ELF( H4T4 ($#pxxx$$QtdRtd<<GNU*'[_N ?@ABC D$E(,F0G4>8H<I@JDKHLLPMTNXO\`PdQhRlSpTtUx|VWXYZ[\]S^_`acdefghijkmnopqrstuvwx yZz{| }$~(,0488<@DHLPTX\`dhlptx|j B $(,04 8<@DHLPTX\`dhlp@-- Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌX0 0 R/Ї,,00S 00/ 0S//ဋ|x88A, ?A /00S//<8PL0L 0 0S/80@-0S (0Q0 0 tC-4M0 c먀0` p000 000 0p dC \@PJ|u p4Ѝ D4mm0@-M@IP P SP P  LP3Ѝ0KЍ0XlC-,M0널0 `` `p000@fP1u ,Ѝ lC-,M0뜀0PUY`p00 000 00p@6Pu p,Ѝ8lRA-R ^/G-p'u `@PPP 0W@t@`@HU@0 1d bp@-PP @Pp@A-`L@P@`qpa4jA-pl@`@Pipe`T iwAiA-`L@P@J`9pY])diA-p|@`@P1p-` }H0<  i@-@_@t `hC-,M0뜀0PUY`p00 000 00p@3Pu p,Ѝ,8h@-O-KM3 sp@T 0 0# 0$0`00d0 0h0$0l0X000D00H0 0L0808\ X0PKߍP `PPPx  R (0\pV U `Y`(PU 220O000400000pY0,0p#00 ,`0`4``嘠j  50P41 ,01 0,x 0, 000,00 ,04  ,0$0$0 0! P 0U0E @TSQq Q Q  R  0 0 0S S Sx00x0001|00000010x00x0x00x0KߍPG`?(P\ll@-M @P eڍTc1p@-@0MPU=  0`  000 0! 000 00$0 0(0`A0S!  0S =00000S S00 000 0`0Ѝp(C-MM`P" 0u~@PP@70080E 0<0E00E 0$0E@9T0<7 <P ݍЍ@PP4Eu~ '0@-'M KN p0@`  $$$$ |404t-;㰀0: k`VqnJ404$ pRݍ0ЍXy4|_0p@-@(MPU ` 0  0 H 0000D00      `(Ѝp*{@-@P lP @?@-P @70p@-@0MWPU+  `0  0!0 0000 0 0$0`00r  00000?s0000 0 0`0Ѝpzp@-P@:P 6P _P p@@-M@&P 0?sVP Ѝ@@-@                     R   - M  E P Ѝ\- M  P Ѝ[01A-@XMPU> 0`0000000000,p0,00 `0000p040 008000<00 0@00 0$0L0p@ zJ 00   `XЍ# "O\wZp@-@ 0S /BPRp 0f p@gPHp@\C-@QDMPA{!D ` i 0X0 @P p0`X"0 !DЍ40 <0@`P p0u,up@-P@"P P h 0 `@4p p( ' YXX@-@P p   hXTXA-Pt`~@P(pw @XC-,M0널0 `` `p000Q@Pu ,Ѝ @sW0@-TM|0}@T 00P000000 0<0P 840 0 PTЍ0rA-P0P@`0 S0P%  00 0 00 0000?0 p00kPP&0S FP  P5P 000 0000 000?0   $P[<[D1G-@(MPXF 0`0U0`` `04pW, W W z  aU` 0ES d!L g000?s0000(Ѝ2(ЍjpZ-LM@0 P P _LЍS@-  @-.@C-,M0널0 `` `p0005@P{u ,Ѝ un\S A-@Mp`PU+ 000 0 0`000`Kp00(@T07 @Jt  :@@@  `Ѝ 8(nQ@-@M  jp Ѝ!Q@-xM@ p 0: S  S :C:SxЍ=xЍ 0  p 0SxЍp@-@MPUp@5  Pp@-@;PUp@  |P@-@)@t PP@-@M w @t ЍO@-@4 P'p  O0 00P g@-000P$ 0P @@f-MM+ ۍЍ@-xM@p0 02p  JxЍSN@-T@-xM@p0 0p  /xЍ8TN- M z[kz{  0 Ѝ.A@-@l@-#PA-8M(1 @T= 0 000000$00(0 0,0 ` PR0S 0 c 00gpw 8Ѝ00;Bp~ hO@N@-pp |L@-R< MPL/J0 0 Q:!"3c0? 00 0%@t  Ѝ000 @00 0 p 0S 00 t000XKp@-MP@`t0@0 ?@PVut T0Ѝp M K%$KJJ0@-PM@@ T 0P@+tu Ѝ0@8 $tJ JO-M `t0 P"%%UB2 ER0ʠU @`FR U r [ 8@0P` 0pQ "0w a!0sR0 0sE @ Q00%:+0000V@ 0 ЍX  `v@,00[00  0 p0S 0 pQ 0!