PtdxxxQtdRtd,,!,!00GNU1[ o^#i !@P˒BstHTD2 lFDaRHA @ ] K%C(OX$JA@( 8H, xaS)HP0" D "D     "#$&()+-0123459:;<@ABCDFHIJMNRSTVWXY[\]^_aegijmoqtvwa wiiSV|JL383~j#sVqִQmO2{gN`#U$h%ZM/<iB1:P Kj#TFDO&f8N蟫S^8 vy`!v%)(ufzFAP0TԼ'W9NO$hHH90nx\`ԯ{fE*uQ$~Uoc2:Fa2q܎# &! Y"8cU_jg0pOvӴwM|_&Jm$z/a"hn~]}8Bpʴ p>qX&.opFF\|qV xR%yCc,o%h̺*:PV1xsr'I 0A"4|˷TA\R(a9|L?"?~G3F[Ddr'BEGGN/C<5i(ָ˽5뚇9Y~5s YۚBXPu yɑhҟcN lYn*B1C3f*-9T਋Cc'J%s djDyFZ<qIcn fB;j u   N( E F 0   ,(  b`D e a  LX6 U z:x \N n !l l @ 8 !f* ; 0 ou Pi T^Z i b  / :s  e A r   .)E  e "} rGZ UWQ#> F |2 _zY'2:L"fr0i |  `.P   @DU )K f T 6 n  М& }[ @i  `Ah 9    З  MS Zy ` ^  P M Hp 5  n;G 0o]V 9  I   k 0Ek   d Z   P{O p5 p}m  ~  К /  `pX o  77 p   < Z lV Pj _ {f  Х@ pY  @v wgM }T  F _ D    P9   P 0  pH{ ,R P{  GD p( @z @h 0L  а8      p ~"+ o_ ;`  @m @,   `q @7!2 ЏB ` 1  Р pW  p-0 P }(    c Yx P^;  I  Ъ   Ћ pq  p x   .  ).   P(   P  `IX7! 0& @n]   0MD ) ' E  h@7!  @G{ p5t   ( 0A    A2   pe ^ p-T < p  0 F B[  4  H  9K   PyP V 7|  < {M   E  C0  B p j H7!  . , P^&  P 0V __gmon_start___fini_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizecaml_unix_access__tls_get_addrcaml_unix_check_pathcaml_convert_flag_listcaml_stat_strdupcaml_enter_blocking_sectioncaml_leave_blocking_sectioncaml_stat_freecaml_uerror__stack_chk_failcaml_unix_inet_addr_of_stringcaml_string_is_c_safeinet_ptoncaml_unix_alloc_inet_addrcaml_unix_alloc_inet6_addrcaml_failwithcaml_unix_chdircaml_unix_chmodcaml_unix_cst_to_constrcaml_unix_cstringvectcaml_stat_alloccaml_unix_errorcaml_unix_cstringvect_freecaml_unix_execvcaml_unix_execvecaml_unix_execvpcaml_unix_execvpe__errno_locationcaml_unix_fsynccaml_unix_mkdircaml_unix_exitcaml_unix_getaddrinfocaml_string_lengthcaml_bad_caml_statecaml_unix_socket_domain_tablecaml_unix_socket_type_table__memcpy_chkcaml_unix_alloc_sockaddrcaml_copy_stringcaml_alloc_smallfreeaddrinfocaml_unix_getcwdcaml_copy_string_arraycaml_alloc_arraycaml_atomcaml_alloc_initialized_stringcaml_unix_gethostbyaddrgethostbyaddr_rcaml_raise_not_foundcaml_unix_gethostbynamegethostbyname_rcaml_unix_gethostnamecaml_unix_getnameinfocaml_unix_get_sockaddrcaml_unix_getprotobynamecaml_unix_getprotobynumbercaml_unix_getservbynamecaml_unix_getservbyportcaml_unix_gmtimecaml_unix_localtimecaml_unix_mktimecaml_copy_doublecaml_ba_byte_sizecaml_ba_unmap_filecaml_unix_mapped_alloccaml_alloc_customcaml_memprof_sample_blockcaml_ba_comparecaml_ba_hashcaml_ba_serializecaml_ba_deserializecaml_unix_putenvcaml_stat_strconcatcaml_unix_unsetenvcaml_unix_renamecaml_unix_rmdirmemmovestrnlencaml_alloc_stringcaml_unix_string_of_inet_addrinet_ntopcaml_unix_time_unboxedcaml_unix_timecaml_unix_unlinkcaml_unix_acceptcaml_unix_cloexec_paccept4caml_unix_bind__fxstat64caml_unix_inchannel_of_filedescrcaml_ml_open_descriptor_incaml_unix_outchannel_of_filedescrcaml_ml_open_descriptor_outcaml_unix_closecaml_unix_connectcaml_unix_dupfcntlcaml_unix_environment_unsafecaml_unix_environmentgetauxvalcaml_unix_error_messagecaml_unix_code_of_unix_errorcaml_strerrorcaml_unix_getpeernamecaml_unix_getpidcaml_unix_getsocknamecaml_unix_gettimeofday_unboxedcaml_unix_gettimeofdaycaml_unix_isattycaml_unix_linklinkatcaml_unix_listencaml_unix_lockfcaml_unix_lseeklseek64caml_unix_lseek_64caml_copy_int64caml_unix_map_filecaml_invalid_argumentcaml_ba_element_sizesysconfmmap64pwrite64ftruncate64caml_unix_map_file_bytecodemsyncmunmapcaml_unix_openopen64caml_unix_cloexec_defaultcaml_unix_pipepipe2caml_unix_read__read_chkcaml_unix_read_bigarraycaml_unix_readlinkcaml_unix_realpath__fdelt_chkcaml_unix_selectmodfcaml_unix_recv__recv_chkcaml_unix_recvfrom__recvfrom_chkcaml_unix_send__memmove_chkcaml_unix_sendto_nativecaml_unix_sendtocaml_unix_shutdowncaml_unix_sleepnanosleepcaml_unix_socketcaml_unix_socketpaircaml_unix_getsockopt_auxcaml_unix_error_of_codecaml_alloc_somecaml_unix_setsockopt_auxcaml_unix_getsockoptcaml_unix_setsockoptnextaftercaml_unix_stat__xstat64caml_unix_lstat__lxstat64caml_unix_fstatcaml_unix_stat_64caml_unix_lstat_64caml_unix_fstat_64caml_unix_symlinkcaml_unix_has_symlinkcaml_unix_timesgetrusagecaml_unix_truncatecaml_unix_truncate_64caml_raisecaml_named_valuecaml_unix_set_cloexeccaml_unix_clear_cloexeccaml_unix_utimescaml_unix_writecaml_unix_write_bigarraycaml_unix_single_writecaml_unix_alarmcaml_unix_chowncaml_unix_chrootcaml_unix_closedircaml_unix_dup2dup3caml_unix_fchmodcaml_unix_fchowncaml_unix_set_nonblockcaml_unix_clear_nonblockcaml_unix_set_close_on_execcaml_unix_clear_close_on_execcaml_atfork_parentcaml_ev_lifecyclecaml_atfork_childcaml_runtime_events_post_forkcaml_unix_forkcaml_domain_is_multicorecaml_atfork_hookcaml_debugger_in_usecaml_debugger_fork_modecaml_debugger_cleanup_forkcaml_unix_ftruncatecaml_unix_ftruncate_64caml_unix_getegidcaml_unix_geteuidcaml_unix_getgidcaml_unix_getgrnamcaml_unix_getgrgidcaml_unix_getgroupscaml_stat_resizecaml_alloc_tuplecaml_unix_getlogincaml_unix_getppidcaml_unix_getpwnamcaml_unix_getpwuidcaml_unix_getuidcaml_unix_initgroupsceilcaml_unix_setitimercaml_unix_getitimercaml_unix_killcaml_convert_signal_numbercaml_process_pending_actionscaml_unix_mkfifocaml_unix_nicecaml_unix_opendircaml_unix_readdirreaddir64caml_raise_end_of_filecaml_unix_rewinddircaml_unix_setgidcaml_unix_setgroupscaml_unix_setsidcaml_unix_setuidsigemptysetsigaddsetsigismembercaml_rev_convert_signal_numbercaml_alloc_2caml_unix_sigprocmaskpthread_sigmaskcaml_unix_sigpendingcaml_pending_signalscaml_unix_sigsuspendcaml_unix_sigwaitcaml_unix_spawnposix_spawn_file_actions_initposix_spawn_file_actions_adddup2posix_spawn_file_actions_addcloseposix_spawn_file_actions_destroyposix_spawnposix_spawnpcaml_unix_tcgetattrcfgetospeedcfgetispeedcaml_unix_tcsetattrcfsetospeedcfsetispeedcaml_unix_tcsendbreakcaml_unix_tcdraincaml_unix_tcflushcaml_unix_tcflowcaml_unix_umaskcaml_unix_waitcaml_unix_waitpidlibm.so.6libpthread.so.0libc.so.6__environld-linux-x86-64.so.2_edata__bss_start_endGLIBC_2.3GLIBC_2.2.5GLIBC_2.16GLIBC_2.3.4GLIBC_2.15GLIBC_2.11GLIBC_2.10GLIBC_2.9GLIBC_2.4        ii  ui  ui   ii ti &2=Hii Sii ]ui ,!0i,!h,!p,!{,!,!-! -!(-!0-!8-!@-!`-! h-!p-!x-!-!6!6!7!7!x/! /!/!,/!%/!r/!_/!a/!i/!i/!/!/!/!f/!/!7!7!Y 7!(7!0! 0!(0!00!980!@0!H0!P0!X0!`0! h0! p0!x0! 0! 0!0!0!0!0!50!0!0!S0!0!M0!0!&0!0!0!1!1!1!1! 1!(1!01! 81!!@1!"H1!#P1!$X1!%`1!&h1!'p1!(x1!1!)1!*1!+1!-1!.1!Q1!/1!01!11!21!31!41!51!61!71!82!92!:2!;2! 2!<(2!=02!=82!@2!>H2!?P2!@X2!A`2!Bh2!Cp2!Dx2!E2!2!F2!G2!H2!I2!J2!2!K2!L2!N2!O2!P2!Q2!R2!S2!T3!U3!U3!V3!W 3!X(3!Z03![83!\@3!]H3!^P3!`X3!b`3!ch3!p3!dx3!e3!f3!g3!3!h3!j3!k3!l3!m3!n3!o3!p3!q3!r3!s3!t3!u4!v4!\4!w4!x 4!y(4!704!z84!{@4!|H4!}P4!~X4!`4!h4!p4!x4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!5!5!5!5! 5!(5!05!85!@5!H5!P5!X5!`5!h5!p5!x5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!5!6!6!6!6!l 6!(6!A06!86!@6!H6!P6!X6!`6!h6!p6!x6!6! 6!6!6!6!6!6!6!6!6!HH HtH52 %4 @%2 h%* h%" h% h% h% h% h% hp% h`% h P% h @% h 0% h % h % h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h %* h!%" h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6%z h7p%r h8`%j h9P%b h:@%Z h;0%R h< %J h=%B h>%: h?%2 h@%* hA%" hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV%z hWp%r hX`%j hYP%b hZ@%Z h[0%R h\ %J h]%B h^%: h_%2 h`%* ha%" hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv%z hwp%r hx`%j hyP%b hz@%Z h{0%R h| %J h}%B h~%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h%z hp%r h`%j hP%b h@%Z h0%R h %J h%B h%: h%2 h%* h%" h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% fH= UH H9HtH Ht ]f.]@f.H= H5 UH)HHHH?HHtH Ht ]f]@f.=I u/H= UHt H= =H! ]fDUH]ffDAUATUSHHhH|$H4$dH%(HD$X1fH=B ffHH5cHHD$ H(HD$HD$LHHD$HD$(HHD$0Ld$H<$H5!H|$AHgDH AdHAt'HT$XdH3%(LuHh[]A\A]Ht$H=~fUSHH8dH%(HD$(12taHl$ H޿H9~%HmHL$(dH3 %(utHDBIfHP9|tHI9uHcHD DHDf.f.AVAUATUSLoI MHIHE1 fIH;%tjID$HI9uJHLd+HHIH)fH;HDHI9uKL[]A\A]A^ÿIHLUSHHH?Ht1DHcH|HuHH[]DATUHSH5zHZH5zH HHHIHrLZHRH=zHAUATIUSH5pzHHHH5ZzLH5KzHIHHLHIHLLHH=zH=f.ATUHSH5yHjH5yHHHHIHLjHbH=yHAVAUATIUH5ySHHH5zyLH5kyHIHHHLHIfLD0LHH5yHD@SHH$H|%t[H=x1 f.AUATUSHHHhHH|$H4$dH%(HD$X1fH= ffHH5xHHD$ L HD$HD$M$I$HD$HD$(HHD$0Ll$H|$zHRHQHt(HT$XdH3%(M$uHh[]A\A]Ht$H=w fDHHD@AWAVAUATUSHdH%(H$1H|$HHt$@HT$8fH= ffHHHaHD$HHH|$HHDŽ$HDŽ$H$HD$@HD$XH$HD$`H$HD$8HD$hHDŽ$HDŽ$H$H$H$H$HHD$XH$HD$`H$ HD$hH$(umDH+uHH$HRHHT$8t1HHD$`tHũ$fHL$pH$LLAMtLMtLEHD$XLl$pMfH= ffHAL0MDHH ^ HH$f.$$HH ^ HH$fHH L|$xL$H\$(Hl$0LLHD$H H$H$@HD$H$HD$H$HD$ HD$LpL$XHDŽ$PLHD$xHDŽ$HHD$HDŽ$L$@HDŽ$HH$`HD$ H$hDKpHsApAFIpDLPH{ H$H$zHHD1H$-Ht$HD$xIƋ{1ɺH4$I1ɋ{Lt$xIFHcC 1HTHD$xHPH$HD$xHPH$HD$xHP HD$xLHD$hHT$hHD$`HHT$XHD$`HPH[(HD$`HHD$XtSfH= ffHH(HJbfH|$@I8fDH|$HI fDH\$(Hl$0Ll$pL)HD$Xf.SHHHdH%(H$1Ht$HH$dH3%(uH[H=q1ifATUSHHpdH%(HD$h1fH= ffHH(HQHD$ LH$HD$HD$HHH;HD$8HD$HD$Ld$ HD$0HD$@HD$HD$(HD$HHD$HD$P.H{H$H8HD${HHsH=HE41HD$H$HHT$HPStKt6H@HT$HPLHL$hdH3 %(uKHp[]A\DH@fDH@fD1yHD$Lf.@HHATUSHH`'dH%(H$X'1HAH$HD$HL$DHA'PHD$PLD$PXZtHD$d@H|$HtH$X'dH3%(u,H`'[]A\foA H\$0)D$0ef.USHHX'dH%(H$H'1<HHHT$0Ht$LL$LD$'H#u8H0H|$Ht1H$H'dH3 %(uHX'[]@HD$Pf.S@HPHHdH%(HD$H1;HD$?>HT$HdH3%(uHP[AWAVIAUATIUSHdH%(H$1fH=. ffHHHJHD$ LHl$`HT$LHD$HHD$HHD$HD$L$HD$8HD$Ld$ HD$0HD$(HD$@HD$HD$HH53mLL$sAHLHAWt$AMxXZ|LLHD$1HD$HT$HD$HHD$HT$HPLH$dH3 %(HD$u!H[]A\A]A^A_D;VATUHSH`dH%(HD$X1fH= ffH5HHHD$LH$HD$HD$ HHH}HD$(HD$Ld$HD$HD$0H}H$1HD$uH$HHT$HPHcUHTHPLHL$XdH3 %(uH`[]A\;fDSHtHHt [H(HHHt HHf.@ATUHSHpdH%(HD$h1fH== ffHHHHD$ LHD$HD$HD$HHD$H}Ld$ HD$0HD$8HD$HD$(HD$@HD$HD$H}H}HD$H}HD$a1HD$HT$HHT$HPUfHTHPHT$HPLHL$hdH3 %(uHp[]A\vfDUSHHHt*HtHH$HtHH[]|f.fUSHHHHt(HHHfCHtHH[]@+f.S1H HcHTHHcSHTHPHcSHTHPHcS HTHPHcSHTHP HcSHTHP(HcSHTHP0HcSHTHP8{ HHHHP@[DHdH%(HD$1H,HH$ HtH>HL$dH3 %(uHH5fh1ҿHdH%(HD$1H,HH$+HtHHL$dH3 %(uHH5 h1ҿFAUATUSHHdH%(H$1fH= ffHH(H)HD$PLLl$H$HD$HHLHD$hHD$Ld$PHD$`HD$XHD$pHD$0HD$HCHD$HCHD$HCHD$HC HD$ HC(HD$$HC0HD$(HC8HD$,HHtlLfH$H*E1HD$tHT$HH$HPLH$dH3 %(u*HĨ[]A\A]@CH5f1ҿ"f.USH_HHCHtH(t.H[]HHH}HH[];HCHxHp'H{H[]AWAVAUATLcUSILcHdH4%(H$1EJ4 L1HHfHHDHH9uH= 1HxLpI1LoLHGfDHTHT HH9uHpLHHXH$dH3 %(LuBHĘ[]A\A]A^A_H= 1MHxLpILoLHGKf.ATUHSHtRHtFHdHH޿1HH}HILt[]A\H5`dHڿLH=DdH SHWtHt[H5dHڿ;H= dHf.fAUATIUSH5cHHH5cLHLHIzLHAwLHAtH[]A\A]H=xcHBfAUATUSHHhH|$dH%(HD$X1fH=f ffHH5f fAtDH5 Z1҉f.@USHHrHHpuHH[]H5Y1҉f.@SHH$H<%t[H=Y1 f.USHHHHHl$HT$ dH%(H$1HiT$ HH%t"H$dH3 %(uHĘ[]H=Y1y@SHEH1҉H1t HHD[H=X10Hq H8Ht L@11HHuH> H8Hu1HHHdH%(H$1HHH$dH3 %(uH f.SHHH\$HT$ D$ pdH%(H$1Ht-t$ HH$dH3 %(uHĐ[H=W1HGHHHDf.SHHH\$HT$ D$ pdH%(H$1HHt-t$ H"H$dH3 %(uHĐ[H=W1XH(1HdH%(HD$1ffHD$dH3%(H*D$^VH* $XuH(HHNf.@HHtHHHHÐAVAUATUSHpdH%(HD$h1H|$Ht$HT$fH=͛ ffHeHH)HD$ HH|$H5WHD$0HD$(HHD$Hl$ HD$8HD$HD$@HD$HD$H`H|$H5|WOH|$H|$IIHD$Ht}E1t^LLLAL,L$AtcHL$hdH3 %(HuXHp[]A\A]A^DLIEDE@LLAHt$H=V*DHHHt HH=T1@SHAH@dH%(HD$81HfDL$x/HD$HT$ H*HvTHcHHT$HHT$ f1H|$fT$_H|$HT$1RHL$8dH3 %(H@[f.1fD$HT$1H@AfDD$fH|$f|$h@ft$@HT$1fL$tf|$S H=QS1ATUISHHHKHDSHcLHHHH5HtH?H9HD[]A\H=R1H5R1ҿKEDATUHSHLfHHRHcHHLOHHt H[]A\EH=R1AWAVHAUATHUSHHIHHIi H<$AdH%(H$81AI@tH DxMpI IFHmMHL$ 1IcHL)Hx"HII9t&IHHJuH9tH=QMDHL$4$H$HL$%H5 H$Lc$J4HfDH HtLHH9uMcJ| N|%I9IX1HHH1EMID$I4II)1HHFIHL$ LDEH$8dH3%(HH[]A\A]A^A_@<$IOHt$D$}?8qH="Q1c[ofDH9tH)1HIJD IH9ulI4$H$tH l H$Lc$<$LaH=PH=:PuH=O)4H=UP1fDHOHWHwLO(LG H?$@USHHHzHu H[]fDH1HHH)HպHHwHHH[]fDAVAUATUSHpdH%(HD$h1H|$Ht$HT$fH=- ffHHHHD$ LH|$H5rOHl$HD$0HHD$HD$(Lt$ HD$8HD$HHD$@HD$HD$HH|$H5|O藿H|$H5+OA胿toAH|$>IDL1'HcLtWHL$hdH3 %(LHD-uLHp[]A\A]A^fuH t{f.kHt$H=`N%DHdH%(HD$1HE‰t;1Hc$HTHHcT$HTHPHL$dH3 %(uHH=xN1AWAVAUATIUSHHHhdH%(H$X1Ht$fH=& ffHL0MHD$MHHD$ HD$L|$PIHD$Ll$HD$(qHLHNӹHHcL۽HStSH|$HcHHLHeH$XdH3 %(MHDu)Hh[]A\A]A^A_@H=UM1xAWAVAUATUSHxdH%(HD$h1H|$Ht$HT$H $fH= ffHHHHD$ LLt$HD$0HD$(HHD$L,$L|$ Hl$IHD$8HD$IHD$@HD$HHD$HHHD$PHD$L`LK44HHt7HL$hdH3 %(LHD-u)Hx[]A\A]A^A_H=*L1HAVAUATUSH`dH%(H$X1H|$fH=я ffHiHHHD$LH|$H5KHD$ HD$HHD$Lt$PLl$HD$(sH|$)ILL1HLqtAHcLD,PH$XdH3 %(Lu(H`[]A\A]A^fkHt$H=K%DAUATUSHhdH%(HD$X1H|$fH= ffHQHHHD$LH|$H5JHD$ HD$HHD$Ld$HD$(`H|$1HHtAHHI艹HT$XdH3%(LLu%Hh[]A\A]@{Ht$H=,J5DAV1AUATIUHSHItiI]IHAHHv[I]HHwHHch ?)LHI HcEH9}]MmIu[1]A\A]A^D[]A\A]A^f.AWAVAUATIUSHHhdH%(HD$X1fH= ffH謽HHD$HD$ L0HD$HD$H$MIHHD$(HD$L|$HD$0AfDH$HXHH$tVHHHcHU ?)LHIt1轻HT-HHT$HPHD$DHD$Ht$XdH34%(MuHh[]A\A]A^A_DD@AWAVAUATIUSH(HL$H|$(H\$EJcHfHL$ HLD$HDDD$荲D$ HfDHL$ HLD$HDDLT$D$@LT$A HU>JcHHL$ HLD$HDDD$tXffH*D$(^;H*L$ X1Ht$xdH34%(LHĈ[]A\A]A^A_@H<$1腸DHcD$ HD@T$ D|$ 藸HHD$JtDHcD$$H|1[H4$1ҿ\藮ATUASHLH0dH%(HD$(1L$ HL$AHH $H,D$YT:HD$AH $T$ H,HD$HDHQH|$(dH3<%(ucH0[]A\f.IAHL$DL$L1ɃL$uIAHL$HD$AHL$q{H1ҿ,1HҶfHH | HHHcIH5q| H H2HT$XdH3%(L(Lu&Hh[]A\A]DHt$H=B̈́f.SHHt$HZHHtH{[H51ҿ @f.HH?HtHH5[1ҿ fHHt HH=51臍AUATUSHHLgI J,HkMIt!H|fDHHHHPH9uLLWL蝂tH[]A\A]H=1f.Hgt HHHDH=1ȌHHdt HH=]1藌USHHHHzfAWAVHAUATIUSHhL|$H4$H|$dH%(HD$X1LvL%f11H[Mt$;@H&H IEHcHHD4!HIHtMHsHHI}LLCHKHCDH+D IHLuL$$H |$LIMcB4迀5HT$XdH3%(Hh[]A\A]A^A_fDIELH{LC(HK H+C9H#A HcIHfDHH@IEHkHA2fDHHtNA A9HcutVuA4L}xtWHCH@LD!ɉfH5. 1ҿ]{DA4L1xH= 1HHHQ{t HH= 1贁@HHvt HH= 1臁HH HHcH4dxt HH= 1GHH HHcH4$t HH=I 1HHzHHDAVAUATUSHcH`dH%(HD$X1fH=I ffHyHD$HD$ L HD$HD$M$I$HD$HD$(Ll$AA@wDHD$|HHTHD$H1wHTHHT$HPM$HL$XdH3 %(uLH`[]A\A]A^Ð1wHD$H(DawHD$k-vHHf.SHdH%(HD$1V{H|$Uyt!t$eHT$dH3%(uH[H= 1!uf.fUSHH5HHdH%(HD$1(szHt$H߉B|xt"t$HL$dH3 %(uH[]H= 1~!uHHaccessinet_addr_of_stringchdirexecvexecveexecvpexecvpefsyncmkdirgetcwdgmtimelocaltimemktimeputenv=unsetenvrenamermdirstring_of_inet_addrunlinkacceptbindin_channel_of_descrout_channel_of_descrcloseconnectdupgetpeernamegetsockname.Alistenlockf0@XhlseekUnix.map_file: bad number of dimensionsUnix.map_file: negative dimensionUnix.map_file: file position exceeds file sizeUnix.map_file: file size doesn't match array dimensionsmap_fileopen@pipereadread_bigarrayreadlinkrealpathselectrecvrecvfromsendsendtoshutdownsleepeAsocket socketpairxx0x\LHt   )setsockoptsetsockopt_intsetsockopt_optintsetsockopt_floatsetsockopt_errorgetsockoptgetsockopt_intgetsockopt_optintgetsockopt_floatgetsockopt_errorlstatfstat@ `?symlinkUnix.Unix_errorException Unix.Unix_error not initialized, please link unix.cma  #!$% &' " srXYZ[\]^_`abcdefghijklmnopq(Kutimeswrite_bigarraysingle_writechrootclosedirdup2fchmodfchownset_nonblockclear_nonblockset_close_on_execUnix.fork may not be called after any domain has been spawnedforkftruncategetgrnamgetgrgidgetgroupsgetlogingetpwnamgetpwuidinitgroupssetitimergetitimerkillmkfifoniceopendirreaddirrewinddirsetgidsetgroupssetsidsetuidsigprocmasksigpendingsigsuspendsigwaitcreate_processtcgetattrtcsetattrtcsendbreaktcdraintcflushtcflow2Kn,X   `  %K @B  `  %& -g5 = @0 0@@     @  waitpid;XdqrsXxthuhvv w`w(xxyy y@zz H Ȃ\ ؂p ȃ ؄ xh x ؇  X< h 8 @ 8 Ȏ  ` `8Xxh@(pXx@`ؚtx <X8pȞx0X`XxؤX@ئ`8XHH8$Xxh,HtXxh(صXX(@84x0(P888,X(xXxPhX8xPhHHx8Xx$<8`8 x8 d 8 ( H 0!8\!!!!!"L"p"H"X"#@#`#8#h##($X $H$$H$$x%@%x%%,&8H&hd&&&&h& 'zRx $x^ FJ w?;*3$"Dk<\lBBA A(G (A ABBA ,xmAAGPN AAG <mBBA A(G (A ABBA < nBBA A(J (A ABBA LXoV<doBBB A(A0 (A BBBA $ p;AAG hDA8p]BAD $xpBBD A(Q0p]BAD ,4 qBBB D(H0dq5Ae A <qBBA A(J (A ABBA `r DLXrBBB B(A0A8G= 8A0A(B BBBH $,wgAL E AA 4TxBAA G;  AABF hy dy @`yBAA JOSOFOTOAO}  AABC ( zAAJN AAE $$zMAI`| AA \LzBBE B(D0A8G**H*a*A*m 8A0A(B BBBF 0|BAD D  AABI |(AZ H |"DT E 4|*BAD D   AABD (T}DAAJ i DAE (~EAAM g DAE 8~A~_D B A ~_D B A @4BBA A(JM (A ABBE <DhAAH T AAH S DAH YAAL5BBH B(D0A8M 8A0A(B BBBA ,BAD U FBA DA_ A <$0BBD A(N0\ (F ABBA <dBBA A(G (A ABBA (0AAG AAG   `LBBD A(J0c (A ABBD N (A ABBD E (A ABBA D\BBE A(D0G 0A(A BBBH $PAG`Q AF DODI<BBA A(G (A ABBA D< h@BBB A(D0J 0A(A BBBF , `AAPX AAA AP AF ( lBAAG _ DAE , BAAG _ DAE 4 5Ae A ,T ЉAAPd AAA  0@Ap A  P \9Dd H D xVGI A $ }AJ] AA $ DK$< }AJ] AA d pYD0O A  DI DRD BBB A(A0D& 0A(A BBBF  ,DY A $ AMP AK ,D p{BAD O ABA ,t YBAD | ABE L BBE B(D0A8S 8A0A(B BBBE  0 ZAAO N AAG eGAD< ؑ{BBB A(A0D" 0A(A BBBJ  D h A L p(BBB B(D0A8M 8A0A(B BBBE L P(BBB B(A0A8D 8A0A(B BBBH DD0BBB A(A0G! 0A(A BBBC <BBA A(D (A ABBE HBDG D(D0t (C BBBF A(F BBBL<BBB B(D0A8G  8A0A(B BBBF Ph BBB B(D0A8G 8A0A(B BBBA Lؙ@BBE B(D0A8M 8A0A(B BBBD ` ȚBBE B(D0A8MWWAt 8A0A(B BBBC Dp4BBE A(H0S 0A(A BBBA L̜BBE B(H0A8S 8A0A(B BBBA 9N\ A ,<AAH@ AAA ,l8hEAK @ FBA 4xBAD J0  AABA LIBBE B(D0A8M 8A0A(B BBBE 0$.BAD LP  AABK X7l(8<PBBD A(J (A ABBB @ABBB A(A0J 0A(A BBBA @ABBB A(A0J 0A(A BBBA (L(AAM| AAA @x BBB A(A0J 0A(A BBBA @ BBB A(A0J 0A(A BBBA (TAAJa AAA D,CBBB A(A0D  0A(A BBBG t-D_ E ,ЪAAQ DAA 8BBA A(J (A ABBA 8tBBA A(G (A ABBA <8FAf I U\h'(pABBD A(JAAJ (,AAJ M AAA (GBAC r ABA ((ܮGBAC r ABA <TBBA A(J# (A ABBG LBBE B(D0A8J3 8A0A(B BBBI LBBB B(A0A8GK 8A0A(B BBBJ D4HBBE A(D0J 0A(A BBBJ |DND BBB A(D0G 0A(A BBBF <BBA A(D (A ABBJ 4BAA D  AABD 4TPAAM h FAB yFA,HAAJ f FAA ,ȶMBAD o FBA IAy A IAy A $PKS<XKST` h\DP dAN A (зHAAJ f FAA (FAAJ d FAA DK DK,(DK4D02BAD D  AABE (|8^AAG { DAG (l^AAJ p DAO ,BAC  ABA 0-DQ E $@DK4<HBAA Ge  AABD (t^AAG { DAG (Ի^AAJ p DAO DK,VAAJ ` FAA (@sAAG0b AAA @]A[0\ؼBAD Jpm  AABA DfAJ@F AA ;Dh A < BBA A(D (A ABBG ,MAAJ _ HAD <DBBA A(D (A ABBF pEAg E .DV A )DV A <BBA A(G0_ (F ABBA $(DP F D )DV A $d0FAAM tAA@XBBB A(D0I 0A(A BBBA 0BAH Mu  AABA 0BAA G  AABA 8}AGV AA $\XAGg AA LoBBE B(D0A8T 8A0A(B BBBG H7BBE B(A0A8D 8A0A(B BBBE L MBBE B(D0A8D 8A0A(B BBBG p ,DY A  )DV A  9N\ A  9N\ A  @DN@ HUBBB A(C0G 0A(A BBBB @!ddAD J AA (d!AAQ0V AAA 0ihp{  Z ,!,!o*0 g 0!