@Q  0 0 SV }t0` 0p 8 0w ai( aIH@H(HGDG- M  Ѝ0@-P M@U Ѝ0 @D Ѝ0@C-4M$1  * PU: 0p000X00` 000 ` 00$0p<@ G `k @4t p4Ѝ4000S  Ta]FF(F- MP p q00000000 Ѝ(FC-M,MpP(@`V 0P #0000$0D0U (Pu $ ؍,ЍM _`E@-=@-M M@8 0`|Pp} R@(  @~t ؍ Ѝ x==C-MM@80`S80p P ! R( | p@Jt ؍Ѝ D<P<- M  Ѝ400@-p  )0<;0@-M@ J k{P{z  L0S o%@t Ѝ0eAx;A-``P`0P 0@q@ P<w0p P;@-`P0P 0 M@q@ 0Pdw<p X00000000 ЍLPx:C-pu 4Ѝ  8F.8@-0D @|p@@@T./ 00/-1@-`0MPp0   00000 0 0$0000 000S@ U  P0000}     UD@P @$PDD,D.,- M@ p@-P@Pp $00/ 0/?p@-`P @0p  *ppp@-`P @p  pp@--h1LM  r(0L` p00000,0 0400800<0(p@@00@ 00S ^@PL~u pLЍ@@I 5k@kj { H {z*{{z  ,.AtB,L+O-M,M pP(`Y4 0P #$ F0U0p00 (XPEUp$U ( X f@t([ AoQ ؍,Ѝ@*G-0M  0X<     0 ` $  ( P , ʠp@`P   p P0P0@DTʠ0ЍU@ @DOoB@T=?(A-M(Mp`y(@PU' 0`\ `#$ D0000 `؍(Ѝ$\ (X j @\t `؍(Ѝ T> (@-G-(M0`p8@T 0  000 7PVW(V`$Vv (Ѝ ='C-,M0 @T 0 p000p pP^`)v ,Ѝ <'@-,M0@T  p0P00pP P0`V 50  p,Ѝx  <%p@-PU@  00 \p P'p( p%%|%p@-@P@t p(%p@-@P` @}t pz$@-@ p +p e$@-@ p +p PP$ @-L$ @-($ ?@-@ 0p@-``PP$p@ P 000S p000S T pHD0003/T$:5#D#p@-@PX ?=@t p,#@-@MA 0&@t Ѝ"@-l@-O@- 0p@-@0MPU/  0`  00 0!000 0 0$0`[0S U0 0 -      `0Ѝp 006l7!p@-PP 0@0P p@0S CrP!p@-P0@0P p@0S /^ !p@-P0S*p@ Pp@ JT`  EA0 A00R0dpU ^ +X %L 4 @- P @ @-1p@-@8MPU>  0`  0!0 0000$00(0 0,0000040`000 0r            `8Ѝpv4p@-PP 0@0{P p@0S p@-P0@0P p@0S p@@-p@-@PP p p d 0@- M@ n{k{zZ 0 {:zSP"0#P%0% Ѝ0.A@Bp@-@-zkz{ P 0ejzk{  0]p.A0@-@,MP_Y@0@0P p ,Ѝ0 )D0@-0M @p Ѝ 8@-@ p C-,M0@T# 0☐00 0 0 p0 00`pVgP>`v ,Ѝ~ `0p@-P`@`p p0S C-,M0@T 0 p000p pNPl`V $`,Ѝ9 ! RP= P(!  1p: 0PS @0Ȁ0 p+ @Ѝ0 bR\0!000 A 1 0 0 0@T D  1,@0D8T@-p @-p 400@-p  X`8001@-fp  X @-0A-@(MPx T p`  B PP@@@  `(Ѝ\ 3P u R 000ETu"@-M@@t Ѝ:@-@TM @&t Ѝ  < Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/P<Q @-@A/SRQP)M`-QS&Ѝ /pSЍ p r0/ r0Ѝ p/ r0 Ѝ r0/@-PC-3` P1;:Soo Qo o N NΠ pnȌ2nj.P 03 P1:PX9W ^ 0?