(FB oAoo>o-!ZZ[[&[6[F[V[f[v[[[[[[[[[\\&\6\F\V\f\v\\\\\\\\\]]&]6]F]V]f]v]]]]]]]]]^^&^6^F^V^f^v^^^^^^^^^__&_6_F_V_f_v_________``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFgVgfgvggggggggghh&h6hFh6!GCC: (Ubuntu 7.5.0-3ubuntu1~18.04) 7.5.0,@i,$Pj,j,_)k,*8lV<`A@mn;,P@n],_n<m0o]o,~~ p5,T`p,`q ,|pq,ܲ wglw0y @y Py@z,>{M,}P{L/|}( ~"LP~*DE\ __p<uhp5<6%@D,5,XD lR 0L,f0<2qЋ,V{,@, LhBЏB,J 5,"`,@<0P9,V,g},p,.}<Yp,W,$,k0@,,:p<D{pYL3SЗКZ,mP{,IzМ<P((,#,3РLp<lХ@Ъ, 9,0,h,P\{I`.7а8A`Ap  <8 Cp-,D<UhF'0A,G@G,}L6PH,@, ,, ,,pH,M\I`IL  <HF,n P,p, Lm)2^P^, 6,Ap-,@KLTP^^,a,j0V\ts]pf,φ;, ,M, ,0E,.,F),,"p(,)|UF p},9o|70M,)9 9,%`Lu.UdP   ; intB 0   F +) )@ )H Qa)Pd; l m / j j   O0 Z-MS .A 4 /A 0A 1A j2A 3A 4A 8 L    =y "; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X Q`B Wh Bp Bt xI c q ]{ m % -N .U /\ 0c 20D 3BG 5sO : Q  Q W U B m;;  ? ( @ Y A WC W W B  |;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tpwy' {2 }= L J s C |~  j  b B(/0N 8idB@ BH |PT XP T `Jhpx+p` Jk  [ W BǴv xˁ l ̆Z|  E J F" G 8 5HR p2 @' '   Y - 8 dI  [ Ef 2q | o &2  j   Z   |#A52U3I/3385 &5 end5  5 ptr5  5 5/( 5/0 7 8| 9 :|;8< &< end<  < ptr<  < R ?|mem@maxAj8C &C endC  C ptrC  C C/( C/0! SMk TMkUMeVM [Z ] ;@   8 ; Z( rMsMi ; "u ) $f2B 7B ;B uB B 4 6B  7B  I ; &  m3|@i!53|! 3|#" 5F"5' 5#$5B$p6$ret7B"g7BJ%j " B|&i 'Us'T &i+'T (i(i&ic'Us'T}(i&j'Us&Bj'U (Gj' )l)##G))*ww") )88S) j+ 7 PP ; int 0   %W '^ )eF +) )@ )H  s Qa)Pd; l m l e e   O0 Z -  .~ 4 /~  0~ 1~ j 2~ 3~  4~   /   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B  h Bp Bt xI ^ l { " % -N .U /\ 0c 20D 3BG 5(O :     U BN";8;  ?8 ( @8 Y A8 C   B   <;?"; ; BB"Bt %B  (M(/ +0= .82X@ 6^H$ 9BP=BXAi`2CthFpIx L& P T[ `r1t0wy{}L J s <~  j  b B(l08idB@ BH <PXP `Jhpx+pJ  [ W B x l BZΨ < H SMd2o @    ; z$  E2  o &25  BK ; "W ) $f2B 7B ;B uB , !        ; ; ;+ ڸ  x+  + <PjR s< UC  D @!jR "U2"Ts"Qv!j] "Uv!jR "U:"Ts"Qv#jh "Uv!njs % "Us!j D "U $j %:%;;P%]]T& q%b'4 pl ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  wjC w! C:!" v"#B$pI$retB%k ! $w>&hkO 'Us'T (rkZ(zke&kp 'Us(k|&k'Us&k5'U (k" )l))*) )88S) j+k C0    intF +e e@ e >H Z  QaePd> l m* 7 7   O Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y > ; S e = S  e i. ,5,B ; >   x9 S      T (L 0 8 @ H P X L`B Rh Sp St lxI 0 E X{ h %w -N .U /\ 0c 2D 3SG 5nO : L  L R U Sh>~>  ?~ ( @~ Y A~ RC R R S  w >?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b S(*0I 8idS@ SH wPO XP O `Jhpx+p[ Jf  [ W Sǡq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  7   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] >@   3 > Z# rHsHd > "p ) $f2S 7S ;S uS S 4 6S  7S  wkg 5wv w! g!" "#$S$p m.$ret!Sw!"S%l ! *w&lls 'Uv'T (vl~(~l&l'Uv'Ts(l&l:'Uv&lY'U (l" )l))*$$) )88S) j+2  H  ; intB 0   F +) )@ )H Qa)Pd; l m / j j   O0 Z-MS .A 4 /A 0A 1A j2A 3A 4A    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   B[P [ v;? "  "t %  ((/ +0= .82@ 6!H$ 9P=XA,`2C7hFpIx L& P T[ `r1twyB{M}XL J s ^~  j d b B(/0p8idB@ BH PvXP v`Jhpx+pJ [ W BǴȘxˣl Zk    '22 =HS k }E2o & 20lV/ nBUtbl/ TB3*BR iBI5C  C`l  ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 eg   ]    X Z -  .y4 /y 0y 1yj 2y 3y 4y 8 L   = y7  Z; J; B ) J= B  ) i . , 5,B;< >  \ x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U Bc;\; ?( @Y A C   B& & AQ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C' hFpIx L& P T[ `r1twyj {u } L J s  ~  j  b B(*0 8idB@ BH P XP  `Jhpx+p J  [ W Bǯȹ x l Z6  E J Fe G 8 5H p2"  @j j    - p {    E 2  o &Q2  e    Z   |#A52U3I/3385 &5 end5  5 ptr5  5 5*( 5*0 7 8 9 :;8<^ &<^ end<^  <^ ptr<^  <^ <*( <*0 > ?mem@maxAj8C &C endC  C ptrC  C C*( C*0d Sk TkUeV [Z ]N ;@> N N { ; Zk rs ;" ) $f2B 7B ;B uB B 4- 6B  7B - (n; v( !i*B<" n#;n$UU %U @m args&U!res '(8!i("{m )m$UF$T~(0\!i""m"*Hm+,Hm- ."m-)m-$U8/N0val1221388S4q3  h33rrZv    ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  qw@n] 5w, wb !k !% "Vn+r #Us#T "en6 #Uv#T "pnA #Us"~nL #U|#Tv"nX #U|"nc #Uv$nn#U #Ts%l%UUr%&{{6%88S%s% j , ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  wn 5w wP !envw " " "kT #n $Us$T  #n $U|$T  #n $Uv$T  #n $Us#n$U}$T|$Qv#o.$U}# oF$U|#o^$Uv%#o$U  $Ts&l&UUr&'*&88S&s& j ?j 4 0 int[IT-kT.k   F +| |@ |H Qa|Pd4 l m K     O) Z -io  .] 4 /]  0] 1] j 2] 3]  4] 8 LT  I   = y  k34 #; B | #= B  | " B i . , 5,B ; >  6 x9 B  k k  k k T k(L k0 k8 k@ kH kP kX n`B th Bp Bt xI ;  z{  % -N .U /\ 0c 2)D 3BG 5O : n  n t U B=T46T4  ? ( @ Y A tC t tBOB 1A4?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C hFpIx L& P T[ `r1twyZ {e }p L J s v ~  j  b B(K0 8idB@ BH P XP  `Jhpx+p J  [ W Bȩ x˴ l ̹Z&   E J FU G 8 5H p2  @Z Z     ` k |   E 2  o &A2     Z   |#A52U3I/3 385 &5 end5  5 ptr5  5 5K( 5K0 7 8 9 : ;8 ?mem@maxA j8C &C endC  C ptrC  C CK( CK0T Sik TikUieVi [Z ]O> 4@. > > k 4 Z[ risi 4 " k $ ) $kf2B 7B ;B uB B 4) 6B  7B ) .o 5. . !env. "0X "1 "k2 #err3B^$o %Us%T .$o*%U|%T .$o*+%Uv%T .$o5C%Us$o@g%U}%T|%Qv&oL$oW%U}$pb%U|$ pb%Uv'pm%U~%T .%Qs.0o] 5 0 "| "k $For%Us%T '$Uo*%Uv%T '$`o5%Us$nox%U|%Tv$voW%U|$~ob%Uv'o%U '%Ts(l(UUr()Q(%(88S(s(  h)88E( j  X ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBH p5 v retB!fd!Bj,p 4p z Us;p !Up U 6 T0"#RR" " j ` }0    intF +e e@ e >H Z  QaePd> l m* 7 7   O Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y > ; S e = S  e i. ,5,B ; >   x9 S      T (L 0 8 @ H P X L`B Rh Sp St lxI 0 E X{ h %w -N .U /\ 0c 2D 3SG 5nO : L  L R U Sh>~>  ?~ ( @~ Y A~ RC R R S  w >?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b S(*0I 8idS@ SH wPO XP O `Jhpx+p[ Jf  [ W Sǡq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  7   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] >@   3 > Z# rHsHd > "p ) $f2S 7S ;S uS S 4 6S  7S  hw`pg 5w w! g!" +"#$S$p ma$ret!S!"S%*q ! *w.&ps 'Uv'T <(p~(p&q'Uv'Ts(q&q:'Uv&UqY'U <(Zq" )l))*rr=) )88S) j+Y  @ ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBx`q P nflqP UU1&^\ `Y 4 0 intB`NY   %z '; )F +e e@ eYCŁH   QaePd4 l m' ZO        O) Z -  .4 / 0 1j 2 3 4  #3N3[  i . , 52,B ;2   x9 B      T (L 0 8 @ H P X '`B -h Bp Bt xI ;  3{ C % -N .U /\ 0c 2)D 3BG 5IO : '  ' - U BoYC4YY4 ?Y( @YY AY -C - -BT ]4?"\ \ cc"ct %c  (n(/ +0= .282y@ 6H$ 9cP=cXA`2ChF=pI=x L=& P= T=[= `2r=1tQw=y{}L 2J 2s ]2~== = =j  b B(0 8idB@ BH ]P XP  `J=h=p2x+2p2 J#  ==[ =2W= B22. x9 l cZ ] i tn2  @  2 2 \ E    E 2) 4 o &2V ? cl 4 E" ) $f2B 7B ;B uBr;  O @ Y 4 [n& g  & Y6 4k  ,Z !6 iwՏ ׏  ؟  ٯ  4 4 4  e  x   $0  0Z  +A  Y0 z@ 4  O 9Z H p0 1 2 V3 5@ 4:l "05F 7B8B9B]:B ;l G<F = >L (  I] R "] #] !<]pq"<]" <]"<]# >#>$s>}#>BS$;?]|%v?]|%e?]|$/?}#?B#@# @$A |%resBL |#sCB{&r # F]'f(rxL )syM*D+,,-|-|- |-~,"--~,77)u .*m**.u/U|/Q~/Rp0B^v,C1u/U|/T~/Q 2u1u/U5/T01u,/T{/Q3/R0.v/Tw/Q4/R0.ov/U2/T0&tn# ])Ps`U*v'*kL*`p1r/UU2r2r2s2s1s7/U}/T|/Q|/R|2s1s)\/U}1s)t/U|2%t42v?2v?1wJ/U}2wV3%]P4a%L 5 '5'5;(]5(]5~(]5/(5(B6sa) 6len* 75 9]8;9;9;B9;)8(99U9): ;M;2;bb,;00< q< p;<; ;88S;>;<=  ; int 0   F +) )@ )H zQa)Pd; l m  ;  ;  Z  e  e   O0 Z -x~ .l4 /l 0l 1lj 2l 3l 4l 8 L    = y*   M ; =; B ) == B  ) i . , 5,B ; >   O x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U BV  ;O  ; ?( @Y AC B  4 D ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C hFpIx L& P T[ `r1twy] {h }s L J s y ~  j  b B(Z0 8idB@ BH P XP  `Jhpx+p J  [ W Bǯ x l ̼Z)   E J F G 8 5H: p2  @] ]   A  c n    E 2@ jmpA B]  C  o &D2   )! ; !R ' (B@ ) H ! b ;SR . buf/b m e   Z   |#A52U3I/3 385k &5k end5k  5k ptr5k  5k 5Z( 5Z0 7 8 9 : ;8< &< end<  < ptr<  < : ?mem@maxA j8C &C endC  C ptrC  C CZ( CZ0 Sxk TxkUxeVx [Z ]  ;@   ; Z rxsx Q ;"] ) $f2B 7B ;B uB B  4  6B  7B !& wg" 6&#9(_$ret)%!w*l&&'Kw(Us(T )Xw(Us)w(U B(T0*w +;,ȝ-ȝ-0.{/!2/ j0;  4 0 int[IT   %u '; )|F +` `@ `TC|H   Qa`Pd4 l m  | |   O) Z -  . 4 /  0 1 j 2 3  4    IE   i . , 5(,B ;(   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ;  { - % -N .U /\ 0c 2)D 3BG 53O :     U BYT-4TC4  ?C ( @C Y AC C   BO  G4?"F F MM"Mt %M  (X(/ +0= .(82c@ 6iH$ 9MP=MXAt`2ChF3pI3x L3& P3 T3[3 `(r31t;w3y{}L (J (s G(~33 3 3j  b B(08idB@ BH GPXP `J3h3p(x+(p( J  33[ 3(W3 B(( x# l MZγ G S ^Xo2z @  ( ( F /  E 2  o &2@ ) MV 4 E "n ) $f2B 7B ;B uB , !        4 4) 4B  ) xB  B P b vd en  fB gB hn 8G@z >7Ghp  dh] !}  errB" #rcB$|z%z &Us&T&Q&R '&X&Y$z%dz &Us%tz &Us%z &Us$zu $z$z] T '4'uPGPyu (aPG#adrRIin4S hpT  :UB A:VV %in6X) hv] !} w !xB#rcxB%vy &Us$y%y@ &Us&Tv&Q|&R&X&Y '$y$y$yu $3z)d.GwG.  0+ 0}!>71G~!1G~!1Gadr1G!)1 S1B D2#res3G!*x` MGW$Bx$Xx$|x%x&U4&T0%y&U0$y($"y+GI,&)G@y 9(a)I-My3&U@&TU,$G0y (a$I-=y3&U4&TU... / q..88S.}}k0/ p..2.3.8.bb,/ .>.XX1;   " ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z -HN  .< 4 /<  0< 1< j 2< 3<  4<      i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;?"  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o &2;@   ") $f2B 7B ;B uB{M  6%>7  {p!  ^  %{ !Us!T@"2{* !Us#M{5  ;?$XB %X%X0&O'2(" z$ 4 0 intB`NY   %z '; )F +e e@ eYCŁH   QaePd4 l m"      O) Z -  . 4 /  0 1 j 2 3  4    "N"J   i . , 5-,B ;-   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ;  "{ 2 % -N .U /\ 0c 2)D 3BG 58O :     U B^Y24YH4  ?H ( @H Y AH C   BT  L4?"K K RR"Rt %R  (](/ +0= .-82h@ 6nH$ 9RP=RXAy`2ChF8pI8x L8& P8 T8[8 `-r81t@w8y{}L -J -s L-~88 8 8j  b B(08idB@ BH LPXP `J8h8p-x+-p- J  88[ 8-W8 B-- x( l RZθ L X c]t2 @  - - K 4   E 2 # o &2E . R[ 4 E "s ) $f2B 7B ;B uBr; O @ Y 4 [n g   Y% 4k  ,I !% iw~ ~  ؎  ٞ  4 4  4 T  x   $  0I  +0  Y z/ 4{ O 9I H   p0 1 2 V3 5/ 4:[ I 4  P$LP{ $L $L.! &!&'LU 'LU;'LU'V!'B(({ VA:) U*"_ +3W!,B`!s,B"| ! '}}k) $ DI' ; int 0   %W '^ )eF +) )@ )H  s Qa)Pd; l m l e e   O0 Z -  .~ 4 /~  0~ 1~ j 2~ 3~  4~   /   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B  h Bp Bt xI ^ l { " % -N .U /\ 0c 20D 3BG 5(O :     U BN";8;  ?8 ( @8 Y A8 C   B   <;?"; ; BB"Bt %B  (M(/ +0= .82X@ 6^H$ 9BP=BXAi`2CthFpIx L& P T[ `r1t0wy{}L J s <~  j  b B(l08idB@ BH <PXP `Jhpx+pJ  [ W B x l BZΨ < H SMd2o @    ; z$  E2  o &25  BK ; "W ) $f2B 7B ;B uBվ ׾      ; ; ; ڔ  x   ODW FGW qHBy4< ~" s4<* G6 c!,~q "UU1&#=~\ $B~} " X+<}(\ >7+< G- !} ) "Us!~ A "Us#~\ $~} %<|k G  k z  &>7<&<&)z SB 'res <$!(} (<Z!$}} $} !} P "U3"T0$} $} )i*}}k) q)bbc*2*3*bb,*>+ &' `) ; int 0   %W '^ )eF +) )@ )H  s Qa)Pd; l m l e e   O0 Z -  .~ 4 /~  0~ 1~ j 2~ 3~  4~   /   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B  h Bp Bt xI ^ l { " % -N .U /\ 0c 20D 3BG 5(O :     U BN";8;  ?8 ( @8 Y A8 C   B   <;?"; ; BB"Bt %B  (M(/ +0= .82X@ 6^H$ 9BP=BXAi`2CthFpIx L& P T[ `r1t0wy{}L J s <~  j  b B(l08idB@ BH <PXP `Jhpx+pJ  [ W B x l BZΨ < H SMd2o @    ; z$  E2  o &25  BK ; "W ) $f2B 7B ;B uBվ ׾      ; ; ; ڔ  x    c 3W B;<E$ >;<!s;<!G=$ ;" 0 !__v?^^"!__x?^""F #Uv"R #Tv$ %^ " 1<D >71<"s1<#G3$ ~#"F #Us"F #Uv"i #Us#Tv$ %^ & <P~*@ G $ # "@ $"<$'>7#<~'#<'s#<')#zS#Br$!res$<$(1 !__v,^$!__x,^%(M  .<'%%~u % %u "  % #U4#T0%u %z ) q)'*}}k) *2*3*bb,*>+ i) , ; int 0   F +) )@ ))H zQa)Pd; l m @ e e   O0 Z -^d  .R 4 /R  0R 1R j 2R 3R  4R      i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B"; ;  ?  ( @  Y A  C   Bla l ;?"  "t %  (!(/ +0= .82,@ 62H$ 9P=XA=`2CHhFpIx L& P T[ `r1twy{}L J s ~  j  b B(@08idB@ BH PXP `Jhpx+pJ [ W BǺxl Z|   '!82C @     N  E2o &2  ; "+ ) $f2B 7B ;B uBtm8  B  B & B  B  B B B .B pB )( 60 ; ; B) = B )y>p t>]% @ %@&A~OA~ANABD& tmBh ~ C|&!resD&"#  V'#hn ; $U}#y S $U}%y # | $U2$T0%݂ # $U"$T u$Q0% &2_m t2D' 4`!tm5m }'#5 ) $Uw%B #j _ $UF$T k$Q0%o h &V(_ t(' *`!tm+m '#Հ $Uw% # $UF$T d$Q0% 'g n tmm "( resP(0 $U9$T0)R)>>4)bb,)>)  h*){)``w+ o/ ; intB 0   F +) )@ )H Qa)Pd; l m / j j   O0 Z-MS .A 4 /A 0A 1A j2A 3A 4A    =y ; ; B ) = B  ) i. ,5,B ;p > {  x9 B      T (L 0 8 @ H P X P`B Vh Bp Bt xI c q \{ l % -N .U /\ 0c 20D 3BG 5rO : P  P V U Bl;;  ? ( @ Y A VC V V B  p ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tdwy& {1 }< L J s B p~  j  b B(/0M 8idB@ BH pPS XP S `Jhpx+p_ Jj  [ W BǴu xˀ l ̅Zp  E J F@ G 8 5Hp p2 @& &   w, 7 XH  Z Ee 2p { o & 2   pj@ J<K L M N QT R S y9T DUT dimVZ  i ;It i qt    @    4  I  2 j 0# ( $4 0 % 8 !B4 pp !I p: d pd d O ! p  s6Z [ 6\ $] "j   Z   |#A52U3I/3385 &5 end5  5 ptr5  5 5/( 5/0 7 8p 9 :p;8<9 &<9 end<9  <9 ptr<9  <9 p ?pmem@maxAj8C &C endC  C ptrC  C C/( C/0? SMk TMkUMeVM [Z ]);@ ) )V; ZFrMsM;"j]^E p  ""j4U#/ 7!$<>pp5%y9>Bn(%>B(%>(&dim>e)'@)'S@*(resAp9*(bB*#C~)?(iHB*)5(iPB+*^+U 7!+Q0+R1,0*H+U|+R3*+U 7!+Q0+R1, ;- hR&vp:+(b +*3*+Us.E,Y.h/Cy0yCy1oldE2**82$$h2,32tt4BB3jg. F 1 4 int 0  F +I I@ IH s  4 4  I 4 !A ' (;@ )H Q 4SA QaIPd4 lc mn    B  B   O) Z - .4 / 0 1j 2 3 4 8 L  ]css Q= y    4 ; ; I = ;  I i . , 5y,B ;y >   x9;     T (L08 @H PX`B h  ;p;t~xI^ e {  % -N .U /\ 0c 2)D3;G5O :   U ;6  4  4? ( @ YA C ; u   4?"#   # # "# t %#   (. (/ +0= .y829 @ 6? H$ 9# P=# XAv `2C hFpIx L& P T[ `yr1twy { } L yJ ys  y~  j  b ;(0 8id;@ ;H P XP  `Jhpyx+ypy J  [ yW ;yyǨ? xJ l # Zΐ )  4 . Ev J F G 8 5H: pE 2|  @  y y A       E 2@? jmpA B  C0 E o &2g P . buf/Qm B   Z   |#A52U3I/3 385k &5k end5k  5k ptr5k  5k 5( 50# 7 8 9 : ;8< &< end<  < ptr<  < <( <0q >: ?mem@maxA j8C &C endC  C ptrC  C C( C0 Sk TkUeV [Z ] 4@    4 Z rs # Q 4"] ) $f2; 7; ;; u; ; 4 6;  7; !3;@D">7;g,#ret=;,$I4%Us$UL%Us$u*v%UF%T %Qs&5%U %Ts!O ">7,'val[-#s!-#p" .#ret#;b.$%Us$˄0%Uv$@`%U3%Ts%Q %Rv$Kx%Uv$V%Uv$a%U|$)*%UF%T |%Qs$1V%U|&@5%U |%TsE( q(== )  h) j)))88S(YY |0 nP4 ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  w` ww. fw.!`C/!``/"retB/#f $Us$T #f $U|$T #Åq $Us#΅q $U|%օ|#$Uv$T|%#&$U|#>$Uv&$U $Ts'l''' ' '88S' jw2 p6 ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  w C 5w0! CA0!" }0"#$B$pI0$retB0%ֆ ! $wE1&O 'Us'T (Z(e&p 'Us(|&†'Us&5'U (" )l))*E) )88S) j+ 4 a )9 4 0 int[IT   %u '; )|F +` `@ `TC|H   Qa`Pd4 l m K    |  |   O) Z -  . 4 /  0 1 j 2 3  4  $I$L   i . , 5(,B ;( >3   x9 B      T (L 0 8 @ H P X #`B )h Bp Bt xI ;  /{ ? % -N .U /\ 0c 2)D 3BG 5EO : #  # ) U BkT?4TU4  ?U ( @U Y AU )C ) )BO N4?"X X __"_t %_  (j(/ +0= .(82u@ 6{H$ 9_P=_XA`2ChF3pI3x L3& P3 T3[3 `(r31tBw3y{}L (J (s N(~33 3 3j  b B(0 8idB@ BH NP XP  `J3h3p(x+(p( J  33[ 3(W3 B((* x5 l _Z N e pj2  @  ( ( X 6   E 2% 0 o &2R ; _h 4 E " ) $f2B 7B ;B uBr;  O @ T 4 [n" g  " T2 4k  ,V !2 iwՋ ׋  ؛  ٫  4 4 4  a  x   $,  0V  +=  Y, u< 4  O 9V H p0 1 2 V3 5< 4:h pNP adrpP}1!q 1!qB(2" sV2"s3#atN~$?t" tBa3%resuN3& " yN3' (U0)\&82 "Y3"Y4'ي (U~(T}~'$ (T~)\*N +__v;+__x;&u %__v;4%__x;4& " N4'4 (U~'G (Ua(T (Q0'Y(Uv'm(U2(T1'w5(Uv)%)* ,MhNQ!5hN4" iV5"iQ5$i~"$iB5#resjN~$j"/jB5&ɇ" mN5'6(U1(T0))--60Lq!6N/6 adr7P6!8q7."59: 8 p8 q 7 n< ; int 0   %W '^ )eF +) )@ )H  s Qa)Pd; l m l e e   O0 Z -  .~ 4 /~  0~ 1~ j 2~ 3~  4~   /   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B  h Bp Bt xI ^ l { " % -N .U /\ 0c 20D 3BG 5(O :     U BN";8;  ?8 ( @8 Y A8 C   B   <;?"; ; BB"Bt %B  (M(/ +0= .82X@ 6^H$ 9BP=BXAi`2CthFpIx L& P T[ `r1t0wy{}L J s <~  j  b B(l08idB@ BH <PXP `Jhpx+pJ [ W Bxl BZΨ < H SMd2o z$  E2o &2 " ) $f2B 7B ;B uB ,p !L ՚ ך  ت  ٺ  ; ; ; p  x   z<0 a<;res< } 4 !M b "Us!h "U2"Ts"Qw"R@#u ! "U:# $ "U "T0 ;?% p&@&2'& j 9 > 4 0   intF +p p@ pp 4  ; ^ p  = ^ p H eQapPd4 l- m8    I  I   O) Z - .4 / 0 1j 2 3 4  "(88`  i . , 5C,B ;C   x9 ^      T (L 0 8 @ H P X ,`B 2h ^p ^t wxI B P 8{ H % -N .U /\ 0c 2)D 3^G 5NO : ,  , 2 U ^tH 4^ 4 ?^( @^Y A^  2 C 2 2 ^  b 4?"a a hh"ht %h  (s(/ +0= .C82~@ 6H$ 9hP=hXA`2ChFNpINx LN& PN TN[N `CrN1tVwNy{}L CJ Cs bC~NN N Nj  b ^(08id^@ ^H bPXP `JNhNpCx+CpCJ NN[ NCWN ^CC"x l hZ b n ys2 J  E2 o & 2#  "5  ) $ f2^ 7^  ;^  u^bЋ  6b`<ً UU   6b<  U0!>>4!K; @ ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4< 8 L    =y ; ; B ) = B  ) i. ,5,B ; >   x9 B      T (L 0 8 @ H P X L`B Rh Bp Bt xI ^ l X{ h % -N .U /\ 0c 20D 3BG 5nO : L  L R U Bh;~;  ?~ ( @~ Y A~ RC R R B  w ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1tkwy" {- }8 L J s > w~  j  b B(*0I 8idB@ BH wPO XP O `Jhpx+p[ Jf  [ W Bǯq x| l ́Zw  E J F G 8 5HM p2 @" "   T ( 3 _D  V Ea 2l w o & 2  e   Z   |#A52U3I/3385~ &5~ end5~  5~ ptr5~  5~ 5*( 5*0 7 8w 9 :w;8< &< end<  < ptr<  < <*( <*0 >M ?wmem@maxAj8C &C endC  C ptrC  C C*( C*0 SHk THkUHeVH [Z ] ;@   3 ; Z# rHsHd ; "p ) $f2B 7B ;B uB B 4 6B  7B  wC 5w<! C<!" 1="#$B$pIg=$retB=% ! $w=&hO 'Us'T (rZ(ze&p 'Us(|&'Us&Ќ5'U (Ռ" )l))*<) )88S) j+= C ; int 0   %W '^ )eF +) )@ )CeH  s Qa)Pd; l m3  e e   O0 Z -  . 4 /  0 1 j 2 3  4    3E   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l { - % -N .U /\ 0c 20D 3BG 53O :     U BY-;C;  ?C ( @C Y AC C   B9  B  G;?"\ \ cc"ct %c  (n(/ +0= .82y@ 6H$ 9cP=cXA`2ChF(pI(x L(& P( T([( `r(1t;w(y{}L J s G~(( ( (j  b B(0 8idB@ BH GP XP  `J(h(px+p J#  (([ (W( B. x9 l cZ G i tn2 @    \ /    E 2) 4 o &2V ? cl ; E "  $ ) $f2B 7B ;B uBWe eH1 r^I O @N $ ^ ; $ ^ i i s ~ ~      q   $  0  +  Y`    V O 9 H,   [ f f p { {  ;      [n g        I  n     %  0  ; V F k Q  \  g  r  }    ;k , ! iw  ! !  !   ; ;, ;E  , xE  E Wp ;"p0 !1$ !2 !V3 !5 4:l #~G@$BBG1>$,G>% ?%A?&aG~'?~% Bw?%s B?(res!G?'"p ~'A:# ~(clo$B@)ٍ% 7GQ@*n+Us,}*+U|1&+T~+Q~+Rs,*)+U~+Qs*ȍE+U2+T0, *v+U +T0, -v--- -M-bb,->- j.{ @ E ; int 0   %W '^ )eF +) )@ )CeH  s Qa)Pd; l m w e e   O0 Z -  . 4 /  0 1 j 2 3  4   :   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l { - % -N .U /\ 0c 20D 3BG 53O :     U BY-;C;  ?C ( @C Y AC C   B  G;?"F F MM"Mt %M  (X(/ +0= .82c@ 6iH$ 9MP=MXAt`2ChF(pI(x L(& P( T([( `r(1t;w(y{}L J s G~(( ( (j  b B(w08idB@ BH GPXP `J(h(px+pJ (([ (W( Bxl MZγ G S ^Xo2z /  E2o &2  E "& ) $f2B 7B ;B uBr^ Oc @  ; [n gc   ;k , ! iw1 1  A  Q A ;Q ;a ;z  a xz  z $ c 0  +  Y W ;. Oc 9 Ha p0g 1n 2 V3 5 4: G T /;G@UG@ retBA!. ~!A:g ~"WT  #UT#Tv#Q~"f_ " #Us#Tv"j F #U #T0$u %--J%$$p% j&B G0    %) '0int )7F +>"7o7 >q 7"> @   T C7 X >H {! v %" ! R T Uv^Vv2 (v z xi !y7 zi  |7 Bi D W !W ! ( CJ  E  FJ ! G Z >'x! H > .- ! 0 " 5 ! = ! > + @ A ! Ci$ L E( J0 I N8 T P@ ," [QH w \QX : ]Qh ) j-x = >  L ^  pQ aP d> le mp 7 7   O;Z-.4 /01j234 SYiit iG=y   >; i= i i.,5{,B;{  x9i     T (L08 @H PX`B h  ipitxI0 E { % -N .U /\ 0c 2;D3iG5O:   U i!  >   >? ( @ YA C i ok`k   >?"     " t %   ( (/ +0= .{82$ @ 6* H$ 9 P= XA5 `2C@ hFpIx L& P T[ `{r1twyK {V }a L {J {s g {~  j  b i(0r 8idi@ iH Px XP x `Jhp{x+{p{ J  [ {W i{{FȚ x˥ l  Z{     0 2;  F Q \ m   E 2  o &2   hZ !"!{{ +0 . fd/i 0 end1 2max3  4 ( 5 P 5 X 6` y97ih 98p >79x  ~ o >@    > Z rsE%" ) $f2i 7i ;i ui i 4 6i  7ip  W7$ e    H 1  !"     & 6 D& > O6 > ZF > _ Fx _ _4!: #V!MЏB7$fdMUA%errOiA&ޏ{'(Us1&&)(UU*(Uv(T (Q0#CB$fdCB%errEiB&{'(Us1&&)(UU*(Uv(T (Q0+5!%i',fd%i-buf'l./ 0i/ 1z0]? iU1!i1"Ul2{3B4~5'0)3H*C6<*Ύ(U1(Ts(Q~7Dm3cC8D9:D4~4~'](Us(T1(Q3(R~(X~&5&t;; ; ;  h;!!>">t %>  (I(/ +0= .82T@ 6ZH$ 9>P=>XAe`2CphFpIx L& P T[ `r1t,wy{{}L J s 8~  j  b B(h08idB@ BH 8PXP `Jhpx+pJ [ W Bǯxl >ZΤ 8 D OI`2k v   E2o & 2 "<8P9  6<8Ee> T>r ^ UG!} U0" #"("80  68F"D $O U0%"" & %3 L "P R 4 0 int[IT   F +` `@ `TH Qa`Pd4 l m 5 | |   O) Z-SY .G 4 /G 0G 1G j2G 3G 4G  I  =y 4 ; B ` = B  ` i. ,5,B ;   x9 B      T (L 0 8 @ H P X 5`B ;h Bp Bt xI ;  A{ Q % -N .U /\ 0c 2)D 3BG 5WO : 5  5 ; U B}TQ4Tg4  ?g ( @g Y Ag ;C ; ; BO  k4?"j  jj"jt %j  (u(/ +0= .82@ 6H$ 9jP=jXA`2ChFpIx L& P T[ `r1t_wy{}L J s k~  j  b B(508idB@ BH kPXP `Jhpx+pJ [ W BǺx l jZk p {u2 S E2o &2  "0 ) $f2B 7B ;B uB B 4 6B  7B  ##kVQ errkUFbufQ w;#BF b  !UU m 6 !Tw!Q "Ƒx " Tb #4$##e$""$2%n N X#p T ; int 0   %W '^ )eF +) )@ )CeH  s Qa)Pd; l m w e e   O0 Z -  . 4 /  0 1 j 2 3  4   :   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l { - % -N .U /\ 0c 20D 3BG 53O :     U BY-;C;  ?C ( @C Y AC C   B  G;?"F F MM"Mt %M  (X(/ +0= .82c@ 6iH$ 9MP=MXAt`2ChF(pI(x L(& P( T([( `r(1t;w(y{}L J s G~(( ( (j  b B(w08idB@ BH GPXP `J(h(px+pJ (([ (W( Bxl MZγ G S ^Xo2z /  E2o &2  E "& ) $f2B 7B ;B uBr^ Oc @  ; [n gc   ;k , ! iw1 1  A  Q A ;Q ;a ;z  a xz  z $ c 0  +  Y W ;. Oc 9 Ha p0g 1n 2 V3 5 4: B#G}G ,GF sBF!. ~!A:g ~"(G #UU1&#Ts#Q~">R  #Us#Q "h] 9 #U #T0$mh %L#L#%M% j&Q vP |# V ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBk#pH  6 GyH u#u#wn Q # X ; int 0   %W '^ )eF +) )@ )CeH  s Qa)Pd; l m w e e   O0 Z -  . 4 /  0 1 j 2 3  4   :   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l { - % -N .U /\ 0c 20D 3BG 53O :     U BY-;C;  ?C ( @C Y AC C   B  G;?"F F MM"Mt %M  (X(/ +0= .82c@ 6iH$ 9MP=MXAt`2ChF(pI(x L(& P( T([( `r(1t;w(y{}L J s G~(( ( (j  b B(w08idB@ BH GPXP `J(h(px+pJ (([ (W( Bxl MZγ G S ^Xo2z /  E2o &2  E "& ) $f2B 7B ;B uBr^ Oc @  ; [n gc   ;k , ! iw1 1  A  Q A ;Q ;a ;z  a xz  z $ c 0  +  Y W ;. Oc 9 Ha p0g 1n 2 V3 5 4: #G}G ,GYG sBG!. ~!A:g ~"ȒG #UU1&#Ts#Q~"ޒR  #Us#Q "] 9 #U  #T0$ h %##t%M% j& S # Z ; int 0   F +) )@ ))#)H zQa)Pd; l m  ;! ; HQ %" $     e  e   O0 Z - .4 / 0 1j 2 3 4   00;0X = yY   | ; l; B ) l= B  ) i . , 5,B ;   s x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U Bz  ;s  ; ?( @Y AC B 6=2= X h ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C hFpIx L& P T[ `r1twy {( }3 L J s 9 ~  j  b B(0D 8idB@ BH PJ XP J `Jhpx+pV Ja  [ W BȘ xˣ l ZM   2   # . ?  Q E\ 2@ jmpAF B  Cg  o &h2   ) ; ! ' (B@ )!H " ;S .F buf/" - "X ) $f2B 7B ;B uB B 4 6B  7B  #p/ 6G!y/ ! "UU# #J Y 6H$tp,P!. "Uw"T0%i &>>4&##D'Z U $ 9] ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB!$Q fd:HQ UU1&+$+$ W 7P ^ ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   FV;? "    "t %  ((/ +0= .8 2@ 6H$ 9P =X A`2 Ch Fp Ix L& P T [ ` r1 t w yJ {U }`L J s f  ~    j l b B( *0 x8id B@ BH P ~XP ~`J h p x+ p  J   [  W  B   ǯ Ƞx ˫l Z ;   2 @J J    P[ s E2o &V 2; ") $f2B 7B ;B uBL$A g$sHn$Ht$H A HJ.I[$ 9$BwIp1 Ip2! Jret"BgJ  y9,BJ G !U !T}!Q !R|"Д@  9J#PS f !UT!T #aS !T $k^ $x^ $i $t # !U}# !U|#  !U}!T|$% #6 3 !U $; J%2$2$&l&&& &88S%& >& j' Y $p ` ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBz$@, ,K$WKO m UU1&TT1&l U  T0 $$ j )[ $ b0    intF +e e@ e$S$ # $%L $&L $+w $,w $. > H ZQaePd> l m ~ 7 7   O Z -  . 4 /  0 1 j 2 3  4    $A   i . , 5$,B ;$   x9 S      T (L 0 8 @ H P X `B h Sp St lxI 0 E ${ 4 %w -N .U /\ 0c 2D 3SG 5:O :     U S`4>J>  ?J ( @J Y AJ C   S  N>?"M M TT"Tt %T  (_(/ +0= .$82j@ 6pH$ 9TP=TXA{`2ChF/pI/x L/& P/ T/[/ `$r/1tBw/y{}L $J $s N$~// / /j  b S(~08idS@ SH NPXP `J/h/p$x+$p$J //[ /$W/ S$$xl TZκ N Z e_v2 6  E2o &2  "! ) $f2S 7S ;S uS$Np fdNKcmdNK$N+Ll@retSdL $SL eM! "  #U#T7#Q@! "X A #T6#Q@" ^ #T5#Q@!ɖ "ݖ #U '#T0! ! $$""$ $%$ j%4] 7% d0    intSF +j j@ j X| >H _R T U^V2 (v_ z xS !y7 zS  |7 BS D L !L ! (C E F !Gj  >'x!Hf QajPd> l m "  7  7   OZ -@F .44 /4 04 14j 24 34 44   = y    > ; S j = S  ji ., 5,B ;  x9S     T (L08 @H PX-`B 3h  SpStqxI0 E 9{ I%| -N .U /\ 0c 2D3SG5OO:- - 3 U Su I > _ >?_( @_YA_3C 33S   c >?"b   b b "b t %b   (m (/ +0= .82x @ 6~ H$ 9b P=b XA `2C hFpIx L& P T[ `r1tWwy { } L J s  c~  j  b S("0 8idS@ SH cP XP  `Jhpx+p J  [ W SDZ x l b Zc h  s m  2     K   E 2  o &2   h !"! + . fd/S 0F end1 2max3  4 ( 5 P 5 X 6` y97Sh 98p >79xQ  ~  >@   ; > Z+ r@s@"h ) $f2S 7S ;S uS S 4 6S  7S  Z > D%& P $%6cpY !fd6c_N!ofs6cN!cmd6cN"ret8F 0O#W%^ 0  x9B         T  (L 0 8  @ H  P X`B h  BpBtxIc q { ,% -N .U /\ 0c 20D3BG52O :   U BX &,; &B;?B( @BYABC   %;?"  ^   " t %   (* (/ +0= .S825 @ 6; H$ 9 P= XAF `2CQ hF^pI^x L^& P^ T^[^ `Sr^1tw^y\ {g }r L SJ Ss x %S~^^ ^ ^j ^ b B(0 8idB@ BH %P XP  `J^h^pSx+SpS J  ^^[ ^SW^ BSS2 x l  ZΌ% %  0 * A 2L  W b m  ~   E 2@ jmpA B\  CR  o &2  !.j5$ *"' I/ #$ q/ J )Z ;$o o ; ;Z ! '? (B@ ) H ;S . buf/   hX !"!SS +i . fd/B 0 end1  2 max3   4 ( 5 P 5 X 6^` y97Bh 98 p >79 x*  ~ ^ ; Z rs"  jH2P&%%4'11%B&. 4 n3 9+ o1 43s%b/&'3,E0v&/c2/>5L3*3),O1 \3!%"2#3$'%.&\.'-(4)4*a,+^),M+-P).f5/+0)1/2.3Q,4&5,6&&7&8n/93:3;?*<)<+=)>;3?94@-Aa1B*C*D+E5F-G3H*/I-J+K''L'M~5Nv.O&5P&Q&R/S`*Tn,U0V#3Wy3Xd+Y,Z+[82\(]0^2_b'`)a(b(c(di&e%f5&g3*h)i'-j +k&l(m)n)o*p/qs4rS-s*t(u<.v0wB(xc(y%1zX5{+|2}=-~_0.5},--/40u*22)%10(,24-a-,*@),5,02>'*+/"211120)-\&j-q(,2/'=142V'11'Q(4J.N5+(&K/4(H2\4* (330]%m)v+,}0 323-'+/01#.&1z2J4%r') $ f2B 7B ;B uB B >!.a !!0 "!5 !!= !!> + !@ !A !!CB$ L !E( !J0 I!N8 T!P@ Y/!bH ,4!cP 1!dX -!e` )!fh &*!gp )!jax q;%tZ&Q'len^tQ(.^Q(0^R)*UN)9*Us*Tv*Q1+J,.%К_& R&1BR+_,.`%З('vfd`%S&,`%QS&1`%S&n.a%T&%/a%T&&a%U-fdcB>V(y9cBV(s0cBW(o.cB]W(dSW.dime(}(%f W(*f )X(G,f X.stg|~(s5h^#Y(.h^Y(0h^Z(iuZ/>_-itSZ0*U / -iSV[1nT2[34[51(q2[3(4[56p ~2\2\) *U1*Tw*Q~0P *U1*Tw*Q~68 2R\2H]7 8]}4fR])ә{*Uw*T}*Q1*R9+0{6*Uw*T9F)(*UN)dQ*U0*T|"*Q3*Xw*Yv9l`)k8*Us*T~*Q*R}9`)vi*U *T09`9;F9`)*U 9`)*U )*U `90ʚv*U *T0 S8;:$)4Bp;fd4B<4 =c6&=p7B>]? B?!B?"|:N5;val%@AA1^^B11nC22"YC$($("LC#+#+dDf !f Dz/&z/C#%D0E0CE))"=)C C<<*C jCbF| b 5 j ; intB 0   F +) )@ )H Qa)Pd; l m / j j   O0 Z -MS  .A 4 /A  0A 1A j 2A 3A  4A      i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   B[P [ v;?"  "t %  ((/ +0= .82@ 6!H$ 9P=XA,`2C7hFpIx L& P T[ `r1twyz{}L J s ~  j  b B(/08idB@ BH PXP `Jhpx+pJ [ W BǴxl Zk    '22 @z z   =  E2o &2 ; " ) $f2B 7B ;B uBIg ;W 5)g j1 09553g @5:P{ 5:u]y9:]:] < ] z_ ?B_#l W)`$ :P % w`% `&I 'U}'T|'Qv( & 'UU'T !( ) E 'T () d 'T @)24 ):? )QJ (YU 'U})` (Ɯk 'U !)˜v z*6)5B +5)+5)B,-55 5.l.##G... .88S.>. j/I Pe '6 m ; int 0   F +) )@ )B; H zQa)Pd; l m  E e e   O0 Z-ci .W4 /W0W1Wj2W3W4W  i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B;; ?( @Y A C   Bf [ f B f  ;? "  &&"&t %&  (1(/ +0= .82<@ 6BH$ 9&P=&XAM`2CXhFpIx L& P T[ `r1twyc{n}yL J s  ~  j  b B(E08idB@ BH  PXP `Jhpx+pJ [ W Bǿȹxl &ZΌ   , 71H2S ^it  E2o & 2"$) $f2B 7B ;B uB6 М BB ` 6 `fd`res /a UU! Uw- U2 T0K8  U  T0!PC "v#66"bb," j$.g 6` n 4 0 int[IT   F +` `@ `V6`TH Qa`Pd4 l mX6 m   R  |  |   O) Z -pv  .d 4 /d  0d 1d j 2d 3d  4d  I   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ;  {  % -N .U /\ 0c 2)D 3BG 5O :     U B)T4T4  ? ( @ Y AC BOshs 4?"  "t %  (((/ +0= .823@ 69H$ 9P=XAD`2COhFpIx L& P T[ `r1t wy{}L J s ~  j  b B(R08idB@ BH PXP `Jhpx+pJ [ W Bxl Z΃  # .(?2J  @     U  E2o &2 & 4 <KW L M N  Q R S y9T DU dimV &  4 " ) $f2B 7B ;B uB6(( vfd(ea 6(a `6)a 6)a! + a!+-b"e6+U~!@6+Bcb#ofs,b#len,b$ret,#buf-7c#fd2Bmc%l  ! 7c& B0 4X ' (d' Kd' d(P.)Uv)T|~")Q}*B=*XH*S+^ )U )T0*i6P( fddbuf eofsCelene!  -f!if"6U{!6Bf!6`f#retBeg"P6 {%< ! %g& ! ' h' :h' ]h(r)U|1&)T)Qs@<$s@<$,( $ &)R@<$&  $` '"h'h' h(+})T)Qs*ߝ=* H*eS+s^ )U )T0*xiT ,4-6" .!"B.".6")-&..&.&.&)/636600 0>0 j10u6u6/  i 7 q ; int 0   F +) )@ )V6)H zQa)Pd; l mX6m  E  e  e   O0 Z -ci  .W 4 /W  0W 1W j 2W 3W  4W     i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B,;;  ? ( @ Y A C  Bvkv ;?"    " t %   (+(/ +0= .826@ 6<H$ 9 P= XAG`2CRhFpIx L& P T[ `r1twy{}L J s ~  j  b B(E08idB@ BH PXP `Jhpx+pJ [ W Bǿxl  ZΆ  & 1+B2M  @     X  E2o &2  ) ;9 ;@) 9 9 "b ) $f2B 7B ;B uB6#V 5#"i %V Ei%i%X_$%Bi} &\ _ len'Bi p(%j! c  1nj" #U~$m ) , % j% j%} j"_ #U|#T~#Q &= #UU#T 'G 'O 'g &o  #U|' &Ơ H #U 'ˠ m (;)6 *5**0+2,676+l+++ +88S+>+ j-I l g7P Kt ; int 0   F +) )@ )H zQa)Pd; l m / e e   O0 Z -MS  .A 4 /A  0A 1A j 2A 3A  4A     i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   B`U ` {;?"    " t %   ((/ +0= .82 @ 6&H$ 9 P= XA1`2C<hFpIx L& P T[ `r1twy{}L J s ~  j  b B(/08idB@ BH PXP `Jhpx+pJ [ W BǴxl  Zp   ,27  @     B  E2o &2  ; " ) $f2B 7B ;B uBC7Р pk  3kokw7B#7Bk r!rpk"  #Ll# P ? $ l$ l%\ &T0'P e &UU&T 'l } &Uv'w! &Uv(- '8 &U (C )M7% *<7%*17%+M7V7M7,l,2-BB3,>, j.jn q8dv ; int 0   F +) )@ ))#)H zQa)Pd; l m    ;, ;  H \ %" $ # +7 1) ; 7 C g ;j8 Fr    e  e   O0 Z -  .4 / 0 1j 2 3 4  kq _= y    ;; B)= B ) i . , 5,B;' > 2  x9B     T (L08 @H PX`B  h  BpBtxI^ l { #% -N .U /\ 0c 20D3BG5)O :    U BO # ; 9 ;?9( @9YA9 C   B   ' ;?"<   < < "< t %<   (G (/ +0= .82R @ 6X H$ 9< P=< XA `2C hFpIx L& P T[ `r1twy { } L J s  '~  j  b B(0 8idB@ BH 'P XP  `Jhpx+p J!  [ W BX xc l < ZΩ' B  M G E J F G" 8 5H p^ 2  @           E 2@X jmpA B  CI' ^ o &2 i  ) ; ! ' (B@ ),H ;S . buf/  e2   Z  2 |#A52U3I/3 385 &5 end5  5 ptr5  5 5( 50< 7" 8' 97 :' ;8< &< end<  < ptr<  < <( <0 > ?'mem@7maxA7 j8C &C endC  C ptrC  C C( C0 Sk TkUeV [Z ] s ;@c s s ; Z rs < ;" ) $f 2B 7B ;B uB !B "4R "6B  "7B- R!7A'J"8A'l"7A'm"7A'7m"8B'Zm# DJm#D m$7D {%?8DB$6E|$BE}$S8E~$7FB{#G n&tvH7{'tvpIP'n#sJBJn'resK'n(x# e'o)ĤPW*Uo+P,{-xo.Ѥ/Us0q/U|/T~/Qs0-/T}/Qs0K/T|/Qs10 /T~/Q}/R|/Xs10)V/T~0;V/T}0MV/T|0^/U3/T00/UF/T /Q01.ʥ/U /T0 72Z80'p<"c80'o"70o# 2JCp#2 p&l3'~&res3'~$73 ~%183B3 t'fd6Bp( :'__d7)q.+ /Uv4G.#88'bq.S/U2/T0(# >'q157#B~"c8#'q"7#q"7#~r3p 67%B67%B+ 'l&'r+ 'fd')r4'__d*) s. /Us $ &B7 878sec 6$8 67 9,8,8#n9977 e9 9bb$,9  h:9 j988%qdq 9(z 4 0 intB`NY   %z '; )F +e e@ eV6eYCŁH   QaePd4 l' m2X6 m k        O) Z -  .4 / 0 1j 2 3 4  .4DNDl " i . , 5=,B ;=  x9B     T (L08 @H PX8`B >h  BpBtxI;  D{ T% -N .U /\ 0c 2)D3BG5ZO :8 8 > U BYT4Yj4?j( @jYAj>C >>BT n4?"m m tt"tt %t  ((/ +0= .=82@ 6H$ 9tP=tXA`2ChFHpIHx LH& PH TH[H `=rH1tbwHy{}L =J =s  n=~HH H Hj   b B(0 8idB@ BH nP XP  `JHhHp=x+=p=) J4  HH[ H=WH B==? xJ l tZ n z 2  @  = = m V   $ E/ 2: E o &2g P t} 4 E" ) $f2B 7B ;B uBr;  O @ Y 4 Ƶ @98a:8 :W:  :@8987:998J: *:@9 8 9 H9 8 '9@ [n g  Y 4k  , ! iw!C "C " S " c S 4c 4s 4 ӌ  s x   $  0  +  Y z 4 @ O 9 Hs #p0y "1 "2 "V3 "5 4:} I 4 $o: %f9wnЪ &wts&9wBs' (9an ),an)9an*ofsan*lenbn)y9bn)bn+retdB,gdB,6ee,P6f ,g@ ,A:hy Y -4%~:OnO&,Ons&9OnQt.ofsOnt.lenOnt&y9PnHu/retRBu0gRBu06Sev$P6T {1f9Y2_v2v2vv3P4Uw4T Q1&T"4Qs4R@<$54UX4T 6U5i4Uv1&4Tw4Qs $ &4R|6q5A4U 4T06782n_&,2nw&92nw.ofs2nw.len2n&x&y93nx0 5_#y05_y$95{0U95By8adr6n{$86{0 96By/ret7Bz0g7B;z068ez$P69 {/res:n{$;@ {$A:2vޅ3W4Uv4TQ1&~"4Qs4R@<$? 2 > 2! ;2, a27 2B @AAAAAA34U 4T05 @4UX4T 5!^i4U{4T4Q{6\5xi4U|1&4Tv4Qs $ &4R}4X66ŪB99 9C##GCC::C C jDC99/B CMCbb,C>C99C--JCp9p9 t :Pr~ ; intB 0   F +) )@ )H Qa)Pd; l m / j j   O0 Z-MS .A 4 /A 0A 1A j2A 3A 4A    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   B[P [ v;? "  "t %  ((/ +0= .82@ 6!H$ 9P=XA,`2C7hFpIx L& P T[ `r1twyB{M}XL J s ^~  j d b B(/0p8idB@ BH PvXP v`Jhpx+pJ [ W BǴȘxˣl Zk    '22 =HS k }E2o & 2 ") $f2B 7B ;B uBI ; :  :9 ,ӆcmd  UU1& TT1& $ &2$ "!) U  T0"::" j v :: ; int 0   F +) )@ ))T )H zQa)Pd; l m! , %" !   p  e  e   O0 Z -  . 4 /  0 1 j 2 3  4     3   = y4  W; G; B ) G= B  ) i . , 5,B ; C x9B     T (L08 @H PX{`B h  BpBtxI^ l { % -N .U /\ 0c 20D3BG5O:{ {  U BJ;C; ? ( @ YAC B   (8;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1twy{} L J s  ~  j  b B(p0 8idB@ BH P XP  `Jhpx+p& J1  [ W B< xG l ̰Z  2   ! E, 27 B o &82d M z ;@j z z  ; Z rs " ) $f2B 7B ;B uB B 4I 6B  7B$ I ; 0w : Esec" ~pi t&@ret'B!w T& " #$ @% &_ 'Us( ( ) ; 'Us'Ts( &Ы 'U ,'T0(ի *: +sec ,$8 ,7 -,8,8n-%--:: - - j. x ;ς ; intB 0   F +) )@ )H Qa)Pd; l m : j j   O0 Z-X^ .L 4 /L 0L 1L j2L 3L 4L    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   B[P [ B [ ;? "  "t %  (&(/ +0= .821@ 67H$ 9P=XAB`2CMhFpIx L& P T[ `r1twyX{c}nL J s t~  j z b B(:08idB@ BH PXP `Jhpx+pJ [ W BǴȮx˹l Z΁  ! ,&=2H S^i  E2o & 2 " $) $f2B 7B ;B uBWj} eH1 rc O} @   ;             q   $! ! + 6 6 @ K K U ` ` j ;u u     [                &  ;  P  e ! z ,  7  B  M Ih ;X h `I ; % P!%;)h "BB)C";)|"I*Ȉ"s*#s,B`$ty-B% ? &UU%) s &Us2$`"&Tv&Q|1&'H &U @&T0(v(/;/;f( j z 6;Ԅ ; intB 0   F +) )@ )B; H Qa)Pd; l m ? j j   O0 Z-] c .Q4 /Q0Q1Qj2Q3Q4Q     i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B  !;  ; ? ( @ Y A  C   Bk` k ;? "  "t %  ( (/ +0= .82+@ 61H$ 9P=XA<`2CGhFpIx L& P T[ `r1twyR{]}hL J s n~  j t b B(?08idB@ BH PXP `Jhpx+pJ [ W BȨx˳l Z{   &   72 B M X c   {  E 2  o & 2 " ) $f2B 7B ;B uBWjk eH1 Iv k v v H;P BB̉ ; IQ s!svP"res"ty B# 1 $UU# W $Tv$Q|1&$Rw# s $U2$T0# $U l$T0% &v&R;R;l&bb,& j'| c;`φ ; int 0   %W '^ )eF +) )@ ))#)CeH  s Qa)Pd; l m(  i  i ;y ; T H  %" $ # +    e  e   O0 Z-. 4 / 0 1 j2 3 4  }q=y >  ;; B)= B ) i. ,53,B;39 >> D  x9B     T (L08 @H PX`B h  BpBtxI^ l %{ 5% -N .U /\ 0c 20D3BG5;O :   U Ba 5 ; K ;?K( @KYAKC B   9 ;?"N  > N N "N t %N   (Y (/ +0= .382d @ 6j H$ 9N P=N XA `2C hF>pI>x L>& P> T>[> `3r>1t-w>y { } L 3J 3s  93~>> > >j > b B(0 8idB@ BH 9P XP  `J>h>p3x+3p3( J3  >>[ >3W> B33j xu l N Zλ9 T  _ Y E J F G 8 5HF pp 2  @  3 3 M    !  # E. 2@j jmpA B  C[9 p o &2 { e   Z   |#>A>52>U3>I/>3> 385w &5w end5w  5w ptr5w  5w 5( 50N 7 89 9I :9 ;8< &< end<  < ptr<  < <( <0} >F ?9mem@ImaxAI j8C &C endC  C ptrC  C C( C0 Sk TkUeV [>Z ]>  ;@   >, ; Z rs N ] ;h )x ; ! '] (B@ )yH x ;S . buf/  E  " ) !$f!2B !7B !;B uB "B #4p #6B  #7BK p!1>$#=$B/>$Be%)N.<< <8>E>== ;=_=+=!9<)<.=/8=2f>3r;\>^~;b\<g<l=<h<<"<#%x$%x$ %؈$ %٘  ;  ;  ; % %Nx% %4&: %=ea =S<;=< !>i< ];jB (>kB <Q ; A&u<pQ  <{ ;k&=}{  < ;&;  < ;&= &;   ;<&; `-! 9 ;&;)  -!&K=) ,!'F<(iB(lg{(tv)Q>9а8P*vty9U+;9+=9ڋ*val9,ty_,opt-.UU1& 3$,!".TU1&.XT.YR)j= 97*vty 9,+; 9e+= 9,ty,opt%-ǰG.UU1& 3$ -!".TU1&.XT/=9`.G0>71tyO0];Bڏ0(>B90/;91val9&D=c@2<Q3q04506@78.Uw9.Us.T|:u9-.UF.Tv.Q08.Uv.T0;;9Ik0>71tyC0];B0(>B0/;9`2 k2 res91&D=c~&<~?L2 99ӭ.Uv1&.T}.Q.R~.X~9 .Uv1&.T}.Q.R~.X~9s.Uv1&.T}.Q.R~.X~:9ۮ.Uw.T0::&:?9T].UF.Tw.Q0:Y @ 8Asec B$8 B7 C,8,8'nC[>[>(DC  hC jCt=t=(C>>)4C<<dC>>)?8} c?ъ 0    intaF +0L"EoE Lq E"L 0@ 00 0 0T 0 a X LH m ! t %" !   R  T  Ut^ Vt 2 ( v z xa ! yE  za  |E B a D Z ! Z !  ( CH  E  FH ! G0 XL'x! H > .+ ! 0x " 5 ! = ! > + @ A ! Ca$ L Ex( J0 I N8 T P@ ," [OH w \OX : ]Oh ) j+x ;L Q a0P dL lB mM  E E   O9Z-.4 /01j234 06FFQ Fn$=yo c L; a0= a 0i.,5X,B;X >c  x9a     T (L08 @H PX`B h  apatxI> S { % -N .U /\ 0c 29D3aG5O :   U a  L L?( @YAC a LSHS n ~L?"  c   " t %   ( (/ +0= .X82 @ 6 H$ 9 P= XAI `2CT hFcpIcx Lc& Pc Tc[c `Xrc1twcy { } L XJ Xs  X~cc c cj c b a(0 8ida@ aH P)XP )`JchcpXx+XpX J  cc[ cXWc aXXD x l  Zc     EI J F G# 8 5H p 2O  @  X X Z     E 2  o &~2  E3   Z  3 |#cAc52cU3cI/c3c 385 &5 end5  5 ptr5  5 5( 50 7# 8 9 : ;8< &< end<  < ptr<  < <( <0 > ?mem@maxA j8C &CendC CptrC C C( C0 Sk TkUeV [cZ ]c LtL@dtt cL Zrs L hX !"!XX +# .fd /a  0end 1 2max 3  4(  5P  5X  6c` y9 7ah 9 8p >7 9x ~!") "$f"2a "7a ";a #ua $4" $6a  $7a " h=L-!1?/=  ">T#fd֕$reta%bufj~&`'"'E(ʹ})U1)Ts1&)Qv**ѹ+)")U1)Tv+F)U )T0*,> -5l. . ˖!Z }/$a$reta%bufj~0p10. J(J))U1)T}&!