@ P  @T P *@T0P11>0YPV @-:= ==$=2==== = =#==&==== =accessinet_addr_of_stringchdirchmodexecvexecveexecvpexecvpefsyncmkdirgetcwdgmtimelocaltimemktimeputenv=unsetenvrenamermdirstring_of_inet_addrunlinkacceptbindin_channel_of_descrout_channel_of_descrcloseconnectdupgetpeernamegetsocknamelistenlockflseekUnix.map_file: bad number of dimensionsUnix.map_file: negative dimensionmap_fileUnix.map_file: file position exceeds file sizeUnix.map_file: file size doesn't match array dimensionsopen@pipereadread_bigarrayreadlinkrealpathselectrecvrecvfromsendsendtoshutdownsleepsocket socketpairsetsockoptsetsockopt_intsetsockopt_optintsetsockopt_floatsetsockopt_errorgetsockoptgetsockopt_intgetsockopt_optintgetsockopt_floatgetsockopt_error   )statlstatfstat@ `symlinktruncateUnix.Unix_errorException Unix.Unix_error not initialized, please link unix.cma  #!$% &' " srXYZ[\]^_`abcdefghijklmnopq(Kutimeswritewrite_bigarraysingle_writechownchrootclosedirdup2fchmodfchownset_nonblockclear_nonblockset_close_on_execUnix.fork may not be called after any domain has been spawnedforkftruncategetgrnamgetgrgidgetgroupsgetlogingetpwnamgetpwuidinitgroupssetitimergetitimerkillmkfifoniceopendirreaddirrewinddirsetgidsetgroupssetsidsetuidsigprocmasksigpendingsigsuspendsigwaitcreate_processtcgetattrtcsetattrtcsendbreaktcdraintcflushtcflow @0 0@@     @  2Kn,X   `  %K @B  `  %& -g5 =waitwaitpid:= ==$=2==== = =#==&==== =@IHxp$4H\̺ܺ = o8d  658o4oo1o==========================================================================================================================================================================================================================\]GCC: (Raspbian 10.2.1-6+rpi1) 10.2.1 20210110A,aeabi"6  "DI J JU@K LTq!XL$$rLpslsupv\!w40LzB<~DC~TFJ3MP^t }ȋWDϞSPԕGdpHP8o(9$Л$ 7,)GО`o=ԢDT1 <4TP40@<0vl0P,1Ыh<ذ= s &DIint%=U["/,DZu_]%^`=lmO1N2t9_:;>w @P =?  "  j         "   %   (( % +0  .8  2 @  6&H  9 P y = X  Aa` c Clh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h     Q 41T Ea F3 G H{8,cg ' 5 m   r-`%g  &P) 22-7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9 ! : = <@ <@end <@ <@ptr <@ p <@K$ < <s >{ ? mem @ !max A !a C Cend C Cptr C p CK$ C CF  =, =8&TD3DI 63'233&$5 ;9^5SQ5r@!5%p6 jfret7%j7 % %B`I I * PPQxI I I I a PtQI I ~ Pt J Px ! l !G! !"NN !QQ ! S! js 9 JintU["K&A(H*,ZM]p|_]%l_:;`/ n /!]o ] m } m , } ,  ,W  / zJ| s4 ^C\ D`DJ|P2QtRT`J|9P:QtRXpJMPXJPu(JrPtJ% % :  TUU Pq b 3s E JOint8U["/,?Zp_]%^`8lmO,N2t9_:;>w ;K8?  "  j       "  %  (( % +0  .8  2@  6!H  9P y =X  A\` c Cgh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h     Q /   1  T E\ F. G Hv8 'c b ' 5 m   m   - `% g    &K) 22( 7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9  : = <; <;end <; <;ptr <; p <;K$ < < s >v ? mem @ max A a C Cend C Cptr C p CK$ C C A8a J* Y & * ,*^DBM m@q %p 0 [Wret%}y0%$J6 J? PPQyJK JW Kc Pt Kp K|  Pt8K Py    l   !k k  QQ   S  j 3s ;@K"int/,bUZ3V[_]O^`3lmONy2wt9_:;>w ;K3?  "  j       "  %  (( % +w0  .8  2@  6!H  9P y =X  A\` c Cgh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      O(  0  8 id O@ OH  P  X  ` > h  p  x     *  l  P    5  =     O       h     Q /   1  T E\ F. G Hv8 'c b ' 5 m   m   - `% g    &K) 22( 7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9  : = <; <;end <; <;ptr <; p <;K$ < < s >v ? mem @ max A a C Cend C Cptr C p CK$ C C A3 @KX 6& 2X ^m@!Op ^ ret!O=9 "O_[H%*\Kd Km PPQxKy K K * PtQuK K G PtK Px    l   !  QQ   S  jU3s LTint%U["Z_]%^`1l~m_:;` LTRn#%tbl1RK$:%R D%S ` i %?9 ,Vs XL intU["Zr_]%^`,l~m,  6   ] XNr y_:; <>`  (M4 v(,rj i*% $Mw ;K3?  "  j       "  %  (( % +w0  .8  2@  6!H  9P y =X  A\` c Cgh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      O(  0  8 id O@ OH  P  X  ` > h  p  x     *  l  P    5  =     O       h     Q /   1  T E\ F. G Hv8 'c b ' 5 m   m   - `% g    &K) 22( 7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9  : = <; <;end <; <;ptr <; p <;K$ < < s >v ? mem @ max A a C Cend C Cptr C p CK$ C C A3x LOX 6&k g  2 X ^ m@!Op ^ ret!O  "O  %*; 9 hOd Om PPQxOy O O * PtQuO O G PtP Px    l   ! = QQ   S  j"qs P YintU["Z_]%^`,lym_:;` P n%S O PPP1& [ es P 1"int?U[K&`(8*1/,RZKN 1Mu_]?^`1lm O%2t9_: ;w z [ 1?  " D j D  K  K  "K  %K  (V( % +0  .8  2a@  6gH  9KP y =KX  Ar` c C}h  F"p / I"x t L"  P" 7 T" F ["  ` r" y tN v w"  y  {  }      N [ #  = " n " M " a "     ?(  .0  8id ?@ ?H  [P  X  ` > "h  "p  x     *  l  P "  " 5 " =   "  ?       h  & K Q n[Q1\Vmcx ' 5 m  K A-`%g ! &) 22E, K[ 1P  8  h;  K 1  n h   K 1k/ n  ! wEo E U e U 1 e 1 u 1W   h  m 4  ` 1 5 h3  b Vu  p0s 1t`2, 3Z 5= :[ 5 7? 8?a 9? :?  ; [ <I= $ > t F   "  # %<[P   <,[x t  <9[ C ^>, " v >} >?s o  ?[}v?[}e?[} ?~g??  @  @  A~resB }C?( " P %F[S Q xQ| rx m g ! Ry "% #$/ $; %G }%S }%_ }%k ~$w % ~$   & d $ 0 . 'R  (P~(Ry' R (Qy(R ) R '0R (P5(Q0'PR (R3(S0'pR (R4(S0)R *R (P2(Q0+ ( %[E C )2 4  s (T@2intU["Z_]%lyNr_:;`x&(T@Z.&'^ Z 1( Z_ ret) k  @Tq; P_ Q  PT~P P_ dT k,P P 2j s hT1"intSLU[K&f(8*1/,XZLN 1M{_]?^`1lmO%2t9_: ;w  a 1?  " J j J  Q  Q  "Q  %Q  (\( % +0  .8  2g@  6mH  9QP y =QX  Ax` c Ch  F(p / I(x t L(  P( 7 T( F [(  ` r( y tT v w(  y  {  }      N a #  = ( n ( M ( a (     ?(  40  8id ?@ ?H  aP  X  ` > (h  (p  x     *   l  P (  ( 5 ( =   (  ?       h ! , Q Q taW1b\sc~ ' 5 m  Q G-`%g' &) 22K2 Qa 1P / n !to     1  1  1W  bcd .e nf?g? Ih naxVA.a hpı ẖerr?ȱ8Rrc ?V V HPtQıRرS '}}V V% fPtV2 zPtV> PtV  WJ  L 1'PaU !aP.a($adrRFJFin4ShpTU?tlUV ain6Xhvwбx?rcx?UV PvU Vc PxQtRySu\}up} '}uD} uH$V 8VJ HV ".ahT,` A?./ 0` 0.^0HFA1a@01aDK1aHadr1aL1P1?][2 u sqres3 a#`U %MaTo Tx T U $U M P4Q0|U U $au %Ff ")aU  !a),F&U P@QP"8$aU  !a$+F&U P4QP''^^ 'QQ ( q' ' S'k( p' )'P P 2'nn3'8'p p ,($$ ' >'1Qos W0intU["Z_]%ly_:;`W0+.,A +(W; P Q@ 8WH P r; ,? m P P 2d Gs O@W81"int?U[K&`(8*1/,RZN 1Mu_]?^`1lmO%2t9_: ;w tU 1?  " > j >  E  E  "E  %E  (P( % +0  .8  2[@  6aH  9EP y =EX  Al` c Cwh  Fp / Ix t L  P 7 T F [  ` r y tH v w  y  {  }      N U #  =  n  M  a      ?(  (0  8 id ?@ ?H  UP  X  ` > h  p  x     *  l   P    5  =     ?       h    E Q hUK1VPgcr ' 5 m  E };-`%g &) 22?&EU 1P  8  b; K 1  n b  K 1k/ n ! w?o ? O _O 1_ 1o 1W   b m 4 ` 1 / b3 b Vo  p0m 1n`2, 3Z 5= :UF 1y8 o$U@W8  $,UC9C$9U& ^&2'UV 'UV 'UV&'}V]'?%![(/VU)mV3* _ + WD,?KE, ?ztTX %<U`W W  PvQVRVW ' PxW X j PVR_S }W} }xX+  X7 P_,X7 PW"kXs xXint8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8 DA F  G  H%4XY 41A?6dY@PP1&tY0xYM+(Y00A+/ A?-B@4YY PtDYfPtTY0XYMxX:A?1YU:yw^lAH0L*P%res Y%(XsX|XX0P3Q0$Yl  i! k q  c"!P P 2!nn3!p p ,! > ys 5xYpX!int8U["(T/,?Z|_]%^`8lmO,2t9_: ;w -= 8?  "  j       "  %  ( ( % +0  .8  2@  6H  9P y =X  A%` c C0h  Fp / Ix t L  P 7 T F [  ` r y t v w  yx  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q !1  c+ x' x5 m   6~-`%g &=) 22 8- Z  #  E %  W;ZL8 ;.;:'#A?