_'B'6(')U1)Ts)Q}+)Us)T  ***/+7)Us+)U  * ,A?p -5Ɨ. . %!Z }/$a$reta%bufj~0p[1. (:))U1)T}&O'pژ'd()U1)Ts)Q}+&)Us)T ***+'e)Us+u)U *z"S?#fd $reta%bufj~&p 'Y2(})U1)Ts)Qv*ڶ*+!)W)U0)Tv+L{)U )T0*Q(d)UK)T )Q0,q>`Al-5|. . ۙ!Z }/$a$reta%bufj~0p1@q. Z(K))U0)T}&!w'B'6()U1)Ts)Q}+)Us)T  ***+)Us+=)U  *()UK)T  ,>oA)-5o֚. q.q 5!qZ }/$qa$retra%bufsj~0ptk1.. ~())U0)T}&O'xw'p'd ()U1)Ts)Q}+)Us)T ***+Ǵ)Us+6)U *;(Q)UK)T 3>H-?Ha0#bufH. J.J @!+?K~!1K~!*K~!K~%vK~!?KZ / ?Ka4. lv&CWg''56"6X6*ų& 0X''9506s66*&NpY'P'5p6Ġ66X*ճ* *N*+Z)U<)T0+%)T  )Q7)R0*ڳ*0*j7>8)8sec8.9!80$s<)$n?)$tA):]? a!;!a;":{>>aO;5F;":> a};5F;"<>>>=#l==88S<>>>=  #h?>>%=>>&4=bb&,=00'=%%&6 ؃ ? m ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b B(*08idB@ BH PXP `Jhpx+pJ [ W Bǯxl Zf    "2- @u u   8{  E2o & 2 ; " ) $f2B 7B ;B uB?,p-  6, . .u  / uo? C ?ǡn$t$  0 ul!?8 ?B"p1ڢ"p2#"retBl#' )$ %UT%T H$Ѻ %T Hۺ   $ ! %U|%Tv $ F %U|$ ^ %UvM $^ %U Hc & >&l&&'??%& &88S& j( B   B int 0   F +0 0@ 00#0T 0H Qa0PdB l mH3 %" $  w l l   O7 Z -  . 4 /  0 1 j 2 3  4   :   = y;  ^B N; I 0 N= I  0 i . , 5,B ; >  U x9 I      T (L 0 8 @ H P X `B h Ip It xI e s {  % -N .U /\ 0c 27D 3IG 5O :     U I\BUB  ? ( @ Y A C  I :JB?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C hFpIx L& P T[ `r1twyc {n }y L J s  ~  j  b I(w0 8idI@ IH P)XP )`Jhpx+p J  [ W Iȫ x˶ l Z/  E J FW G 8 5H p2  @c c    & i t   E 2  o &J2  l   Z   |#A52U3I/3385 &5 end5  5 ptr5  5 5w( 5w0 7 8 9 :;8 ?mem@maxAj8C &C endC  C ptrC  C Cw( Cw0V Sk TkUeV [Z ]@ B@0 @ @ m B Z] rs B " ) $f2I 7I ;I uI I 4 6I  7I  b@I H ? A!&g "|A(0"o@)!. "A00"@1!4 "A60",@7!: "P@<0"@=!A "?C0"@D!G"<@I0"@J!M!"AO0"@P!T@"@V0"PAW!Z_"A\0"@]!`~"F@b0"@c!f"?h0"Ai!l"@n0"=Ao!t"?v0"Aw!{"@}0"?~@s Y@" #@$#H #g (# 0# 8# @# H#P#!X#@`#_h#~p#x##$-A% 6&res!&'ru"~(P)oA'*bA')( )oA)*bA))(/)oA,*bA,)+w#`)oA.*bA.)@,л}-U4-T,ݻ-U0-Tv,=-U -Tv./bb,/@@W0R A@l0    intF +e e@ e Xw >H Z  > > R  T  U ^V 2 (v z xS !y7 zS  |7 BS D L !L ! (CEF!Ge  >'x!H Q aeP d> l m  M  7  7   OZ -kq ._4 /_ 0_ 1_j 2_ 3_ 4_   = y   4 > $; S e $= S  ei ., 5,B; >  6 x9S     T (L08 @H PXn`B th  SpStlxI0 E z{ %w -N .U /\ 0c 2D3SG5O :n n t U S=  >6  >?( @YAtC ttS   + >?"     " t %   ( (/ +0= .82 @ 6 H$ 9 P= XA `2C hFpIx L& P T[ `r1twyD {O }Z L J s ` ~  j  b S(M0k 8idS@ SH Pq XP q `Jhpx+p} J  [ W SǬȿ x l ̣ Z     E J Fk G 8 5H p 2  @D D     J U vf  x E 2@ jmpA2 BD  C  o &+2  7 ! !!! Z   |#A52U3I/3 385 &5 end5  5 ptr5  5 5M( 5M0 7 8 9 : ;8 ?mem@maxA j8C &C endC  C ptrC  C CM( CM0j Skk TkkUkeVk [Z ] T >@D T T  > Zq rksk > e > ! ' (S@ )H  >S .2buf/ h !"! + . fd/S 0bend1 2max3  48( 5 P 5 X 6` y97Sh 98p >79xm ~  "&) !$f!2S !7S !;S "uS #S $4 $6S  $7Sv"#A0$50$60% 2ƥ%2D &2 '$2S(p38(ret4S(len5bʦ){n% >*:+UU+T n,D,L*W+Uv+T},_*g+Uv*+U n,D #A$5%$6H% !k%!D &! '$!S(p"ݧ(ret#S&(len$bo){% -*<+Uv+T n,F,N*YI+Uv+Ts,`*hn+Uv*+U n,-"l--.0A 0- -88S- "j/ JB ; intB 0   F +) )@ )H Qa)Pd; l m  ; ; _ j j   O0 j]Z - .4 / 0 1j 2 3 4  ,,7,"  = yU   x ; h; B ) h= B  )i ., 5,B ; >    x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U B  ;  ; ?( @Y A C  B 2I>I d t ;?"  "t %  ((/ +0= .82 @ 6 H$ 9P=XA? `2CJ hFpIx L& P T[ `r1twy { } L J s  ~  j  b B(_0 8idB@ BH P XP  `Jhpx+p J  [ W BǴ x l ZY   E? J F GL 8 5H p 2E  @     P      E 2@ jmpA B  C  o &t20  j\   Z6  \ |#A52U3I/3 385 &5 end5  5 ptr5  5 5_( 5_0 7L 8 9 : ;8< &< end<  < ptr<  < <_( <_0 > ?mem@maxA j8CE &CE endCE  CE ptrCE  CE C_( C_0 Sk TkUeV [Z ] 2 ;@   ; Z rs  ; ) ; !M ' (B@ )H  ] ;SM . buf/] h  !"!" ) $f2B 7B ;B uB B !4' !6B  !7B ' IB ;C2!AB "B" P7!# I H7!$2B[@G;%fd[B&U[,A&hB['y9]B(Z)Us)T1)Q0(r )Us)T2*)Uv)T|$ BSG%fdSB"&US,&hBS'y9UB?( )Us)T1)Q0(")Us)T2*7)Uv)T|+KB#,BBKU$D,&5Db&UD,()y)Us*)U2)Tv)Qs- ?&U?, &hB?V.5*)Ts)Qv/ $0A&B$B&U$,¬&hB$' &'& ">7'~0err'~0arg'~")'P 1S'B2res(2exn) )3p"+ P7!41+ 5E ='oB1Ѯ'A1 (@U)U}(/m)U|(K)U4)T0.1V(=a)U P(]@)U *ql)U `  +#B'/& 6<e7BB4BB8err9/F:@l;L??*K)U1)T0*̾w)Us)T )QD)R @"""A q@#%@$2@bb$,@]B]B[@!B!B%<@#+#+d@00&. B ;RKK nnK~KY!'0(@)~H intKS K 0   F +R R@ RR#R  W WH Q aRP dK ln my 9H %" 9 $ D# +D  O O O Z-7 =.+4 /+0+1+j2+3+4+   ^  =y QK; R=  R i.O ,5,B;Z > ex9Q QQQ T Q(LQ0Q8 Q@QH QPQX:`B @h  pt#xI   F{ V%. -ON .OU /O\ 0Oc 2D3G5\O::: @U    WVK WlK?l( @lYAl@C @@  ZK?"o   o o "o t %o   (z (/ +O0= .82 @ 6 H$ 9o P=o XA `2C hFpIx L& P T[ `r1tNwy { }& L J s , Z~  j  b (07 8id@ H ZP)XP )`Jhpx+pB JM  [ W ńƄcȄ xˏ l o Z Z u   z E J FO  G 85H p  2   @         ! B 2  = E H 2@ jmpA B C| S   o &2  . buf/     Z   |#A52U3I/3385 &5 end5 5 ptr5  5 5(50 o  7  8Z9j :Z;8 ?Zmem@jmaxAjj8C &C endC C ptrC  C C(C0 N S7k T7kU7eV7 [Z ]8 K@ ( 8 8 e K ZU r7s7o K" Q) $Qf 2 7 ; u ! "4"6 "7  !BZo"5Z"+?Z!"1ZD#  og#  $ %$ &tv!u~'t!ٰ'p"Q'ret#X'at$)'mt$)ױ(!# 5Z!)0+n*Y+0,~-|./Us),*+,~-ֲ./aw)/Us0,/Us/T 1p1x0!/Us/T}10F/Us1> .O/U   K 2 83sec)4$8)47)5,8,8#n5l555BB"5 588S65 j Bߟ 4 0 int[IT   F +` `@ `TH Qa`Pd4 l m  < | |   O) Z -Z`  .N 4 /N  0N 1N j 2N 3N  4N  I   i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ;  {  % -N .U /\ 0c 2)D 3BG 5O :     U BT4T4  ? ( @ Y A C   BO]R ] x4?"  "t %  ((/ +0= .82@ 6#H$ 9P=XA.`2C9hFpIx L& P T[ `r1twy|{}L J s ~  j  b B(<08idB@ BH PXP `Jhpx+pJ [ W BǺxl Zm    )24  @| |    ?  E2o &2 4 <KA L M N  Q R S y9T DU dimV   4 " ) $f2B 7B ;B uBB_H fd_buf_X `6_{ 6`! b e!b|"6b?{!6bB#ofsc`8#lenc`!6dB#retdB"P6e {$~ % r&|*PlK '(')B*U}*T Q1&T"*Qs*R@<$+G,X~ *U|1&*T}*Qs+`++)*U *T0|T -4 C: vfd:S 6:v `6; 6; B;߷! = !=|>"e6=?~!@6=B#ofs>ָ#len> !B>B#ret>#buf?ֹ#fdDB .  % T+,' *Uv*T|~"*Q+++U+a+f)t*U *T0BP|fdZbufϺ `6 6g! ! ܻ!!|d"6!?{!6!Bȼ#ofs"`#len"`6!B"`!6#Bݽ#ret#BP"P6$ {$r% 7&|'+''')=*Uv*Q}*R@<$+B,P#*U|*Tv*Q}+X+c+,n*U *T0+/&0&0&0&)199923BBq2 2>42 j2%Y  4C ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB$CP tP UU1&.C.CI  C ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b B(*08idB@ BH PXP `Jhpx+pJ [ W Bǯxl Zf    "2- @u u   8{  E2o & 2 ; " ) $f2B 7B ;B uB% j' " LC ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b B(*08idB@ BH PXP `Jhpx+pJ [ W Bǯxl Zf    "2- @u u   8{  E2o & 2 ; " ) $f2B 7B ;B uBUC 5  u8$BSpretB   !! % "UU"T # # ! W "Uv# ! | "Uv# ! "U # u$l$$%_C_C$ $88S$ >$ j&  fC  ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b B(*08idB@ BH PXP `Jhpx+pJ [ W Bǯxl Zf    "2- @u u   8{  E2o & 2 ; " ) $f2B 7B ;B uBDIR] CCu vdU u xuC8qCB d{ "!  %X" # $ $U|" " # g $U9$T $Q0" uR %%CC% % >%  h&6  C@b ; int 0   F +) )@ )H zQa)Pd; l m 5 e e   O0 Z-SY .G 4 /G 0G 1G j2G 3G 4G    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V B V ;? "  "t %  (!(/ +0= .82,@ 62H$ 9P=XA=`2CHhFpIx L& P T[ `r1twyS{^}iL J s o~  j u b B(508idB@ BH PXP `Jhpx+pJ [ W Bǯȩx˴l Z|   '!82C NYd | E2o & 2 " $) $f2B 7B ;B uBC BBfd1fd2+ UsT Q0 ( = UvTsP# U T0 U. ! B B~!v"CC! j!2B2B М C`0    intF +e e@ e >H Z  QaePd> l m* 7 7   O Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 S      T (L 0 8 @ H P X `B h Sp St lxI 0 E {  %w -N .U /\ 0c 2D 3SG 5O :     U S >>  ? ( @ Y A C   SVK V q>? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b S(*0k8idS@ SH PqXP q`Jhpx+p}J [ W Sǡȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2S 7S ;S uSCpH fd S% !Us!Tv1& " !U !T0#$CC%# # j  Cխ ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBCM fdnuidgid Be  Us Tv1& Q|1& ! U  T0"#CC" " j! y gD| ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBID6c fd6 UU1&T Q0C0 fd0 UU1&T Q0D&`IZ fd& s(BY w  UsT3Q0  9 UsT4 U T02DI fd|sB ' UsT3Q0 ? UsT4Y U T0!2B2B! B B~!""! j * Dt ; int 0   F +) )@ )$BH zQa)Pd; l m$b  ;! ;  p  e  e   O0 Z - .4 / 0 1j 2 3 4     3 = y4   W ; G; B ) G= B  ) i . , 5,B ;   N x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U BU  ;N  ; ?( @Y AC B   3 C ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1twy{ } L J s  ~  j  b B(p0 8idB@ BH P% XP % `Jhpx+p1 J<  [ W BǺs x~ l ̻Z(  2    , E7 2@s jmpA\ B CB y o &C2  DBoDBDe? -EDDfEEEEDEE" ) $f2B 7B ;B uB B 4 6B  7Bj Sk TkUeV [Z ] ) ; !( ' (B@ )!H 8 ;S( .\ buf/8 C !uE$ - " 6$#ret&B$& $0 $A- $i %wp &Us%  &U h&T0' &U ((;Ep $ ) &U5&T0(E  "#EG) &U4&T U $ &*MEMEL+EE*EE&* j*b+DD8+DDG[c E00    intF +e e@ e Xw >H Z  > > R  T  U ^V 2 (v z xS !y7 zS  |7 BS D L !L ! (CEF!Ge  >'x!H  e >  !)  '  (S@  )H 9 > S) Q aeP d> lK mV    7  7   OZ-.4 /01j234 9?OOZOw-=yx l  >; Se= S ei.,5a,B;a   x9S     T (L08 @H PX`B h  SpStlxI0 E { %w -N .U /\ 0c 2D3SG5O :   U S  >  >?( @YAC S U\Q\ w  >?"  l   " t %   ( (/ +0= .a82 @ 6 H$ 9 P= XA& `2C1 hFlpIlx Ll& Pl Tl[l `arl1twly< {G }R L aJ as X a~ll l lj l b S(0c 8idS@ SH Pi XP i `Jlhlpax+apau J  ll[ laWl SaaǬȷ x l  Zl     ! 2,  7 B M ^  p E{ 2@ jmpA B<  C   o &2  . buf/9  h !"!aa + . fd/S 0. end1 2max3  4 ( 5 P 5 X 6l` y97Sh 98p >79x9  ~ U >@   l# > Z rs"P ) $f2S 7S ;S uS S 4 6S  7S !F(F "fd("len(# *S$ofs+. N%-& 8W 'Us'Tv%'H(FS'U m'T0!EH-"fd"len#  S%-&8 'Us'Tv1&%H(S'U m'T0)*0E0) ) jQ  F`Ӷ ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB%FPH  6eYH /F/FQ  IFe ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB7FpH  6yH AFAFQ  dF ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBSFH  6H ]F]F   F ; int 0   F +)oe )@ )H zQa)Pd; l m 5 e e   O0 Z-SY .G 4 /G 0G 1G j2G 3G 4G    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   BaV a |;? "    " t %   ((/ +0= .82!@ 6'H$ 9 P= XA2`2C=hFpIx L& P T[ `r1twy{}L J s ~  j  b B(508idB@ BH PXP `Jhpx+pJ [ W BǺxl  Zq   -28 @     C  E2o & 2  ; " ) $f2B 7B ;B uBF * mF, F- F. F/ F<P^9 gid<G>9 Ia' r2 Us= ! "H U  T0] F,^ #>7,G.9 S Us' _ Us(= !> "NH U w T0$uF2! #G9 : ! %>7~%F&mem%)CSB 'resC(  )ySj oj }u   U4 T0  )%)FFe)}}k) j* q)FFk)2)3)bb,) >+ i G ; int 0   F +)oe )@ )H zQa)Pd; l mqA  @  e  e   O0 Z -^d  .R 4 /R  0R 1R j 2R 3R  4R      i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B"; ;  ?  ( @  Y A  C  Blal ;?"  "t %  (!(/ +0= .82,@ 62H$ 9P=XA=`2CHhFpIx L& P T[ `r1twy{}L J s ~  j  b B(@08idB@ BH PXP `Jhpx+pJ [ W BǺxl Z|   '!82C @     N  E2o &2  ; "+ ) $f2B 7B ;B uBG  6F n!B3G!B res"X!p i2B" %# #, # $? %U0%T0" 0*g #, # 2$? %Us%Tv&O 'Z %Uv%T s $ &2$' e %Us $ &'@p %Uv'Up %Uv$c{ %U %T0()G B9 ) B)! 9 *)GF)G+%+FF+GG.+88S+ j  RGY ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB?Gp-  6U>7y  !U2!T !Q0"IGIGS#2#  hQ v oG ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB]GH  6H gGgGz  G ; int 0   F +)"eoe )@ )H zQa)Pd; l m @ e e   O0 Z-^d .R 4 /R 0R 1R j2R 3R 4R    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B"; ;  ?  ( @  Y A  C   Bla l ;? "  "t %  (!(/ +0= .82,@ 62H$ 9P=XA=`2CHhFpIx L& P T[ `r1twy{}L J s ~  j  b B(@08idB@ BH PXP `Jhpx+pJ [ W Bxl Z|   '!82C @     N  E2o & 2  ; "+ ) $f2B 7B ;B uBF01 G3 G4 G5 yG6 G7 G8 G9(GB^h uidBGDh 6  - Us !% " U  T0h G2P^% #>72G4h ^ Usg x Us !% " U  T0$G #Gh '  %>7~%F~%G~&dir%G%)NSB'res0(  /f      m U7 T0= B )%)GGm)}}k) j* q)GGs)2)bb,) >+Q H H@C ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBGH  6H GG Ѷ H` ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBH0V HF4A a UvS  UvTsx UFT Qv U T0  q!)H)H!  h! j Hu  B intI 0   F +0 0@ 00#0H Qa0PdB l m  B- B H] %" $     q  q   O7 Z - .4 / 0 1j 2 3 4  &,<<G<d = ye    B x; I 0 x= I  0 i . , 5,B ; >    x9 I      T (L 0 8 @ H P X `B h Ip It xI j x {  % -N .U /\ 0c 27D 3IG 5O :     U I   B  B ?( @Y AC I BTIT o  B?"  "t %  ( (/ +0= .82 @ 6 H$ 9P=XAJ `2CU hFpIx L& P T[ `r1twy { } L J s  ~  j  b I(0 8idI@ IH P)XP )`Jhpx+p J  [ W I x l Zd    EJ J F> G 8 5Hn p 2P  @    u [     E 2@ jmpA B  C  o &24  E 0U B ! ': (I@ )-H U BS . buf/  q   Z   |#A52U3I/3 385 &5 end5  5 ptr5  5 5( 50 7 8 9 : ;8<7 &<7 end<7  <7 ptr<7  <7 <( <0 >n ?mem@maxA j8C &C endC  C ptrC  C C( C0= Sk TkUeV [Z ] B' B@ ' ' T B ZD rs  B" ) $f2I 7I ;I uI I  4  6I  7I !@Hq X5HOHH zH hZ 4H k8 H m8 Pj BZ"rH1j #^H=fA$IH=%val?5@&@'UU1& $ &2$"'Ts&MJ'Us&q3'U 'T0(v#H3pJ$IH3$H3%new55%old55&'Uv&'Uv&'Us2$"'Tv'Q|&J'U|&<'U 'T0()H']*tp'g%res*P+#',oA+-bA+)+J!,oA,-bA,).#'U2'T5/Hs*tv/*sec)"$8)P-7)&'a)'Uw((80hHhH z0 j10HH 0bb!,0,8,8"n2HH H 0 "I ; int 0   F +) )@ )H zQa)Pd; l m  ;  ; Z e e   O0 Z -x~ .l4 /l 0l 1lj 2l 3l 4l   = y   A ; 1; B ) 1= B  ) i . , 5,B ;   8 x9 B      T (L 0 8 @ H P X p`B vh Bp Bt xI ^ l |{  % -N .U /\ 0c 20D 3BG 5O : p  p v U B?  ;8  ; ?( @Y A vC v vB   - ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA`2ChFpIx L& P T[ `r1twy{}L J s ~  j  b B(Z0 8idB@ BH P XP  `Jhpx+p J&  [ W Bǯ] xh l ̥Z  2    E! 2@] jmpA B C, c o &-2 n  ) ; ! ' (B@ ) H ;S . buf/  " ) $f2B 7B ;B uB B 4 6B  7Bm   ;@   ; Z rxsxFI; pid!UI%"sigB^# d $UT1&# | $Us% & $U $T0'IIc'PIPIp')I)I"' j? % sI0    intF +e e@ e >H Z  QaePd> l m* 7 7   O Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 S      T (L 0 8 @ H P X `B h Sp St lxI 0 E {  %w -N .U /\ 0c 2D 3SG 5O :     U S >>  ? ( @ Y A C   SVK V q>? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b S(*08idS@ SH PXP `Jhpx+pJ [ W Sǡxl Zf    "2- @u u   8{  E2o & 2 > " ) $f2S 7S ;S uS\I  5mI  u8$S9pqretSDS   (V!S C "UU"T #] #e !o { "U|"Tv#v !~ "U|## !. "U #9 u$l$$%fIfIZ$ $88S$ >$ j&  |I  ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBIM IretB  n Us! U  T0"%#IIY" je  I0 ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twyu{}L J s ~  j  b B(*08idB@ BH PXP `Jhpx+pJ [ W Bǯxl Zf    "2- @u u   8{  E2o & 2 ; " ) $f2B 7B ;B uBDIR] CI  5  u\8$B d res  p!I!  ," B #UU#T $ $ " t #Uv$( "3 #Uv"> #U1#T$ I "T #U $#_ uR %l%%%II% %88S%bb,% >% j&  IP ; int 0   F +)*J; )@ )H zQa)Pd; l m 5 e e   O0 Z-SY .G 4 /G 0G 1G j2G 3G 4G    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B;;  ? ( @ Y A C   BaV a |;? "    " t %   ((/ +0= .82!@ 6'H$ 9 P= XA2`2C=hFpIx L& P T[ `r1twyH{S}^L J s d~  j j b B(50v8idB@ BH P|XP |`Jhpx+pJ [ W BǺȞx˩l  Zq   -28 CNY q E2o & 2 ") $f2B 7B ;B uBI_ I I I^ I W I!_ o ;DIRz CJ I0EI vdd!I *e"O ` >U !F` "Us No #]z !p ; "U9"T "Q0 u o  $%III$ $2$  h$JJi  4Jp ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBDIR C@J. vdd  !U9!T !Q0 "JJJJ"  h  TJF ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uB]J)v gidBv U UU1& U T0 gJgJ! jJ ; J ; int 0   F +)oe )@ )H zQa)Pd; l mqA  @  e  e   O0 e}   ]    X Z -  .4 / 0 1j 2 3 4  #  i . , 5,B;< >   x9 B      T (L 0 8 @ H P X -`B 3h Bp Bt xI ^ l 9{ I % -N .U /\ 0c 20D 3BG 5OO : -  - 3 U BuI;_; ?_( @_Y A_ 3C 3 3 B  M;?"b b ii"it %i  (t(/ +0= .82@ 6H$ 9iP=iXA`2ChFpIx L& P T[ `r1tAwy{}L J s M~  j   b B(@0 8idB@ BH MP XP  `Jhpx+p J)  [ W BǺ4 x? l iZ M o zt2 @    b 5    E$ 2/ : o &2\ E ir ;"~ ) $f2B 7B ;B uBnJM ,GM{F! "c n#BF!- i'c" %r # $ % & '! (Uv'9, (U|(T}'C7 (U})fB (U (T0*NX +valM,- -1.rrZ.xJxJ.88S. j  J ; int 0   F +) )@ )$BH zQa)Pd; l m$b @ e e   O0 Z -^d  .R 4 /R  0R 1R j 2R 3R  4R      i . , 5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B"; ;  ?  ( @  Y A  C   Bla l ;?"  "t %  (!(/ +0= .82,@ 62H$ 9P=XA=`2CHhFpIx L& P T[ `r1twyS{^}iL J s o~  j u b B(@08idB@ BH PXP `Jhpx+pJ [ W BǺȩx˴l Z|   '!82C NYd | E2o &2 ") $f2B 7B ;B uBJp(  6pidy  U  T0!JJ" j C J  ; int 0   F +) )@ )H zQa)Pd; l m * e e   O0 Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 B      T (L 0 8 @ H P X `B h Bp Bt xI ^ l {  % -N .U /\ 0c 20D 3BG 5O :     U B ;;  ? ( @ Y A C   BVK V q;? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b B(*0k8idB@ BH PqXP q`Jhpx+p}J [ W Bǯȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2B 7B ;B uBJ)v uidGv U UU1& U T0 JJ! j Kp90    intSF +j j@ j  > >  >@   >  H _QajPd> l@ mK   7  7   OZ -  . 4 /  0 1 j 2 3  4  '-==l   = y[  a ~ > n; S j n= S  ji ., 5V,B ;V >a  x9S     T (L08 @H PX`B h  SpStqxI0 E { %| -N .U /\ 0c 2D3SG5O:   U S  >  > ? ( @ YAC S J?J e u >?" a "t %  ((/ +0= .V82 @ 6 H$ 9P=XA@ `2CK hFapIax La& Pa Ta[a `Vra1tway { } L VJ Vs  V~aa a aj a b S(0 8idS@ SH P XP  `JahapVx+VpV J  aa[ aVWa SVV5 x l ZZ  E@ J F; G 8 5Hk p 2F  @  V V E Q      E 2@ jmpA B  C  o &u21  B jR >! '7 (S@ )H R >S . buf/  7   Z   |#aAa52aU3aI/a3a385 &5 end5  5 ptr5  5 5( 50 7 8 9 :;8<4 &<4 end<4  <4 ptr<4  <4 <( <0 >k ?mem@maxAj8C &C endC  C ptrC  C C( C0: Sk TkUeV [aZ ]a a$ > Z rs U > "a ) $f2S 7S ;S uS S  4  6S  7S Z > !K5 P"Kd#Jd$setf~%sgS!SKgS~&'UU'Ts(*&*5'Us'T~(1@(>K&qV'Us'T H'Q0(va".KXp}#YKX$setZ~%s[S;&r'UU'Ts(*&j'Us(@(u&'U ='T0(a"JH# 6H!D J~% Ka)B*iMS) +N+1Na,3*jPS?-"'Uw'Ts&'Uw&8V'Uw&e 'U 2'T0(jaa"J7V#K7#YK7*how9S$set:}!K:~%s;Sn&X'UT'Ts(]*&k'U|'Ts'Qv(r@(w&V'Uv&VH'Us'T &'Q0(a.J' /set'% )%) R$res*~!*Q 0/*S1@U*i+S)":%K-&K 'Us-'U0'Q~-'Uv'Ts)z% 2(a 2 KF*#YK/setP)*sig"S(-'Uv-'Uv33KK3 3kKkKd3  h438K8K3!%3 j3$K$K3JJ3CKCK"3)I)I"3^K^K#3KK3IIc3JJ{  L-4::.4int0    F + @ $Q$b mH   QaPdm l mA  a  f  f   O Z -  .s 4 /s  0s 1s j 2s 3s  4s  $   i . , 5,B ;   x9 Q  4 4  4 4 T 4(L 40 48 4@ 4H 4P 4X `B h Qp Qt xI _ t {   % -N .U /\ 0c 2D 3QG 5O :     U Q8: m:"m  ?" ( @" Y A" C  QwQ &m?"; ; BB"Bt %B  (M(/ +0= .82X@ 6^H$ 9BP=BXAi`2CthFpIx L& P T[ `r1twy{}L J s &~  j  b Q(a08idQ@ QH &PXP `Jhpx+pJ  [ W Q x l BZΨ & H SMd2o  @    ; z  E2  o &25  BK m "W 4 $W ) $4f2Q 7Q ;Q uQQ mP+ L-Q NL.Q K/  L0 UL L1 L&o "L& &ZK!&K"&DL#&|%W &W :5'pid(~ src)Q r)QXact* ~!L0!LB " dst6Q#XT+ i=Q$T O %Uv%T~%Q}$ m %Uv%T~& %Uv%T~$ %U|%T \$( %Uv%T \$3 %Uv$>  %Uv$I  %U~$I 6 %U~$-T p %U~%T|%Qv%R0%X~%Y~$8> %Uv$BI %U~'_ $( %T \$j %U%T \%Q|'u (-L-L(LL(l(UUr(KK(dLdL(s(LLH(LLT(  h)Z HM!) @ intG 0   F +) )@ )H Qa)Pd@ l m 4 o o   O5 Z-RX .F 4 /F 0F 1F j2F 3F 4F    i. ,5,B ;   x9 G      T (L 0 8 @ H P X `B h Gp Gt xI h v {  % -N .U /\ 0c 25D 3GG 5O :     U G!@ @  ?  ( @  Y A  C   Gk` k @? "  "t %  ( (/ +0= .82+@ 61H$ 9P=XA<`2CGhFpIx L& P T[ `r1twyR{]}hL J s n~  j t b G(408idG@ GH PXP `Jhpx+pJ [ W GǹȨx˳l Z{   & 72B MXc { E2o & 2 ") $f2G 7G ;G uGMaMoMo*M< M5 RM5  N 5  M!5 M"  M#  !M$* 4 M%* 8 @o :NM}MEndo MM0 @p ?N)  ]N $M^* CM_G- N c @S M`c N @} !N0 "lMW N @ !Nb #2Mf 9y $fdf %NfF&<X 'UU1&'TT1& $ &2$"(Y'U 'T0#M[9 $fd[%ZM[& 'UU1&'TT1& $ &2$"('U 'T0#QNP) $fdP&_ 'UU1&('U 'T0#NE, $fdE*%MEc& 'UU1&'TT1&('U 'T0#cN40MC$fd4%M4$arg45!`6@ ~)$s =*;*0+ ,F-M .N/ ...&-!.&'U(d'U0@."/X`!`.]E.h{-t!.y.&.^..(S'UF'T u'Q0&j'U~'T&1('U~'T|2$"'Q1o3(}'U u'T0#M$7$$fd$2res&X!`'@ ~) *0,* *L-+0.,0d.w/6p.;.F/RX.W.b .mi.x-.-0 .\./` .&<'Uv(G'Uv&'UU1&'Tv&=R'U&&"'U k'T01'33M4dst4src5ok67pc8t9M7msk5 89M7ofsG7numG:msk5 :iG8"IH G"CM G:res G6:i G6"IHG@ 05 3N4dst4src67pc8R9M7msk5 89M7ofsG7numG7msk5 67iG89IHG9$M* 67iG69IHG;H Z  QaePd> l m* 7 7   O Z-HN .< 4 /< 0< 1< j2< 3< 4<    i. ,5,B ;   x9 S      T (L 0 8 @ H P X `B h Sp St lxI 0 E {  %w -N .U /\ 0c 2D 3SG 5O :     U S >>  ? ( @ Y A C   SVK V q>? "  "t %  ( (/ +0= .82@ 6H$ 9P=XA'`2C2hFpIx L& P T[ `r1twy={H}SL J s Y~  j _ b S(*0k8idS@ SH PqXP q`Jhpx+p}J [ W Sǡȓx˞l Zf    "2- 8CN f xE2o & 2 ") $f2S 7S ;S uSN`R {lR UU1&NN4> 6O`" ; intB 0   F +) )@ )H Qa)Pd; l m  ; ; _ j j   O0 Z -} .q4 /q 0q 1qj 2q 3q 4q  " = y#   F ; 6; B ) 6= B  ) i . , 5,B ; >   H x9 B      T (L 0 8 @ H P X `B h Bp Bt xI c q {  % -N .U /\ 0c 20D 3BG 5O :     U BO  ;H  ; ?( @Y A C  B  - = ;?"  "t %  ((/ +0= .82@ 6H$ 9P=XA `2C hFpIx L& P T[ `r1twyV {a }l L J s r ~  j  b B(_0} 8idB@ BH P XP  `Jhpx+p J  [ W BǴ x l ̵Z"   E J F G 8 5H3 p2  @V V   :  \ g x   E 2@ jmpA BV  C  o &=2   ) ; !K ' (B@ )H  [ ;SK . buf/[ f j   Z   |#A52U3I/3 385d &5d end5d  5d ptr5d  5d 5_( 5_0 7 8 9 : ;8< &< end<  < ptr<  < <_( <_0j >3 ?mem@maxA j8C &C endC  C ptrC  C C_( C_0 S}k T}kU}eV} [Z ]  ;@    ; Z r}s} J ;"V ) $f2B 7B ;B uB B 4 6B  7B I ; !=OV p"OZP#y9Z#.OZ$pid\B9!N\BT%g\B&x-'UU'T p(8&C'Us'TT'Qv(N&'Us&Y 'U h'T0(d"NEd# 6E$pidGB!NGBd(8&m'Ud( N&'Us&?Y'U K'T0(Dd)O*U'*pid*BM#N*B% ,'%,V Z+st-~!N- ,N-B$res.-Z% B&!x'U1'T1(.&Ix'U2'T0&x'U1'T0&x'U1'T2(dV .## G..OO!d. . j/.NN!M.bb ,.kKkKd% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I4: ; I .?: ; 'I@B!: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I U 4: ; I!1"B#1$1%.?<n: ; &.?<n: ;'.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I: ; I U 4: ; I% U$ > : ; I$ >   I&I : ;  : ; I8 > I: ;  ( : ;I '4: ;I?<'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I.?: ; '@B : ; I!4: ; I"1#B1$B%.?: ; 'I@B&: ; I'4: ; I( U)1*1X Y +1, 1-41.41/.: ; 'I 0: ; I1 24: ; I3.?<n: ; 4.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"1#B$1%.?<n: ; &.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!: ; I"4: ; I#1$B%1&.?<n: ; '.?<n: ;% U: ; I$ > $ >  I&I4: ; I?<  : ;  : ; I8 : ;I ' 4: ;I?<'II!I/  : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!: ; I"4: ; I#4: ; I$1%B&1'1(.?<n: ; ).?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U: ; I$ > $ > &I I 7I &  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ;   : ;!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I& ' U(4: ; I)1RUX Y *1+ U,41-41.1/B0 111213.: ; 'I 4: ; I54: ; I64: ; I7 8.?: ; 'I 49: ; I:.?<n: ; n;.?<n: ; <.?<n: ;=.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%1RUX Y &1'1(B)1*1+!I/,.?: ; 'I 4-: ; I..?<n: ; n/.?<n: ; 0.?<n% U: ; I$ > $ >  I&I  : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I 4: ; I!4: ; I" U#4: ; I$1%1&B'!I/(: ; I).: ; 'I@B* +'I,.: ; 'I@B-B1..?<n: ; /.?<n: ;0.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1RUX Y 1 1!B"1#1$.?: ;'I 4%: ;I&.?<n: ;n'.?<n: ; (.?<n% U: ; I$ > $ > &I I  : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; 4: ; I.?: ; 'I@B : ; I!4: ; I" #1$B%1&!I/'.?<n: ; (.?<n: ;).?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ;.?: ; 'I@B: ; I 4: ; I!1"B#B1$1%.: ; 'I@B&4: ; I'4: ; I( ).?<n: ;*.?<n: ; +.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I U!4: ; I"1#B$B1%1&.: ; 'I@B'4: ; I( ).?<n: ;*.?<n: ; +.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I!4: ; I" #1$B%1&.?: ; 'I@B'.: ; 'I@B(1).?<n: ; *.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( : ; I8 !I!'I"> I: ; #4: ; I$.?: ; 'I@B%: ; I&: ; I'4: ; I(4: ; I) *1+B,1-.: ; '@B.B1/.: ; 'I 0: ; I14: ; I2.?<n: ; 3.?<n4.?<n: ;% U: ; I$ > $ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$1%B&1': ; I(.?<n: ;).?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#1$B%1&1'.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B : ; I!: ; I"4: ; I#4: ; I$4: ; I%4: ; I& '1(B)1* +4: ; I,.: ; 'I@B-.?: ; '@B. U/1RUX Y 011121X Y 3.?: ; 'I@B4B15.?: ; 'I 46: ; I7.?<n: ; 8.?<n: ;9.?<n:.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I.?: ; 'I@B: ; I4: ; I 4: ; I!1"B#1$1%.?<n: ;&.?<n: ; '.?<n% U: ; I$ > $ >   I&II !I/ 4: ; I?<  : ;  : ; I8 : ;I'4: ;I?<'I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1BB1 1!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I.?: ; 'I@B : ; I!4: ; I"4: ; I#4: ; I $4: ; I% &1'B(1).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((7I  : ; ! : ; I" : ; #.?: ; 'I@B$: ; I%4: ; I&4: ; I'4: ; I(4: ; I) *1+B,1-.?<n: ; ..?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8  : ;  : ; I I !I/ : ;I'4: ;I?<'I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I> I: ;  ( !("(#.?: ; 'I@B$: ; I%4: ; I&1'1(B)B1*1+.: ; 'I ,: ; I-4: ; I. /4: ; I0.?: ;n'I 1: ;I2.1@B3144151RUX Y 617 18 941: 1;.?<n: ; <.?<n: ;n=.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I1 B!1".?<n: ; % U$ > : ; I$ >   I&I4: ;I?< 4: ; I?<  : ;  : ; I8 : ;I ''I : ;I8 : ; I!I/ <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1X Y 1 B!B1"B1#.: ; 'I $B1%.?<n: ; &.?<n: ;% U: ; I$ > $ >  I&I  : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 7I.?: ; 'I@B: ; I4: ; I4: ; I 1!B"1#!I/$.?<n: ; %.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ;  : ; I : ; .?: ; 'I@B: ; I 4: ; I!4: ; I"1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I.?: ; 'I@B : ; I!1"B#B1$4: ; I%1&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I U 1!B" #1$1%.?<n: ;&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ; % U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I4: ; I 4: ; I!1"1#B$.?<n: ; %.?<n% U$ > $ > &I: ; I  I : ;  : ; I8  : ;  : ; I I !I/ : ;I'4: ;I?<'I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 7I4: ; I .?: ; 'I@B!: ; I"4: ; I#4: ; I$1%1&B'B1(1).?<n: ; *.?<n: ;n% U$ > : ; I$ > &I 7I I  : ;  : ; I8  : ;  : ; I I!I/ > I: ; ( : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I !> I: ; "(#!$ : ; %.?: ; '@B&: ; I': ; I(4: ; I)1*B+B1,.?: ; 'I@B-4: ; I.4: ; I/ 0111X Y 213 144154161RUX Y 7 U84191:.: ; 'I ;: ; I<: ; I=4: ; I>.?: ;n'I ?: ;I@ A4: ; IB.?<n: ;C.?<n: ; D.?<n: ;nE.?<n: ; nF.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 4: ; I> I: ; ( .?: ; 'I@B: ; I 4: ; I!4: ; I"4: ; I# $1X Y %1&1'B(1)1*.?: ; n'I 4+: ; I,-.?<n: ; n..?<n: ; /.?<n% U$ > : ; I$ > I!I/   I &I  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I1 B!1".?<n: ; #.?<n: ;$.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 !I.?: ; 'I@B: ; I : ; I!4: ; I"4: ; I#4: ; I$4: ; I% &1RUX Y '1(1)B*1+1,!I/-.?: ; 'I 4.: ; I/.?<n: ; n0.?<n: ; 1.?<n% U$ > : ; I$ >   I7I&I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! U"1#B$1RUX Y %1&1'1(!I/).?: ; 'I 4*: ; I+.?<n: ; ,.?<n: ; n-.?<n% U$ > : ; I$ >   I7I&I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I!4: ; I" #1RUX Y $1%1&B'1(1).?: ; 'I 4*: ; I+.?<n: ; n,.?<n: ; -.?<n: ;..?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I &4: ; I'4: ; I( )1RUX Y *1+ U,41-41.1/B01112.: ; 'I@B3 U4 5.: ; 'I@B64: ; I7.: ; 'I 8: ; I9.?<n: ; :.?<n% U: ; I$ > $ > &I I 7I &  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( (! : ; " : ; I# : ; $4: ; I%.?: ; 'I@B&: ; I'B1(.?: ; 'I ): ; I*: ; I+4: ; I,4: ; I-!I/.: ; I/4: ; I04: ; I11RUX Y 21314B51617.?: ; 'I@B84: ; I9 :.?: ; 'I 4;.1@B<41=41>1? 1@ A41B.?<n: ; nC.?<n: ; D.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 4: ; I.?: ; 'I@B: ; I: ; I1 B!1".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I 7I.?: ; 'I@B: ; I4: ; I U 4: ; I!1RUX Y "1# U$41%41&1'B(1)1*.: ; 'I +: ; I,4: ; I-.?<n: ; ..?<n% U$ > : ; I$ > &I  I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((7I 4: ; I?!.?: ; 'I@B": ; I#4: ; I$4: ; I%1&B'1(.?<n: ; % U$ > : ; I$ > &II!I/   I  : ;  : ; I8 : ;I '4: ;I?<'I : ;I8 : ; <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ((.?: ; 'I@B : ; I!4: ; I"4: ; I#1$B%1&.?<n: ; '.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I! : ;"(# : ; $ : ; I%> I: ; &4: ; I' : ; ( : ; I).?: ;'I@B*: ;I+: ;I,4: ;I-B1.B/.?: ; 'I@B0: ; I1: ; I24: ; I31RUX Y 415 U6417418191:1;.?: ; 'I@B<4: ; I=4: ; I >4: ; I? @.: ; 'I A: ; IB4: ; IC.?<n: ; D.?<n% U$ > $ > &I: ; I  I4: ;I?<  : ;  : ; I8  : ;  : ; I I!I/ : ;I''I4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1RUX Y '1(1)B*1+1,.?: ; 'I@B-: ; I.4: ; I/4: ; I 04: ; I1 U213.: ; 'I@B4 5 U6417.: ; 'I 8: ; I9: ; I:.?: ;n'I ;: ;I<.?<n: ;n=.?<n: ; >.?<n?.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I 1 4: ; I!4: ; I"4: ; I# $1%B&.?<n: ; '.?<n: ;(.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'II!I/ 4: ; I?< : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; (  : ; I8 7I> I: ;  ( ! : ; " : ; I# I8 $.?: ; 'I@B%: ; I&4: ; I'4: ; I( U)4: ; I *4: ; I+ ,1-B.1/.?<n: ; 0.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 I !I/  : ;   : ;  : ; I: ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; !( "7I#.?: ; 'I@B$: ; I%4: ; I&4: ; I'4: ; I (4: ; I) *1+B,1-.?<n: ; ..?<n: ;n/.?<n% U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  > I: ; ( : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I!4: ; I"4: ;I#4G: ;$.?: ;'@B%: ;I&: ;I'4: ;I(1)B*1+.?: ;'I@B,: ;I-.?: ;'@B.1/.?: ;'@B04: ;I14: ;I 24: ;I3 U44: ;I5 6.?: ;'I 7: ;I84: ;I9.1@B:1;41<41= 1> ?41@.?<n: ; A.?<n: ;% U$ > : ; II!I/  : ;  : ; I8  : ;  $ >    I &I : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%4: ; I &4: ; I'4: ; I( )1RUX Y *1+ U,41-41.1/B01112.: ; 'I 3: ; I44: ; I5.?<n: ; 6.?<n% U: ; I$ > $ >  I&I &  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; I8 !I.?: ; 'I@B: ; I : ; I!4: ; I"4: ; I#4: ; I$ %4: ; I&1RUX Y '1(1)1*B+1,1-!I/. U/.?: ; 'I 40: ; I1.?<n: ; n2.?<n: ; 3.?<n: ;4.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I4: ; I 4: ; I! "1#B$1%.?<n: ; &.?<n: ;'.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I !1"B#1$.?<n: ; %.?<n: ;&.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! "1#1$B%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I1B 1!.?<n: ; ".?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I: ; I4: ; I1 1!B"1#.?<n: ; $.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B4: ; I 1!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!.?: ; 'I@B": ; I#4: ; I$1%1&B'1(.?: ; '@B)B1*.?<n: ; +.?<n: ;% U$ > $ > : ; I  I&I : ;  : ; I8 I !I/  : ;   : ;  : ; I: ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I!.?: ; 'I@B": ; I#4: ; I$4: ; I%1&1'B(1).?<n: ; *.?<n: ;n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!B1"1#: ; I$.: ; 'I@B%4: ; I&4: ; I'4: ; I( ).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I 4: ; I! U"1RUX Y #1$1%B&1'1(.?: ;'I 4): ;I*.?<n: ;n+.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I1B1 1!B".?<n: ;#.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!B1"1#: ; I$.: ; 'I@B%4: ; I&4: ; I'4: ; I( ).?<n: ; *.?<n: ;+.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!> I: ; "4: ; I#.?: ; 'I@B$: ; I%4: ; I&1'B(1).: ; 'I@B*: ; I+ ,4: ; I -4: ; I.1/.: ; '@B0.?<n: ; 1.?<n2.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I 7I.?: ; 'I@B : ; I!: ; I"4: ; I#1$B%1&1'.?<n: ; % U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I4: ; I4: ; I !1"B#1$.?<n: ; %.?<n: ;&.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!1".?<n: ; #.?<n: ;% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! "1#B$1%.?<n: ; &.?<n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; : ; I.?: ; 'I@B: ; I4: ; I 1!1"B#B1$.?<n: ; %.?<n: ; n% U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I : ; I.?: ; 'I@B: ; I4: ; I1 1!B".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 > I: ;  ( : ;I '4: ;I?<'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I 4: ; I! U"1X Y #1$ 1%41&41'1(B)1*.: ; 'I +: ; I, -4: ; I..?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I4: ; I11 B!.?<n: ;".?<n: ; % U$ > : ; I$ >   I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B1 .?<n: ;!.?<n: ; % U$ > $ > &I: ; I  I : ;  : ; I8 I !I/ ' 4: ;I?< : ; : ;I'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1'B(1) *4: ; I+4: ; I, -1..: ; 'I@B/: ; I04: ; I 1 U2.: ; '@B3.?<n: ; 4.?<n% U4: ; I?< I$ > &I$ > : ; I  : ;  : ; I8 : ;I ' 4: ;I?<'I : ;I8 : ; I!I/ <!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I  : ; .?: ; 'I@B: ; I4: ; I4: ; I 4: ; I! : ; " U# $1%B&1'1(.?<n: ; ).?<n% U$ > &I: ; I$ >   I : ;  : ; I8 : ;I ' 4: ;I?< 'I5I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I > I: ; ( ( 4: ; I  : ; !4: ;I"4: ;I#.?: ;'I@B$: ;I%: ;I&1'B(1)1RUX Y*1+ U, 1- 1U.41/ 1U0 11124: ;I3.: ; ' 4: ; I5 : ;6 74: ; I8 94: ; I:4: ;I;.?<n: ; <.?<n% U$ > $ > : ; I  I&I : ;  : ; I8 : ;I ' 4: ;I?< 'I : ;I8 : ; I!I/ <4: ; I?<!  : ;  : ; I 8  : ; I 8 : ; I 8: ; I .?: ; 'I@B: ; I1B.?<n: ;% U$ > : ; I$ > &I  I : ;  : ; I8 I !I/  : ;  : ;I'4: ;I?<'I4: ; I?<5I : ;I8 : ; <!  : ;  : ; I 8  : ; I 8 : ; I 8 : ; I8 : ; I > I: ; ( 7I!4: ; I".?: ; 'I@B#: ; I$4: ; I%4: ; I&1'B(1).: ; 'I@B*: ; I+4: ; I,4: ; I - ..?<n: ; /.?<nL /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysaccess.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h @i3?YW=YYiu /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/arpaaddrofstr.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hinet.hsocketaddr.hfail.h Pj*kSA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syschdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h jY7YYYhuL /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syschmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstat.h k8AYYYZՃgA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcst2constr.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tbl lK)ZV! ../../runtime/caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/includecaml/usr/include/x86_64-linux-gnu/syscstringv.cmlvalues.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hstdatomic.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h @m~JK#v:>XZ n(uLI=-5 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecv.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h @nwq?Y;=Y;=: /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecve.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h npY=Y;=Ye=i /usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysexecvp.cerrno.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h 0owq?Y;=Y;= o.o kY=Y;=Z>Y\8@Y| /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfsync.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h  p A>V?uYZrL /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysmkdir.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstat.h `p8AYYYZՃn /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlexit.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h `qKM /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetaddrinfo.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hnetdb.halloc.hcst2constr.hsignals.h pq<#yX%F<C0Y;Y;pXJpJt|u=-Y .YYXX;gu!nWo^z<BVv XI/sZVG?WYLJt@XtYYWY=OSAS<+"zt3'# /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysgetcwd.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h  w& ~Xt~f.~XY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgethost.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hsignals.hfail.halloc.h w.Wu$8C[GMGYrZYu˄usutX 0y$=  @y)=  Py6v.W f;misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblsignal.hunistd.hgetopt_core.hunixsupport.halloc.h { }XJ}f}X;YY1 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetnameinfo.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hnetdb.hfail.h P{$f=W|yQy<  v0YY%Z;YYsYYWY=ui/X_ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgetproto.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hfail.halloc.h |Wu$GYIKYsYYuuu X }+ >Z  ~4LY=IW /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinetgetserv.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hin.hnetdb.hfail.halloc.h P~ Wu'G0YIYYIYYsYY/us X 1ZI=-U ;Z:vKZI=-U /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescamlgmtime.cstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hstruct_tm.htime.halloc.h  ",>0 (JY;KYYH0 2JY;KYYH0 p>=WtrXr<&DxuYI=/IKsYYui%X5i /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlmmap_ba.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hbigarray.hcustom.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hroots.hmemprof.hstdlib.hcamlatomic.h /IMyyyJCy.Mc p> .-"/KHA,KK/Ku(/KH?KKw /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysputenv.cstddef.htypes.hstdint-intn.h__sigset_t.hsetjmp.hsetjmp.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstdlib.h tA;=Y]vB @; ?\tt <9 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysrename.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h pxY;=YYiA /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysrmdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h  Y7YYYhu0 /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetsocketaddr.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hstring.h rgY-YWY=ut] !A   ->  08/wXJX=YH==jt`J#t]<#XJa fuX =`8 JWwH1l)fo YYDuX(/zJP. J\z6X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/arpastrofaddr.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hin.hinet.halloc.h 03Ys V /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamltime.cstddef.htypes.htime_t.htime.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h KIY ЋKYIB /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysunlink.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h Y7YYYhu9 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/netinet/usr/include/x86_64-linux-gnu/sysaccept_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hin.hun.hsocketaddr.hsignals.hsocket.halloc.hsocket_type.h J=Wz7  vXvZ"Y\sYYuf(X - /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetbind_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h  zmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hin.hsocketaddr.hsocket.herrno.hsocket_type.h % |..|Xt|X.|XYWEtiwv YYLI=-W ЏYYLI=-W /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlclose_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h   =>V?uYZr@ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetconnect_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsignals.hsocket.h `ymisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hfcntl.h  @W\u) /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/sysenvir_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hunistd.hgetopt_core.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblauxv.halloc.h 0 P<nJ[0HF /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syserrmsg_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hmath.htime.hsys.halloc.h t0Yg 6  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetpeername_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h &zmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pKuIY6  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sys/usr/include/netinetgetsockname_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.h &zmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hsetjmp.hsetjmp.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h LVY  pKYIu /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlisatty_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KI{ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamllink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h <YW=YuOYhus>V>zvtX /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syslisten_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.h @K /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamllockf_unix.ctypes.hfcntl.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.hfcntl.herrno.h p&>xfJ ;g2ZzY!.Yu Xw)u/^fN4WYsYYYt$ /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamllseek_unix.ctypes.htypes.hstddef.hstdint-intn.hthread-shared-types.hpthreadtypes.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.h *tj:YYgYU p6tAL;YYg=IW ../../runtime/caml/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/bits/typescamlmmap_unix.cmlvalues.hstat.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hthread-shared-types.hpthreadtypes.hmisc.htime.hlibio.hstdio.hdomain_state.hdomain_state.tblfail.hbigarray.hsetjmp.h__sigset_t.hsetjmp.hplatform.hio.hsignals.hunistd.hstdatomic.hconfname.hgetopt_core.hunixsupport.hmath.hstat.hmman.herrno.h З Jv< Jw< .vf <v< tI-Ns< .tJ-KJJK;UgIK.Z]X}Jݛ[[9Y-=h9?gY!-YX-fY)b\=-=KWlX}J_TsYY_;T К VLZ`w=>Hh,/ /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlopen_unix.cfcntl2.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.halloc.hsignals.h P:U-9Y=YQvlX Y]ջntMvqJX~ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlpipe_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h МJ ȻtJ  /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlread_unix.cunistd.hstring_fortified.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hbigarray.hunistd.hgetopt_core.hunixsupport.hsignals.h P7 rX_Y4zXlYYb@Vst X )$SzJ_V7z<y<yX`xJ Yhջst Xi /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlreadlink_unix.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hsignal.hunistd.hgetopt_core.hunixsupport.halloc.hsignals.h #XYX.YY=;YYus< X /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlrealpath_unix.cstdlib.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.halloc.hstdlib.h РY(Xp<pmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.halloc.hselect2.h #/-/Wg;!Kgc>v"7/] p0<H=Guh!g'uvX t < uX u= v u 1YW=W=KK,KfuXYYɁYYYYsYYul%.wXFX /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscaml/usr/include/netinetsendrecv_unix.csocket2.hstring_fortified.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hsocket.h Х z<(Y*\b3Ygzlz<`rf X 3 v<Wp.[NY1iYafa< XsYYh'X oy73Y=O<1XOJ2YgYZ yt_y<`xX5Y=Z<XX.YYZ: Ъ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysshutdown_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.h K11 caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/types/usr/include/x86_64-linux-gnu/syssleep_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hstruct_timespec.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.herrno.h 0 0HKIfl~J~yYYXg /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssocket_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsockaddr.hsocket.hsocket.hsocket_type.h *:> h>r>=;=;]/YzJ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssocketpair_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsocket.halloc.hsocket_type.h P?9Z:r>=;=; 任u  caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/types/usr/include/x86_64-linux-gnu/sys/usr/include/netinetsockopt_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hunistd.hgetopt_core.hmath.htime.hsocket.hin.hsocketaddr.hmathcalls.hsocket.halloc.h KzJ=u^ yX zw 2SIKubtY;Ytp<# `.Q^u5YgI=kj(;Y[/9xX  ==:>/sKeK  а=;==g /usr/include/x86_64-linux-gnu/sys/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlstat_unix.cstat.htypes.htypes.htime_t.hstddef.hstdint-intn.hstruct_timespec.hthread-shared-types.hpthreadtypes.hstat.hstdint.hconfig.hmisc.hmath.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hplatform.hio.hunistd.hgetopt_core.hunixsupport.htime.hmathcalls.halloc.hcst2constr.h .u J=qJyutfyXQvHMhXJeXR}nGMgXJdXR}nGM\8\fsYY;[!u!!uJWJ\8\fgt)  X}X=7YX}.Yg<uV ` X}X=7YX}.Yg<uV \8t}<1Y<}YYV p X}X=7YX}.Ygu  X}X=7YX}.Ygu .}misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h  <YW=YYiupX p,YL /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/systimes_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hstruct_timeval.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.hstruct_rusage.halloc.hresource.hresource.h 4z|xX4ZV>YN8TdHLYd# /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamltruncate_unix.ctypes.htypes.hstddef.hstdint-intn.h__sigset_t.hthread-shared-types.hpthreadtypes.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hplatform.hio.hunistd.hgetopt_core.hunixsupport.hmath.htime.h 8AYYY[Ճ 0?KYYYiu0 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysunixsupport_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hstdatomic.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hsetjmp.hsetjmp.hplatform.hunistd.hgetopt_core.hunixsupport.hmath.htime.hfcntl.herrno.halloc.hcallback.hcst2constr.h  vt <Z_z i 0.=u/u;=5Y;YY;YYsYY@8=rX;=18   s i =- gs/YY-[W  @=- gs/YY-[W ! caml/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/caml/usr/include/x86_64-linux-gnu/sysutimes_unix.cunixsupport.hsetjmp.h__sigset_t.hsetjmp.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hstruct_timeval.hselect.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hmath.htime.hmathcalls.h #KYZKYIK=;QYYu~Xu~XyXQyX^u~X~V$ /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcamlwrite_unix.cstring_fortified.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hbigarray.hunistd.hgetopt_core.hunixsupport.hsignals.herrno.h P^;?x<9j7 >:=uy<9Y ===vYg misc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlchown.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h  Y(YYYYZuu X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlchroot.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.h Y(YYYhuu X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlclosedir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hdirent.h Y4YYYZuux.Z4n /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamldup2.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h /KMg=uXwWzX  /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysfchmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.hstat.h p;YYZ} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfchown.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hsignals.h ti;YYYZz /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlfcntl.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hfcntl.h "YY-\r `&"YY-\r 0sK  6sK B /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/sys/usr/include/x86_64-linux-gnu/bits/typescamlfork.cstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hdebugger.hunistd.hgetopt_core.hunixsupport.hmath.htime.hdomain.hsetjmp.hsetjmp.hruntime_events.h   KYuI  $"ZKZZYw.wtz s /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/types/usr/include../../runtime/camlcamlftruncate.ctypes.htypes.hstddef.hstdint-intn.h__sigset_t.hthread-shared-types.hpthreadtypes.hsetjmp.hsetjmp.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hplatform.hio.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.h ;YYZ (\8LKYYZq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetegid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h PKuIYq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgeteuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pKuIYp /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetgid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetgr.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hgrp.herrno.hfail.halloc.h Wu'G0[G[/IYYsYYuqX ,Y;YYb I=-o P<[9LY;YYiI=-F /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlgetgroups.cunistd.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.herrno.halloc.h =- ~<~.2~X<~X<~.5-=!-ZpX} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetlogin.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.halloc.h pLYY=IWq /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetppid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetpw.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hpwd.herrno.hfail.halloc.h Wu'9VYIYZHZ\F\YIYYsYYujX P2Y;YYb I=-o [9LY;YYiI=-p /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlgetuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h KuIY} /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlinitgroups.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hgrp.h 02>  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/sysitimer.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hstruct_timeval.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.hmathcalls.h :[g=eK. '"V>' p38N:YWY ="dJVD" /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/syskill.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblfail.hsetjmp.hsetjmp.hunistd.hgetopt_core.hunixsupport.hmath.htime.hsignal.hsignals.h : ?;Zq' /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysmkfifo.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hstat.h G+9\YYY[ust Xy /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlnice.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.herrno.h \8LZ:\ZIudt  /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlopendir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hsignals.hdirent.halloc.h  Y(YYYY=uq  X /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlreaddir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hdirent.hsignals.halloc.hfail.hdirent.h 0#=YYYYKS2 /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlrewinddir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hdirent.h K=YZp /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlsetgid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h K ../../runtime/caml/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/syscamlsetgroups.cmlvalues.hstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hgrp.hstdatomic.h ~JK;=Z:0YZ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/syscamlsetsid.cstddef.htypes.hstdint-intn.hstdint.hconfig.htypes.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h pLYY3E]z p /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamlsetuid.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.h K /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/bits/types/usr/include/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/syssignals.ctypes.h__sigset_t.hsigset_t.hsignal.hstddef.hstdint-intn.hstdint.hconfig.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.herrno.hsigthread.halloc.h Y;uY  'UJ=ՃYSՃ 7Ao%73=>KYZYK c1Yuۃv  pc1YYYZ T2YYKu5 /usr/include/usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/7/include../../runtime/camlcamlspawn.cerrno.htypes.htypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblmemory.hunistd.hgetopt_core.hunixsupport.hspawn.h #6xt|Z=1;=+vg;=/LB[ JxXYewYYvh-=" /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/camlcamltermios.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.htermios.htermios.halloc.h N8bXY-=<&<;KYKFOf*II?+=0/-ɝzo.+Lo28\FYuy< 0Pz<zXPzXX*t.=+K=pIK?+?up*@ .tz6JyX K K K1  K1 /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include../../runtime/camlcaml/usr/include/x86_64-linux-gnu/sysumask.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblunistd.hgetopt_core.hunixsupport.hstat.h `KIY~ /usr/lib/gcc/x86_64-linux-gnu/7/include/usr/include/x86_64-linux-gnu/bits/usr/include../../runtime/caml/usr/include/x86_64-linux-gnu/bits/typescaml/usr/include/x86_64-linux-gnu/syswait.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.htime.hmlvalues.hlibio.hstdio.hsys_errlist.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmajor_gc.haddress_class.hdomain.hsignal.hsignals.hunistd.hgetopt_core.hunixsupport.hmath.htime.halloc.hwait.h **=Ճjḥ;Y>q#=  XYYYV P[v7JuYYYdslice_targetc_stack_linkallocated_words_resumedmark_stackcaml_verb_gcdependent_size_IO_2_1_stderr_backtrace_slotmemprof_IO_save_endcaml_minor_gc_end_hook_sys_siglistextra_heap_resources_IO_write_basecaml_finalise_end_hookstderrshared_heapcaml_heap_state_IO_save_baserequested_major_slicecaml_ref_table_chain_cur_columncaml_minor_heaps_endcaml_custom_tablecaml_gc_mark_phase_requestedstat_promoted_wordscaml_leave_blocking_section__environlocal_rootstrap_barrier_offstat_forced_major_collectionscaml_unix_check_pathcaml_convert_flag_list_IO_markercaml_intern_statestat_blocks_markedcaml_finalise_begin_hookcaml_major_cycles_completedcaml_final_infomemprof_domain_scompare_unorderedcaml_minor_tablesntables_IO_FILEcaml_extern_state__timezonetrap_sp_off/home/teraram/ci/builds/workspace/parallel-build/flambda/false/label/ocaml-manycores/otherlibs/unixcaml_enter_blocking_section_hookunsigned charbacktrace_last_exncaml_custom_eltPhase_mark_finalcaml_minor_gc_begin_hookcaml__roots_path__tzname_Bool_IO_FILE_pluscaml_gc_policycaml_ephe_ref_table_IO_lock_textra_paramscv_flagsmajor_work_done_between_slicesPhase_sweep_and_mark_main_IO_read_ptryoung_startfp_offsetstdincaml_enter_blocking_section_markerssweeping_done__va_list_tagGNU C11 7.5.0 -mtune=generic -march=x86-64 -g -g -g -O2 -O2 -fexcess-precision=standard -fPIC -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fno-tree-vrp -ffunction-sections -fstack-protector-strongreserveaccess_permission_tablecaml_leave_blocking_section_hookcaml_exception_contextcaml_minor_collections_countoptindcaml_unix_accessoo_next_id_localminor_heap_wszcaml__frame_IO_2_1_stdin_caml_major_slice_begin_hookcaml_runtime_warnings_flags2dependent_allocatedcaml_fatal_error_hook_IO_read_baseslice_budgetcaml_stat_free_unused2uintptr_tcaml_timing_hookcaml_domain_stop_hookyoung_end_old_offsetexternal_raisec_stacktz_minuteswestgc_regs__stack_chk_failcaml_atfork_hooklong long intmarking_donetrap_barrier_blockcaml_ephe_infocaml__dummy_pathcaml_minor_heaps_start_IO_write_endgc_phase_tcaml_domain_external_interrupt_hookgp_offsetcaml_domain_terminated_hookfloatswept_wordscaml_stat_strdupthreshold_IO_buf_basecaml_major_slice_epochcaml__temp_resultcaml__roots_blockgc_regs_bucketscaml_major_slice_end_hook__pad2__pad3__pad4__pad5requested_external_interrupt_sbufPhase_sweep_ephecurrent_ramp_up_allocated_words_diffoverflow_arg_areanitemsallocated_wordsyoung_limitlong doublePhase_sweep_mainunique_idoptoptallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningbacktrace_bufferlong long unsigned intreg_save_areasigngam__off_tallocated_words_suspendedephe_refinside_stw_handleropterrcaml_minor_heap_max_wsz_IO_backup_base_shortbuf_IO_2_1_stdout_char_os__off64_tbacktrace_activestat_major_wordsmemprof_young_triggerrequested_minor_gc_IO_buf_endcaml_pending_signalscurrent_stackatomic_uintnatshort intrequested_global_major_sliceatomic_intnat_vtable_offsetpermsextra_params_areaexn_handler__daylight__int64_textra_heap_resources_minorcaml_domain_initialize_hookcaml_uerroryoung_ptrcaml_local_roots_ptr_IO_read_endasize_tdls_rootmlsize_tstack_infostat_minor_wordslocked_filenotz_dsttimecaml_unix_cloexec_defaultoptargshort unsigned intstdoutmajor_ref_IO_write_ptrparser_tracecaml_domain_statestack_cachecaml_ephe_ref_eltcaml_gc_phaseaccess.c__pad1__in6_u__uint8_tin_addr_taddress6__u6_addr16__u6_addr32in6addr_loopback__uint32_ts_addrcaml_unix_inet_addr_of_stringcaml_unix_alloc_inet_addraddresscaml_unix_alloc_inet6_addrin6addr_anyinet_ptonaddrofstr.ccaml_string_is_c_safe__uint16_t__u6_addr8caml_failwithcaml__dummy_dirnamechdir.ccaml_unix_chdircaml__roots_dirnamevpermcaml_unix_chmoddefltcaml_unix_cst_to_constrcst2constr.ccmdnamememory_order_acquirecaml_stat_allocheader_tcaml_unix_cstringvect_free__atomic_load_ptrmemory_order_acq_relmemory_order_consumememory_order_seq_cstmemory_order_releasecaml_unix_errormemory_order_relaxed__atomic_load_tmpcstringv.cHd_valcaml_unix_cstringvectwpathcaml_unix_execvexecv.cargvargsenvpexecve.ccaml_unix_execve_sys_nerr__errno_locationcaml_unix_execvpeprogram_invocation_nameprogram_invocation_short_name_sys_errlistgetdate_errcaml_unix_execvpexecvp.ccaml_unix_fsyncfsync.cmkdir.ccaml_unix_mkdircaml_unix_exitexit.csockaddr_in6ai_addrlensin_familyai_flagssin6_addrai_nextvaddrai_canonnamevoptss_unixs_gencaml_bad_caml_statesin6_scope_idsock_addr_unionsockaddr_insin_portsin6_port__socklen_tsa_familysin_zerocaml_alloc_smallcaml__roots_vnodeai_familyfreeaddrinfoai_socktypes_inet6sun_path__builtin___memcpy_chkcaml_unix_socket_type_tablecaml__dummy_vrescaml__dummy_vnode__chhintsconvert_addrinfosin_addrsocklen_param_typeai_addrsin6_familysockaddr_unsun_familysa_family_tvcanonnamememsetcaml_copy_stringgetaddrinfo.ccaml_string_length__src__lencaml_unix_alloc_sockaddrcaml_unix_socket_domain_table__destvservcaml_unix_getaddrinfomemcpycaml__roots_vressa_datasin6_flowinfos_inetai_protocolin_port_tretcode__getcwd_alias__jmp_buf_tagexn_bucketlongjmp_buffer__mask_was_saved__sizesigjmp_buf__buf__saved_maskgetcwd.c__jmpbuf__jmp_bufcaml_unix_getcwd__val__sigset_talloc_one_addr_16caml_unix_gethostbynamehostentcaml_alloc_initialized_stringh_namecaml_raise_not_foundgethost.ccaml_alloc_arrayh_addrtypegethostbyaddr_ralloc_one_addr_4caml_atomh_aliasesh_addr_listh_errnopgethostbyname_rcaml_copy_string_arraycaml__roots_nameaddr_typealloc_one_addrcaml__dummy_namealloc_host_entrycaml_unix_gethostbyaddrgethostname.ccaml_unix_gethostname__gethostname_alias__buflencaml__roots_vhostcaml_unix_getnameinfogetnameinfo_flag_tablegetnameinfo.ccaml__dummy_vhostcaml_unix_get_sockaddrgetproto.cprotoentcaml_unix_getprotobynamep_protocaml_unix_getprotobynumberalloc_proto_entryp_aliasesp_namealloc_service_entrys_aliasesserventgetserv.cs_portcaml_unix_getservbyportcaml_unix_getservbynames_prototm_hourtm_ydaytm_zonecaml_copy_doubleclkvalcaml_unix_gmtimealloc_tmtm_isdstcaml_unix_mktimetm_montm_mingmtime.ccaml__roots_tmvaltm_yeartm_gmtofftm_wdaycaml__dummy_tmvaltm_mday__time_ttm_seccaml_unix_localtimeclockcaml_ba_mapped_opscaml_ba_byte_sizecaml_int64_opsscanning_actionCAML_MEMPROF_NUM_SOURCE_KINDScaml_custom_major_ratiocaml_int32_opsCAML_BA_MANAGEDdimcopycustom_operationsmmap_ba.cCAML_MEMPROF_SRC_MAP_FILEcaml_ba_managedcomparecaml_ba_element_sizecaml_scan_roots_hookcaml_alloc_customcaml_unix_mapped_allocmem_wordsSCANNING_ONLY_RECENT_FRAMEScounterrefcountSCANNING_ONLY_YOUNG_VALUEScaml_nativeint_opscaml_atomic_counter_decrcompare_extcaml_ba_arrayCAML_MEMPROF_SRC_NORMALnum_dimscaml_ba_mapped_finalizecaml_ba_opsdeserializecaml_ba_proxyCAML_BA_MAPPED_FILEscanning_action_flagscaml_ba_unmap_fileasizebsize_32CAML_BA_EXTERNALCAML_MEMPROF_SRC_MARSHALcaml_memprof_sample_blockbsize_64custom_fixed_lengthhashCAML_MEMPROF_SRC_CUSTOMidentifiercaml_stat_strconcatcaml_unix_unsetenvputenv.ccaml_unix_putenvp_newnewnamerename.coldnamep_oldcaml_unix_renamecaml_unix_rmdirrmdir.cclose_on_errormladrstrnlen__builtin_memmovecaml_alloc_stringpath_lengthstruct_offsetcaml__dummy_aadr_lencaml__roots_rescaml__dummy_rescaml__roots_aalloc_unix_sockaddrsocketaddr.cstrofaddr.ccaml_unix_string_of_inet_addrinet_ntopcaml_unix_time_unboxedcaml_unix_timecaml_unix_unlinkunlink.csockaddr_atSOCK_RAWsockaddr_x25sockaddr_inarpsockaddr_ipxsockaddr_dlsockSOCK_DCCPsockaddr_isoSOCK_SEQPACKET__socket_typeSOCK_STREAMsockaddr_eoncaml_unix_acceptsockaddr_nsSOCK_NONBLOCKaccept4accept_unix.cSOCK_DGRAMSOCK_CLOEXECSOCK_PACKETSOCK_RDMsockaddr_ax25caml_unix_cloexec_pbind_unix.ccaml_unix_bind__glibc_reservedst_ctim__kindst_blksizest_blocks__pthread_list_t__gid_tst_mtim__next__data__prev__pthread_internal_listchannels_unix.c__ownercaml_unix_inchannel_of_filedescr__dev_tcaml_plat_mmap_alignmentcaml_plat_mutex__nusers__blksize_tst_uid__pthread_mutex_s__spinsst_rdev__syscall_slong_t__fxstat64__mode_t__lockso_type_lenst_gidcaml_all_opened_channelsso_typest_sizechannelcurrfstat64file_offset__blkcnt_t__ino_tcaml_ml_open_descriptor_outcaml_plat_futex_wordcaml_plat_pagesizecaml_unix_check_stream_semanticscaml_unix_outchannel_of_filedescrpthread_mutex_t__pad0__fd__fxstat__countst_nlinkst_devtimespec__listcaml_ml_open_descriptor_in__aligntv_nsec__elisionst_mode__uid_tst_ino__nlink_t__statbuftv_secst_atimclose_unix.ccaml_unix_closeconnect_unix.ccaml_unix_connectcaml_unix_dupfcntldup_unix.ccaml_unix_environment_unsafeenvir_unix.cgetauxvalcaml_unix_environmentsecure_environcaml_strerrorerrmsg_unix.ccaml_unix_code_of_unix_errorcaml_unix_error_messageerrnumcaml_unix_getpeernamegetpeername_unix.ccaml_unix_getpidgetpid_unix.cgetsockname_unix.ccaml_unix_getsocknamecaml_unix_gettimeofdaygettimeofday_unix.ccaml_unix_gettimeofday_unboxed__suseconds_ttv_usecisatty_unix.ccaml_unix_isattylinkatcaml__dummy_followcaml_unix_linkcaml__roots_followpath1path2caml_unix_listenbackloglisten_unix.cl_startl_typel_pid__pid_tfildeslockf_unix.cflockspanl_lenl_whencecaml_unix_lockflseek64caml_unix_lseekcaml_copy_int64caml_unix_lseek_64lseek_unix.cseek_command_tableofs_c_SC_LEVEL3_CACHE_SIZE_SC_MAPPED_FILES_SC_CHILD_MAX_SC_CLK_TCK_SC_SIGQUEUE_MAX_SC_THREAD_ROBUST_PRIO_INHERIT_SC_DEVICE_IO_SC_JOB_CONTROLstartpos_SC_CHAR_MAX_SC_TRACE_INHERIT_SC_MEMLOCK_RANGE_SC_PII_SOCKET_SC_CHAR_MIN_SC_SAVED_IDS_SC_ARG_MAX_SC_TIMEOUTS_SC_CHAR_BIT_SC_AIO_LISTIO_MAX_SC_MB_LEN_MAX_SC_THREAD_PRIO_PROTECT_SC_PII_INTERNET_SC_THREAD_PROCESS_SHAREDvstart_SC_TRACE_NAME_MAXpwrite_SC_PII_SC_MEMORY_PROTECTION_SC_OPEN_MAX_SC_THREAD_THREADS_MAX_SC_READER_WRITER_LOCKS_SC_STREAMS_SC_2_C_VERSION_SC_THREAD_ROBUST_PRIO_PROTECT_SC_BC_DIM_MAXCAML_BA_FORTRAN_LAYOUT_SC_THREAD_ATTR_STACKADDR_SC_V7_ILP32_OFF32_SC_V6_ILP32_OFFBIG_SC_2_PBS_LOCATE_SC_LEVEL1_DCACHE_LINESIZEmunmap_SC_TRACE_EVENT_FILTER_SC_NL_LANGMAX_SC_V6_LP64_OFF64_SC_NL_MSGMAX_SC_USER_GROUPS_SC_LEVEL1_ICACHE_ASSOC_SC_DEVICE_SPECIFIC_R_SC_NZERO_SC_XOPEN_XPG2_SC_XOPEN_XPG3_SC_XOPEN_XPG4_SC_ULONG_MAX_SC_XOPEN_ENH_I18Nmmap64_SC_INT_MIN_SC_2_UPEcaml_grow_file_SC_PAGESIZE_SC_FILE_SYSTEM_SC_2_VERSION_SC_RE_DUP_MAX_SC_LEVEL3_CACHE_ASSOC_SC_2_FORT_DEV_SC_SCHAR_MAX_SC_IOV_MAX_SC_THREAD_CPUTIME_SC_SYSTEM_DATABASEmmap_SC_PII_INTERNET_DGRAM_SC_SSIZE_MAXst_ctime_SC_FILE_LOCKING_SC_SCHAR_MINst_ctimensec_SC_INT_MAX_SC_UIO_MAXIOV__syscall_ulong_t_SC_NPROCESSORS_ONLN_SC_C_LANG_SUPPORT_R_SC_VERSION_SC_LEVEL1_DCACHE_ASSOCfile_size_SC_SPIN_LOCKS_SC_UINT_MAXCAML_BA_C_LAYOUT_SC_THREADS_SC_THREAD_SAFE_FUNCTIONS_SC_WORD_BIT_SC_REGEXPcaml_invalid_argument_SC_ASYNCHRONOUS_IO_SC_CHARCLASS_NAME_MAX_SC_XOPEN_VERSION_SC_LEVEL3_CACHE_LINESIZE_SC_THREAD_STACK_MIN_SC_2_C_DEV_SC_XOPEN_UNIX_SC_NL_TEXTMAX_SC_PII_INTERNET_STREAM_SC_GETGR_R_SIZE_MAX_SC_V7_ILP32_OFFBIG_SC_SEMAPHORES_SC_LEVEL4_CACHE_SIZE_SC_MULTI_PROCESSdata_size_SC_2_LOCALEDEF_SC_LINE_MAX_SC_PHYS_PAGES_SC_XOPEN_REALTIME_SC_MONOTONIC_CLOCKvkind_SC_RTSIG_MAX_SC_FILE_ATTRIBUTES_SC_USER_GROUPS_R_SC_XOPEN_XCU_VERSION_SC_PII_XTI_SC_XOPEN_REALTIME_THREADSmmap_unix.c_SC_LONG_BIT_SC_FIFO_SC_XBS5_ILP32_OFFBIG_SC_UCHAR_MAX_SC_PIPE_SC_TYPED_MEMORY_OBJECTS_SC_LOGIN_NAME_MAX_SC_THREAD_KEYS_MAX_SC_ADVISORY_INFO_SC_RAW_SOCKETSst_mtimensec_SC_COLL_WEIGHTS_MAX_SC_PII_OSI_M_SC_SYSTEM_DATABASE_R_SC_BC_SCALE_MAX_SC_TRACE_EVENT_NAME_MAX_SC_USHRT_MAX_SC_HOST_NAME_MAX_SC_BC_STRING_MAXvshared_SC_THREAD_PRIORITY_SCHEDULINGcaml_unix_map_filepage_SC_2_SW_DEV_SC_REALTIME_SIGNALScaml_unix_map_file_bytecodecaml_ba_layout_SC_XBS5_LPBIG_OFFBIG_SC_2_PBS_ACCOUNTINGvdim_SC_THREAD_DESTRUCTOR_ITERATIONS_SC_TRACE_LOGst_atime_SC_MEMLOCK_SC_PII_OSIpwrite64_SC_DELAYTIMER_MAX_SC_2_FORT_RUN_SC_V7_LP64_OFF64_SC_NPROCESSORS_CONF_SC_SHRT_MAX_SC_AIO_MAX_SC_BARRIERS_SC_REGEX_VERSION_SC_LEVEL2_CACHE_LINESIZE_SC_C_LANG_SUPPORT_SC_DEVICE_SPECIFIC_SC_SHARED_MEMORY_OBJECTS_SC_XBS5_LP64_OFF64major_dim_SC_LEVEL4_CACHE_ASSOC_SC_V7_LPBIG_OFFBIG_SC_NL_ARGMAXftruncate64_SC_SINGLE_PROCESS_SC_AVPHYS_PAGES_SC_XOPEN_SHMdelta_SC_THREAD_SPORADIC_SERVER_SC_SS_REPL_MAX_SC_NL_NMAX_SC_SIGNALS_SC_2_PBS_MESSAGE_SC_SEM_NSEMS_MAX_SC_T_IOV_MAX_SC_PRIORITIZED_IOargn_SC_V6_ILP32_OFF32_SC_STREAM_MAXvlayout_SC_TZNAME_MAX_SC_2_PBS_CHECKPOINT_SC_SPAWNst_mtimesysconf_SC_TRACE_SYS_MAX_SC_SYMLOOP_MAX_SC_2_CHAR_TERM_SC_SHELL_SC_FD_MGMT_SC_XOPEN_CRYPT_SC_LEVEL1_ICACHE_LINESIZE_SC_AIO_PRIO_DELTA_MAX_SC_TRACE_USER_EVENT_MAX_SC_TIMER_MAX_SC_2_PBS_SC_CPUTIME_SC_SPORADIC_SERVERmsync_SC_CLOCK_SELECTION_SC_XBS5_ILP32_OFF32_SC_NETWORKING_SC_LEVEL4_CACHE_LINESIZE_SC_ATEXIT_MAX_SC_IPV6_SC_PII_OSI_COTS_SC_MQ_PRIO_MAX_SC_SEM_VALUE_MAX_SC_TIMERS_SC_PASS_MAX_SC_FSYNC_SC_SELECT_SC_TTY_NAME_MAX_SC_POLL_SC_MESSAGE_PASSING_SC_LEVEL2_CACHE_ASSOC_SC_BC_BASE_MAX_SC_LEVEL2_CACHE_SIZE_SC_EXPR_NEST_MAX_SC_SYNCHRONIZED_IOst_atimensec_SC_PII_OSI_CLTS_SC_XOPEN_STREAMS_SC_LEVEL1_DCACHE_SIZE_SC_SHRT_MIN_SC_2_PBS_TRACK_SC_NGROUPS_MAX_SC_V6_LPBIG_OFFBIG_SC_LEVEL1_ICACHE_SIZE_SC_EQUIV_CLASS_MAX_SC_BASE_SC_PRIORITY_SCHEDULING_SC_GETPW_R_SIZE_MAX_SC_XOPEN_LEGACY_SC_THREAD_PRIO_INHERIT_SC_MQ_OPEN_MAX_SC_TRACE_SC_NL_SETMAX_SC_2_C_BINDarray_size_SC_THREAD_ATTR_STACKSIZEopen_flag_table__open_aliasopen_unix.c__path__oflagopen_cloexec_tableKEEPEXECclo_flagsopen64caml_unix_openvunitpipe2caml_unix_pipepipe_unix.c__read_aliascaml__dummy_vfdiobuf__ssize_tvofscaml__roots_vfd__read_chkcaml__dummy_bufvbufread_unix.cvlen__nbytescaml_unix_readcaml__roots_bufnumbytescaml_unix_read_bigarraycaml_unix_readlinkreadlink_unix.c__readlink_aliascaml__dummy_p__resolved__namecaml_unix_realpath__realpath_aliasrealpath_unix.ccaml__roots_pfrac_secfdlist_to_fdsetwritefds__fds_bitsmaxfdcaml__roots_lcaml_unix_select__fd_maskexceptfds__d0__d1caml__roots_readfdscaml_timeval_of_secnewresint_secmodfcaml__dummy_lcaml__dummy_readfdsexceptfdset_to_fdlistfd_setselect_unix.c__fdelt_chktimeout_secMSG_RSTMSG_WAITFORONEMSG_PEEKMSG_CTRUNCcaml_unix_recvMSG_FASTOPENMSG_WAITALLcaml__roots_adrcaml_unix_recvfromcaml__dummy_adrMSG_BATCHMSG_CMSG_CLOEXECMSG_EORMSG_OOBMSG_ZEROCOPYcaml__dummy_buffcaml_unix_sendto__flags__recv_chkMSG_SYNcaml__roots_buffargc__recvfrom_chkcaml_unix_sendto_nativeMSG_CONFIRMMSG_MOREsendrecv_unix.c__builtin___memmove_chkMSG_DONTWAIT__addrMSG_PROXYMSG_NOSIGNALMSG_FIN__addr_lenMSG_ERRQUEUEMSG_TRUNCMSG_DONTROUTEmsg_flag_tablecaml_unix_sendshutdown_unix.ccaml_unix_shutdownshutdown_command_tablenanosleepduration_seccaml_timespec_of_secsleep_unix.ccaml_unix_sleepsocket_unix.cdomaincaml_unix_socketsocketpair_unix.ccaml_unix_socketpairlevelsockopt_unix.cIPPROTO_MTPIPPROTO_ENCAPvsocketTYPE_LINGERsockopt_unix_errorIPPROTO_UDPsockopt_tablegetsockopt_fun_namecaml_unix_getsockopt_auxsockopt_lingerIPPROTO_IGMPcaml_unix_error_of_codeIPPROTO_IPIPPROTO_IPV6option_valueTYPE_INTIPPROTO_PIMIPPROTO_MPLSsockopt_boolIPPROTO_ICMPIPPROTO_UDPLITEcaml__roots_errIPPROTO_MAXIPPROTO_RAWTYPE_UNIX_ERRORoptsizeIPPROTO_RSVPIPPROTO_COMPcaml__dummy_errTYPE_BOOLsockopt_timevall_onoffIPPROTO_DCCPIPPROTO_ESPoptvalsetsockopt_fun_nameIPPROTO_TPcaml_unix_getsockoptIPPROTO_SCTPIPPROTO_PUPvoptionIPPROTO_IDPoption_typeIPPROTO_GREIPPROTO_EGPTYPE_TIMEVALcaml_unix_setsockopt_auxsockopt_intcaml_alloc_someIPPROTO_BEETPHsocket_optionl_lingerIPPROTO_IPIPIPPROTO_TCPcaml_unix_setsockoptIPPROTO_AHcaml_unix_lstatlstat64caml_unix_fstat_64__lxstatstat_timestampstat_auxcaml_unix_stat__lxstat64__xstat64caml_unix_lstat_64nextafter__xstatuse_64caml__dummy_atimecaml__roots_atimefile_kind_tablecaml_unix_stat_64caml_unix_fstatstat_unix.ccaml_unix_symlinkcaml__dummy_to_dirsymlink_unix.ccaml__roots_to_dircaml_unix_has_symlink__ru_nivcsw_wordru_nvcswru_minfltRUSAGE_SELFru_msgrcvru_nsignals__ru_majflt_wordru_stime__ru_idrss_wordru_majfltru_msgsndru_isrssru_utime__rusage_who__ru_maxrss_word__ru_minflt_wordru_nivcswgetrusage__ru_nswap_word__ru_msgsnd_word__ru_oublock_word__ru_isrss_wordru_inblock__ru_ixrss_wordru_idrssRUSAGE_CHILDREN__ru_msgrcv_wordcaml_unix_times__ru_nsignals_word__ru_inblock_wordcaml__temp_dcaml__temp_iru_maxrssru_ixrssru_oublock__ru_nvcsw_wordru_nswapcaml_unix_truncate_64caml_unix_truncatetruncate_unix.cerror_table__atomic_store_tmpcaml_unix_set_cloexeccaml_named_valuecaml_unix_clear_cloexecunixsupport_unix.ccaml_raisecmdarg__atomic_store_ptrerrcodeerrconstrcaml_unix_error_exnutimes_unix.ccaml_unix_utimeswrite_unix.cvsinglewrittencaml_unix_single_writecaml_unix_writecaml_unix_write_bigarraycaml_unix_alarmalarm.ccaml_unix_chownchroot.ccaml_unix_chrootclosedir.ccaml__dummy_vd__dirstreamcaml_unix_closedircaml__roots_vddup2.cdup3caml_unix_dup2fchmod.ccaml_unix_fchmodcaml_unix_fchownfchown.ccaml_unix_set_close_on_execcaml_unix_clear_nonblockcaml_unix_set_nonblockcaml_unix_clear_close_on_execfcntl.ccaml_debugger_fork_modecaml_runtime_events_post_forkcaml_debugger_in_usecaml_ev_lifecyclefork.ccaml_event_countEV_RING_STOPEV_RING_PAUSEEV_DOMAIN_TERMINATEEV_DOMAIN_SPAWNchild_pidEV_RING_STARTcaml_atfork_childcaml_domain_is_multicoreEV_RING_RESUMEcaml_unix_forkcaml_atfork_parentatomic_uint_fast64_tEV_FORK_PARENTEV_FORK_CHILDcaml_debugger_cleanup_forkftruncate.ccaml_unix_ftruncatecaml_unix_ftruncate_64getegid.ccaml_unix_getegidcaml_unix_geteuidgeteuid.ccaml_unix_getgidgetgid.cgr_namealloc_group_entrygroupcaml_unix_getgrnamgr_memgr_passwdcaml_unix_getgrgidgetgr.cgr_gidpassgidset__getgroups_aliascaml_stat_resizegetgroups.ccaml_alloc_tuplecaml_unix_getgroupsngroups_maxcaml_unix_getlogingetlogin.ccaml_unix_getppidgetppid.cpw_gidpw_shellalloc_passwd_entrycaml_unix_getpwuidcaml_unix_getpwnampw_passwdpw_uidpw_dirpw_gecospw_namegetpw.ccaml_unix_getuidgetuid.cinitgroups.cusercaml_unix_initgroupsit_interval__itimer_whichITIMER_VIRTUALcaml_unix_getitimeritimersitimerval__builtin_ceilcaml_unix_set_timevalitimer.cnewvalITIMER_PROFcaml_unix_setitimercaml_unix_convert_itimerITIMER_REALit_valuecaml_convert_signal_numberkill.ccaml_process_pending_actionscaml_unix_killsignalcaml_unix_mkfifovmodemkfifo.cnice.cincrcaml_unix_niceopendir.ccaml_unix_opendird_reclend_namecaml_unix_readdird_offreaddir.creaddir64direntd_inod_typedirectory_entrycaml_raise_end_of_file__ino64_trewinddir.ccaml_unix_rewinddirsetgid.ccaml_unix_setgidcaml_unix_setgroupssetgroups.csetsid.ccaml_unix_setsidcaml_unix_setuidsetuid.csigemptysetsigscaml_unix_sigpendingcaml_unix_sigprocmaskencode_sigsetdecode_sigsetsignals.csigaddsetcaml_unix_sigsuspendpthread_sigmasksignovsetcaml_alloc_2caml_rev_convert_signal_numberoldsetnewconsvactionsigismembercaml_unix_sigwaitsigprocmask_cmdposix_spawn_file_actions_initoptenv__actionsusepath__allocatedcaml_unix_spawnexecutableposix_spawn_file_actions_adddup2__used__spawn_actionposix_spawn_file_actions_destroyspawn.credirectposix_spawnposix_spawn_file_actions_addcloseposix_spawnpdontclose__padposix_spawn_file_actions_tcfsetospeedc_linecaml_unix_tcflushc_ispeedtermioscaml_unix_tcflowbaudtermios.cc_oflagqueuecfgetospeedqueue_flag_tableCharspeedtablesrc_pc_lflagcaml_unix_tcgetattrspeed_twhentcflag_tcc_tOutputc_iflagc_ospeeddst_pSpeedInputc_ccdelaydecode_terminal_statusc_cflagwhen_flag_tablecfsetispeedEnumterminal_io_descrcaml_unix_tcdraincaml_unix_tcsetattrcfgetispeedcaml_unix_tcsendbreakencode_terminal_statusaction_flag_tablecaml_unix_umaskumask.ccaml_unix_waitcaml__dummy_stcaml__roots_stcaml_unix_waitpidalloc_process_statuspid_reqwait.cwait_flag_table@iuiU@iuiTi,jv1jGjvi.j\1jGj\iiPi+jS1jGjSiiPi0j]1jGj]iiPii] j1j1BjGj1PjmjUmjjSjjUjjSj!kU8kkvkkvMkk\kk\ukykPykkSkkSkkPkk]kk]kk1kk1klUklT2ll|ll|Hll]ll]yl}lP}llVllVllPllSllSbllSllT1&ll1ll1llQl&mQ&m6mQll0lmPm%mP&m6m0n nU n6nV6n:nU:n;nUnn0n-nS@mgmUgmmVmmSmmUmmUmmUmmV@mgmTgmm^mmTmmTmmTmm^mmPmm^mmPmmPPmm]mm]Pmgm0gmsmPsmm\mmPmm0mm\mm0mm0@mLmU@mLmux@nUnUUnnS@nNnTNnknVknnTvn}nP}nn\knonPonnVnnUn#oSnnTnn\n#oTnnQnnVn#oQnnPn#o\nnPn#oVnnPn#o]ooUopSooToo\opTooQooVopQooPop\ooPopVooPop]0oEoUEooS0o>oT>o[oV[ooT[o_oP_ooVfomoPmoo\ p+pU+pUpU6p:pP:pFpSGpUpS$p+pu1&+pUpU1&`ppU`ppTpAq|DqZq|pCq]DqZq]ppPp?qVDqZqV qqPq>qSDqZqSp qS qZqT1&qDq1UqZq1`qgqUgqlqUpqqUpqqTpqqQqrsrts%ttsttstv{#vvsvv{#qrVrtV%ttVttVtv{vvVvv{Ert0%tw0rt0%tw0rs]%tt]vv]vvP st\%tt\tt\vvPssPst^tt^rr1st]tu]uvSvvSst]tu]uevSvvSuvvvvvuev]uv0vv0uuYuu^uu ~ uuTuu\Yvevtt| s/s0 s/s0 s/s| w3wU3wwUFwKw FwKwS@zczUczwzSwzzUwz{zP{zzSzzSzzSzzPzzVzzVzzVPyuyUuyySyzUz$zS$z3zUyyS)z.zSqyy2y z\z.z:.z3z\qyy4y zVz.z@.z3zVyyPy zS.z3zSwwUwxSxxUx"ySwxvxyvy"yvwx\xy\y"y\=xy0y"y0wx{xUxxPy!yPxxPy!yP@yHyUHyLyTLyMyU0y8yU8yY0YQQ6p0ۘ0kp0Xxx(,X(,xx~Q~;F~FOQOP~w;Pw_p{_wp{wәPPUPTPQss˜s^^˜^0˜0P\\˜\!PPpP59P9]˜]LVLQ1&V˜Q1&^ v $ &1$#Ɯ˜ v $ &1$#:L\:L]МUPUМTPT=PKOPUTQR͞ssٞ__400=^Q1&^=]R1&]=\\=SVSU1&U1&^xv1$#xPPv1$#BS]BK|~"KOTOS|~"BSVPUU\U\U\x\PTPQV\Q\sVsxQPRS\R\eSexRY~ex~W]WY~ex]ڝ\0ex0ڝs@<$-(\R1&@<$-(exR1&@<$-(RSexS+Hs1$#H\PswPwxs1$#ߝs@<$-( $ &ߝ_ߝ|1&+S+_v1&u"& Q1&u"&*UUsˠs]ˠ]80ˠ0bVˠVJNPN\ˠ\PƠʠPOb Ob^Ob\РU ss\\K00rvPv]PP]w]PP]Pb0P[~UTQRʥ{vʥvB_ʥ_ФaSyP\{ {p"PSʥS^PPxPPĤФaѤؤapUSSpT\T\~~֢__SV kSkuVV # s $ &#uVSkPu~~ԡUԡ]١TQHVHSQS_V_fQ١P]Sc]SHSSYS s $ & s $ &UH s $ &ЪUUЪܪTܪTUVUVTE]ETQ9^9QR%S%+R+RXXlSS(OPO\\+6R6lSlR1&@<$R1&@<$,(6PS69~1&}"9B Q1&}"BOTOP Q1&T"6PWTUT4]4UŨ]ŨبUTTTQTPVPQӨVӨبQTRT{S{RŨSŨبRTXT_ߧUߧXŨ_ŨبXa|Ũب|n^Ũب^0Ũب0ۧ0Ũب04]Ũب]P{Ũب{ s@<$-( R1&@<$-(ŨبR1&@<$-(PӨרPPӨרP{0P04{4_4{ s@<$-( $ & 4R1&@<$-( $ & { 4S4}1&M^]M^SMPv1&u"PY Q1&u"Y]UХU\U\UХTХQVQ V QХR:S:RSRХXj^jX^X!-]]b00\\jnPn^^js@<$-(R1&@<$-(R1&@<$-(Ħ|1$#P P|1$#o^os@<$-( $ &R1&@<$-( $ &o{So|1&Ħ\ĦSv1&u" Q1&u"æUکUک\UŪ\ҩTҩ^TŪ^Q:V:ŪQR)S),R,ŪRXŪXYŪ{{SŪS P ]Ū],7R7{S{ŪR1&@<$R1&@<$,(7WS7L{LWV\QRX{U)UT)T0ZUZիU>^a}VPV«ЫVT^a_eaUHUTSHTQHQR9\9:R:H\)6P:GP7V:HVPUUPTSTPVQVQPR\R\PP~VVаUUаְTְXTаQQаRYRܰTU1&Q$Q1& $ &3$t 3$`-!""'Q1& $ &3$U1& 3$`-!""UǰUTưXưǰTQǰQưPưǰU1&°Q°ư$Q1& $ &3$p 3$`-!""ưǰ'Q1& $ &3$U1& 3$`-!""`UVUpUpuVuUV`TTpTpuTuxTxT`lQl\Q\`RQRpQpuRuzQzRR`XSXpSpuXuSX`YY#Y#5Y5pYpuYuYYX545p8yaPUPw̮~̮YwPTPŮ\Ů̮T̮Y\PQPǮ]Ǯ̮Q̮Y]PRPˮ_ˮ̮R̮Y_PXPîVî̮X̮YVj®s̮Ysɮ^̮Y^̮PP&+P?DPTXP̮PTXPU̹S̹U̹V̹s1&Uոmvtvo\t\PlStSJtPP*]*SpUŷ]vdzvڷ_\dz\P\SdzS:dPuyP]SٶUٶdUڶV`Unvuvʵp\u\PmSuSKuPP ] SNUev%Qvz \%Q\PS%QS%P6:P]SBUB]U ] UBTBSTSSvv\\~ Psijssijsbijbs0))eAijs0))eAaijaųʳaIssIss5Ibb5Is0))eAs0))eA=Iaa aWsʳԳsWsʳԳswbʳԳbws0))eAʳԳs0))eAaʳԳapUU ZU ZT ZQg:sMcss?]Mc]B0Mc0P=\Mc\P;VMcVPA^Mc^B1^c1UUػܻPܻSPSݻ~0)).Av0)"8~0)).A~0)"=w~0)).Av0)"w~0)).A~0)"UTss\\GKPKVVZ^P^]]5Z]m11UT||]]IMPMVV[_P_SS2[S[T1&m11@YUYxSx|U|S@QTQyVy|T|V@SQS{\{|Q|\ZbP U (S(,U,7ST)V),T,7VQ+\+,Q,7\ PUSUSTVTVUSTV0bUbq\0bTbq]0bQbݿVݿ1Q1`V`eQeqVxpQpؿq1<q0PпؿPؿ1S1<P<CSCQPQeSepPpqSEQ P7!EOP U U'UǾUǾ׾S׾UϾPSUTQvOv\O\f]49]swPwS9OSP]9O]>faaKfcc9w19>1aaawaU\U\TQ']'Q]QR S RSRvvv^^^ 00 '}1&'7]7Q1&}1&Q1& $R$R1&RR1&$r@<$-($mR1&@<$-(R1&@<$-( [0[mS0S*BS*7{7B])U)T)Q)R)X6B}Ut}glPl<w<G~UtwG0Ut0D^Ut^F_Ut_0SU\0atSPP@\Ut\>V>GU1&UtVPU\U\UPTPQ_Q_QPR^R^Rpr {#r {#Pr{{00__^ ^^0rS0S~@<$-(m~@<$-(~@<$-(]Sr]]2=]25t"5<T2=VUU&U&T&VTVT&Q&\Q\3ss?^^s00P]]PVV11.U;ssG\\{00PVVP]]11,U9ssEVVm00u\\11UU'U'aUTaTQQ'Q'aQpUUpTVTVPSSU UTVT VQ\Q \PS SUUUU`rUrUwP"U"YU'/P %U%U3oSpSUTUUFUTFT"&P&6S8FS7V8FVUUTVTVPSSPXUXeUpxUxUUUP`U`UrPPPU8S8>U>NS#P(=P>MPUVUVss\\N00PPPPUcU0VPEVHcVPQG\GHP00PVSpxUxUyPPUUUUPP PP]U]SUSxPPPU1S15U5BS2v=Bv4\=B\50=B05P=AP5P=APU%U0@U@cVcdUdV0@T@HSHdTdxSxTUvUpUUpT\TUlSlmU#Js0)).As0)"Jks0)).As0)"USUSa)aUUTTPUTss ]]N00`dPd\\quPuVVNqVqT1&T1&11UUPP NU[s #sg\ #\0 #0P] #]P"PPV #VP"P0=U=]U]kUkuU4IS]pSIMPMXSX\umpuSUUUUUUUUSfU PW]Xf]U\Xf\>BPBRSXfS 0uxpxUxUyPPUUUvU,0P0`SavSpUUPSSUjUTVejV)0)W1ej1!P!'s')SUUPTPWQWTM\U1& $ &2$P"\mqPqSS SUSVUVi||]]1SSP~USTVTPU\~\~\~TVTVTQSQSQR~X^ S ~^~P~~P~\~\~\~^^^T\PP_07P7_PP_0 ] $}$1P8]P]X\}\iPi}P} 4U4YU #T#YTUUTTUUUUTT07U7}U0eTeWwWb~b}w0iQi]}Qs] }x ]bj]s_bj_s ssSssXbosows wXSsSs$V$7XSjV TS\TfjTPYScYfjP0PSd0dfPfj00pupPfj0TT$7TR s xx$*R*0r 07xxoTosxhsU{Rr s xx~psPU'UBGPGI\I^P^"&P&'^EV~V"'VEGPG\|x\\"'\EI IdsdkskSssSss s DXDLSLTsT\S\fsf_XS_"'Sd|Q q"ssxQ!P!LYY LTT Rs #sp#Lxxxx #0#=PPfQQf0P0 P0qtqQt`gUgxUPwUwUP\T\_S_TPSSz~P~VVUDU P 0S1DSUwSwUT=VVVVTz|||]]IPPZPP@iGjrjjjjPjjjkkllm0m6ml6mPmmmmmmmm@mmn;n@nnn#o0ooop pUp`pZq`qlqsss/ss tuvs tu"v)vYv^vevvvuu(u+uuupqw!w&w-w3wFwKw wwwzzzzw"y0y=y@yMyPy3z@zz{{ {{ {%{{M{P{||}}~ ~B~P~z ophp@@ T|# -0|*0ɋЋՌ ɎΎtЏ U`00OPmp ip;@lpkpɗ;Pp{ЗʚКJP˜МPĝ#&+BGKSPx).ObwzˠP\_bР¡ġơˡѡԡա١١HY^ߡ>Y^uĤfpʥĦ4PVY^9>BP:?DWХبŪЪ)T«ЫTmq0իHPįׯY`ǰаCGaenvг I NRWгճ', w| AK\c¶ݶ-:KR*=J[b¹Ź̹Q`dpz cpݻ8=Vgwɿпӿֿ'0q7@  %*9O'/5=)0*/2BPtap Y` FPepNP 8cpBP%0mpv #0u .fp+0 jpv*8EP =`sz|hjsz(XjszXj (@h@X'0} Y`xDP0*>ABF Z Z Ph `h x8,!,!,!-!x/!0!6!@7!   `h h! h7@7!F,!m 0iy,!$-7 wH 0y Y @y kyP | P~*  h 7!@ )2:G [gp~ 1ESan{P <@<  p</? N^ u`-!( -!(,!( P02> G WfvP7!(19 2KWblt  s ] )2;E FS aP qy   Up6!"-!+x>@7!J0!` q k E     @  I,  Х@;  S p  ,      *  }@  Y u       p   p  .  YM  h^  P^q  @i     {M   `p  }  )  'F [  @mq  К        $ @7!+  ;: J W p       M d-C\ lVt p}  j" @G:N pe P(t  5`  o' 9 `q H^v @, o pY . wg? n;Z 0o]k | H7! Py `.-A#Tk 7 p(  , (.BX P{g З  ` а8 @D " 0M6Phx  0A { H/H^k ЏB  0V  V(:N ]p p! P Z *A p-W p5n 0 p- p P{';Q_ Cq  `I  P' pq=O a ^t @n] ~"   _ I4HX7!M Pbx H }(  М 7. GD]y   )+ p5;R@7!^p D  - .AUi~ A @ f 9 `A(?Tk Р~ Ћ ^ Ъ#:N_t  n  0L2  C \  k  _  9  )  F   `  ! Pj#! 9!Q! c! s! @z! !! P9!! !!" )"B"W"l" "" " " 0" M" 0E#P# 6# PF#V# k### pH# ##$1$ 0N$ a$y$ $$$$$ )$ p$  % F "%">%P% ZV% ph%%%  %% B%% P^& 9&,&crtstuff.cderegister_tm_clones__do_global_dtors_auxcompleted.7698__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entryaccess.caccess_permission_tableaddrofstr.cchdir.ccst2constr.ccstringv.cexecv.cexecve.cexecvp.cfsync.cmkdir.cexit.cgetaddrinfo.cgetcwd.cgethost.calloc_host_entryalloc_one_addr_4alloc_one_addr_16gethostname.cgetnameinfo.cgetnameinfo_flag_tablegetproto.calloc_proto_entrygetserv.calloc_service_entrygmtime.calloc_tmmmap_ba.ccaml_ba_mapped_finalizecaml_ba_mapped_opsputenv.crename.crmdir.csocketaddr.calloc_unix_sockaddrstrofaddr.cunlink.caccept_unix.cbind_unix.cchannels_unix.ccaml_unix_check_stream_semanticsclose_unix.cconnect_unix.cdup_unix.cenvir_unix.cerrmsg_unix.cgetpeername_unix.cgetpid_unix.cgetsockname_unix.cgettimeofday_unix.cisatty_unix.clisten_unix.clockf_unix.clseek_unix.cseek_command_tablemmap_unix.copen_unix.copen_flag_tableopen_cloexec_tablepipe_unix.cread_unix.creadlink_unix.crealpath_unix.cselect_unix.cfdlist_to_fdsetfdset_to_fdlistsendrecv_unix.cmsg_flag_tableshutdown_unix.cshutdown_command_tablesleep_unix.csocket_unix.csocketpair_unix.csockopt_unix.csockopt_tablegetsockopt_fun_namesetsockopt_fun_namesockopt_boolsockopt_intsockopt_lingersockopt_timevalsockopt_unix_errorstat_unix.cstat_auxfile_kind_tablesymlink_unix.ctruncate_unix.cunixsupport_unix.cerror_tablecaml_unix_error_exnutimes_unix.cwrite_unix.calarm.cchroot.cclosedir.cdup2.cfchmod.cfchown.cfcntl.cfork.cftruncate.cgetegid.cgeteuid.cgetgid.cgetgr.calloc_group_entrygetgroups.cgetlogin.cgetppid.cgetpw.calloc_passwd_entrygetuid.cinitgroups.citimer.ccaml_unix_set_timevalcaml_unix_convert_itimeritimerskill.cmkfifo.cnice.copendir.creaddir.crewinddir.csetgid.csetgroups.csetsid.csetuid.csignals.cdecode_sigsetencode_sigsetsigprocmask_cmdspawn.ctermios.cterminal_io_descrspeedtablewhen_flag_tablequeue_flag_tableaction_flag_tableumask.cwait.calloc_process_statuswait_flag_table__FRAME_END____dso_handle_DYNAMIC__GNU_EH_FRAME_HDR__TMC_END___GLOBAL_OFFSET_TABLE_caml_unix_getuidinet_ntop@@GLIBC_2.2.5caml_unix_chmodcaml_unix_getservbyportcaml_named_valuecaml_unix_unlinkcaml_unix_recvfromcaml_unix_timesfree@@GLIBC_2.2.5caml_unix_dupcaml_unix_set_nonblockcaml_unix_recvcaml_unix_sendto_nativepthread_sigmask@@GLIBC_2.2.5caml_unix_tcsendbreakcaml_runtime_events_post_forkcaml_ev_lifecycleposix_spawn_file_actions_init@@GLIBC_2.2.5localtime@@GLIBC_2.2.5__errno_location@@GLIBC_2.2.5unlink@@GLIBC_2.2.5caml_unix_getpeernamecaml_unix_write_bigarray_ITM_deregisterTMCloneTablecaml_atfork_parentcaml_convert_flag_list_exit@@GLIBC_2.2.5chroot@@GLIBC_2.2.5caml_domain_is_multicorecaml_unix_stat_64caml_unix_setitimer__read_chk@@GLIBC_2.4mkdir@@GLIBC_2.2.5caml_unix_gettimeofday_unboxedcaml_unix_socketcaml_unix_getgrgidcaml_unix_accessisatty@@GLIBC_2.2.5caml_alloc_tuplecaml_unix_alloc_inet6_addrcaml_unix_gethostnamesetsockopt@@GLIBC_2.2.5caml_unix_mkdircaml_unix_getsocknamecaml_unix_closedircaml_unix_code_of_unix_errortcdrain@@GLIBC_2.2.5caml_unix_cstringvectcaml_unix_map_file_bytecodecaml_atomreadlink@@GLIBC_2.2.5fcntl@@GLIBC_2.2.5write@@GLIBC_2.2.5getpid@@GLIBC_2.2.5cfgetispeed@@GLIBC_2.2.5caml_pending_signalscaml_stat_free_edatacaml_unix_killdup3@@GLIBC_2.9caml_alloc_2getpeername@@GLIBC_2.2.5caml_stat_resizecaml_alloc_initialized_stringposix_spawn_file_actions_destroy@@GLIBC_2.2.5__xstat64@@GLIBC_2.2.5opendir@@GLIBC_2.2.5getpwuid@@GLIBC_2.2.5caml_unix_nicecaml_unix_waitshutdown@@GLIBC_2.2.5cfsetospeed@@GLIBC_2.2.5caml_unix_cst_to_constrmsync@@GLIBC_2.2.5gethostbyname_r@@GLIBC_2.2.5caml_unix_sigsuspendrmdir@@GLIBC_2.2.5_finicaml_atfork_hookcaml_unix_chdirchdir@@GLIBC_2.2.5__stack_chk_fail@@GLIBC_2.4caml_unix_clear_cloexecgetuid@@GLIBC_2.2.5caml_unix_gettimeofdaycaml_unix_readcaml_unix_renamecaml_unix_closeaccept4@@GLIBC_2.10send@@GLIBC_2.2.5caml_string_lengthexecvpe@@GLIBC_2.11caml_unix_socket_domain_tabletcflush@@GLIBC_2.2.5caml_unix_execvpecaml_unix_sigwaitcaml_unix_exitgetgrgid@@GLIBC_2.2.5__fdelt_chk@@GLIBC_2.15symlink@@GLIBC_2.2.5modf@@GLIBC_2.2.5nanosleep@@GLIBC_2.2.5caml_unix_listencaml_unix_spawncaml_unix_lseek_64gettimeofday@@GLIBC_2.2.5caml_unix_getgidgetservbyname@@GLIBC_2.2.5caml_unix_getcwdcaml_unix_cstringvect_freecaml_unix_execvpcaml_unix_putenvgeteuid@@GLIBC_2.2.5caml_unix_time_unboxedcaml_unix_cloexec_defaultcaml_alloc_smallcaml_unix_gethostbyaddrcaml_unix_setsockopt_auxstrnlen@@GLIBC_2.2.5getcwd@@GLIBC_2.2.5sendto@@GLIBC_2.2.5alarm@@GLIBC_2.2.5rewinddir@@GLIBC_2.2.5setgroups@@GLIBC_2.2.5caml_unix_getsockoptcaml_memprof_sample_blockcaml_unix_setsidcaml_unix_bindcaml_unix_check_pathnextafter@@GLIBC_2.2.5getnameinfo@@GLIBC_2.2.5caml_unix_read_bigarraysetsid@@GLIBC_2.2.5closedir@@GLIBC_2.2.5caml_unix_opencaml_convert_signal_numbercaml_unix_map_filecaml_unix_selectcaml_unix_umaskcaml_process_pending_actionscaml_unix_setsockoptread@@GLIBC_2.2.5caml_unix_unsetenvcaml_raise_not_foundcaml_unix_tcsetattr__tls_get_addr@@GLIBC_2.3getsockopt@@GLIBC_2.2.5caml_alloc_somecaml_debugger_cleanup_forkcaml_unix_getgroupsexecve@@GLIBC_2.2.5utimes@@GLIBC_2.2.5caml_unix_errorcaml_unix_lseekputenv@@GLIBC_2.2.5caml_unix_ftruncate__fxstat64@@GLIBC_2.2.5tcsendbreak@@GLIBC_2.2.5getpwnam@@GLIBC_2.2.5caml_ba_hashcaml_unix_outchannel_of_filedescrcaml_unix_linkcaml_unix_initgroups__memmove_chk@@GLIBC_2.3.4__memcpy_chk@@GLIBC_2.3.4sigemptyset@@GLIBC_2.2.5caml_unix_utimescaml_unix_error_messagecaml_ba_byte_sizemkfifo@@GLIBC_2.2.5__gmon_start__umask@@GLIBC_2.2.5caml_unix_getpidcaml_unix_waitpidcaml_leave_blocking_sectionrealpath@@GLIBC_2.3caml_ba_unmap_filesocketpair@@GLIBC_2.2.5getgrnam@@GLIBC_2.2.5caml_unix_chown__recv_chk@@GLIBC_2.4inet_pton@@GLIBC_2.2.5caml_unix_has_symlinkcaml_unix_mapped_allockill@@GLIBC_2.2.5caml_unix_sleepcaml_unix_getlogingetprotobynumber@@GLIBC_2.2.5caml_copy_int64caml_ml_open_descriptor_outgetgid@@GLIBC_2.2.5caml_unix_lockfcaml_unix_getnameinfoselect@@GLIBC_2.2.5pwrite64@@GLIBC_2.2.5caml_strerrorcaml_unix_symlinkgetgroups@@GLIBC_2.2.5caml_unix_readlinkmmap64@@GLIBC_2.2.5caml_copy_string_arraycaml_unix_clear_nonblockcaml_unix_set_close_on_exec__recvfrom_chk@@GLIBC_2.4caml_unix_getegidcaml_unix_getaddrinfonice@@GLIBC_2.2.5caml_atfork_childcaml_unix_getpwuidcaml_unix_execvcaml_unix_getprotobynumbercaml_unix_fstat_64caml_unix_sigprocmaskcaml_copy_doublecaml_unix_gmtimecaml_invalid_argumentcaml_ml_open_descriptor_incaml_unix_getsockopt_auxlisten@@GLIBC_2.2.5_endcaml_unix_socketpairgetlogin@@GLIBC_2.2.5caml_unix_single_writecaml_unix_getprotobynamegetegid@@GLIBC_2.2.5caml_unix_clear_close_on_execcaml_unix_pipemktime@@GLIBC_2.2.5caml_enter_blocking_sectioncaml_unix_tcgetattrcaml_unix_set_cloexecposix_spawnp@@GLIBC_2.15getprotobyname@@GLIBC_2.2.5sigsuspend@@GLIBC_2.2.5caml_debugger_in_usecaml_ba_deserializecaml_unix_forkcaml_unix_setgroupscaml_unix_tcdraincaml_raisecaml_rev_convert_signal_numbercaml_ba_serializecaml_unix_fsyncsetitimer@@GLIBC_2.2.5__bss_startlinkat@@GLIBC_2.4munmap@@GLIBC_2.2.5getauxval@@GLIBC_2.16caml_unix_getservbynameftruncate64@@GLIBC_2.2.5cfgetospeed@@GLIBC_2.2.5fchmod@@GLIBC_2.2.5caml_unix_rmdircaml_unix_lstat_64bind@@GLIBC_2.2.5caml_unix_rewinddiropen64@@GLIBC_2.2.5caml_stat_strconcatmemmove@@GLIBC_2.2.5readdir64@@GLIBC_2.2.5caml_unix_statfsync@@GLIBC_2.2.5caml_unix_acceptcaml_unix_getitimersetgid@@GLIBC_2.2.5caml_unix_shutdownwaitpid@@GLIBC_2.2.5caml_unix_lstattcgetattr@@GLIBC_2.2.5caml_ba_element_sizetcsetattr@@GLIBC_2.2.5caml_unix_realpathaccess@@GLIBC_2.2.5fchown@@GLIBC_2.2.5caml_unix_timecaml_unix_getgrnamcaml_bad_caml_statecfsetispeed@@GLIBC_2.2.5gethostbyaddr_r@@GLIBC_2.2.5caml_unix_sendtogetrusage@@GLIBC_2.2.5tcflow@@GLIBC_2.2.5caml_copy_stringsysconf@@GLIBC_2.2.5getitimer@@GLIBC_2.2.5posix_spawn@@GLIBC_2.15caml_alloc_arrayrename@@GLIBC_2.2.5sigpending@@GLIBC_2.2.5gmtime@@GLIBC_2.2.5unsetenv@@GLIBC_2.2.5caml_unix_execvecaml_unix_get_sockaddrcaml_unix_isattygetsockname@@GLIBC_2.2.5caml_unix_dup2caml_unix_localtimecaml_unix_tcflowcaml_unix_setgidcaml_unix_ftruncate_64execvp@@GLIBC_2.2.5caml_unix_connectsigwait@@GLIBC_2.2.5caml_alloc_stringcaml_unix_inet_addr_of_stringcaml_unix_truncate_64__lxstat64@@GLIBC_2.2.5caml_unix_opendircaml_unix_fstatcaml_unix_gethostbynamecaml_unix_chrootgethostname@@GLIBC_2.2.5caml_unix_environmentcaml_stat_alloccaml_unix_sendpipe2@@GLIBC_2.9__environ@@GLIBC_2.2.5caml_raise_end_of_filesigismember@@GLIBC_2.2.5getppid@@GLIBC_2.2.5connect@@GLIBC_2.2.5caml_unix_cloexec_plseek64@@GLIBC_2.2.5caml_unix_mkfifo_ITM_registerTMCloneTablecaml_unix_string_of_inet_addrcaml_unix_fchowncaml_unix_readdircaml_unix_socket_type_tablecaml_unix_alloc_sockaddrcaml_unix_writecaml_ba_comparecaml_unix_sigpendingsetuid@@GLIBC_2.2.5posix_spawn_file_actions_addclose@@GLIBC_2.2.5caml_unix_fchmodcaml_unix_alarmposix_spawn_file_actions_adddup2@@GLIBC_2.2.5getservbyport@@GLIBC_2.2.5getaddrinfo@@GLIBC_2.2.5caml_unix_environment_unsafecaml_unix_truncatecaml_debugger_fork_modecaml_uerrorcaml_stat_strdupinitgroups@@GLIBC_2.2.5ceil@@GLIBC_2.2.5caml_string_is_c_safecaml_unix_setuidcaml_unix_mktimecaml_unix_getppidcaml_unix_error_of_code__cxa_finalize@@GLIBC_2.2.5caml_alloc_custom_initcaml_unix_geteuidsigaddset@@GLIBC_2.2.5execv@@GLIBC_2.2.5caml_unix_alloc_inet_addrfork@@GLIBC_2.2.5caml_unix_inchannel_of_filedescrcaml_failwithcaml_unix_getpwnamcaml_unix_tcflushfreeaddrinfo@@GLIBC_2.2.5socket@@GLIBC_2.2.5.symtab.strtab.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment.debug_aranges.debug_info.debug_abbrev.debug_line.debug_str.debug_loc.debug_ranges$.o@8 00X#@**gHo>>UoAAdBBnBFF(xZZsZZ ~PhPh`h`ho  xx88!,!,,!,,!, -!-x/!x/x0!06!6` @7!@70@7)i7 IO@M'h30UMO>4I0 " 5" X @& W