=HF Zh? ][Z* PlZ7 QlZZD o1TZHA1.|t1:A?3dZ* PutZ* PtZP PuQtZZD  xY A? 2 " +)^"xCAA#D0#H#L#6P#%XVres$ nl @Z%. ZP, Y] Yf Yr Zf Z~ P4Q0PZ x!L"p* "?"p# q#aa '$k#yy %$P P 2$nn3$p p ,$ > s Zt$`int?U["/,FZPw_],^`?lmRO32t9_: ;w E &U ??  "  j       "  %  (!( % +0  .8  2,@  62H  9P y =X  A=` c CHh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N & #  =  n  M  a      ,(  0  8id ,@ ,H  &P  %X  %` > h  p  x     *  l  P    5  =     ,       h    Q 9&1'!8cC ' 5 m   N -%g &U) 22   ?tm, Y , , ,H ,  , ,. , , , $  $ (>&\@6t>'&@6^@'#A&A& AN6A,IEtmB C qiresD &0]%V&4\ \ P\b P ] @At,% ] PwQ0@] T] P"R0p2&[Dt2*&4 ttm5[ PP[ Pl\b \ PF(&[Db t('&'#* ttm+NH[ 5 PP[ I Pl[b [ PF &Z tm"{wres &Z P9Q0!"R"4"p p ," >"& & h#`` {"zz{"ws \]X0)intU["Zt_]%^`,lm{_:;` ,@  7 O  KKL>M rK$N  Q>R rS  T U dimV , G {   R F / fv {  # $ fN%%%f R{ l   r,   c  [/!>] >%>'%>>8r4,dim>Gph@ @resA bB-)C iH %OK^PQSRy7iP %soH^PtQRy^UQtR0S1P^iPvh^PtS3^QtR0S1K,7 \]lYv+b  Yp]% )!j;9"#vPN$]%]]OPt%]&C'nC>(oldE )G = *8*h*,*{{ + 5 c"s ^D+intZU"q[_],^`%lmNq_:;`;X_XA;)gc ret=, d_A Pt t_U Pt _n PF Rt _ Qt^A' val3 s! k p" MG ret#,zv ^  Pu ^! Pt ^@ P3 Qu St ^T Pv _ h Pv _| Pt 4_ PF Ru <_  Pt L_ Quq & & hjS X#s _,intU["Z_]%^`,lymNr_:;` _*+'6% * * ret%'# _0} Pv Qx _0 Pu Qx _< Pv _< Pu _H `T Pt Qu `` `l Pu `l Pt 4`x Px Qvl  QQ Sj E$s 38`-int8U["/,?Zp_]%^`8lmO,N2t9_:;>w ;K8?  "  j       "  %  (( % +0  .8  2@  6!H  9P y =X  A\` c Cgh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h     Q /   1  T E\ F. G Hv8 'c b ' 5 m   m   - `% g    &K) 22( 7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9  : = <; <;end <; <;ptr <; p <;K$ < < s >v ? mem @ max A a C Cend C Cptr C p CK$ C C A8;8`* 6&IE* ki^m@!%p 0 ret%%$P`6 `? PPQy`K `W `c Pt`p `|  Pt` Py    l   !EEB QQ   S  jOE&s S`La/1"intU[K&[(8*1/,MZN 1Mp_]?^`1lm O% 2t 9 _: ;  >w {P1?  " E j E  L  L  "L  %L  (W( % +0  . 8  2b@  6hH  9LP y =LX  As` c C~h  Fp / Ix t L  P 7 T F [  `  r y tC v w  y  {  }        N P #   =  n  M  a      ?(  #0  8 id ?@ ?H  PP  X  ` > h  p   x       *  l  P    5  =      ?         h  ' L Q o P R1 ] W nc y ' 5 m  L    6- `% g    " &) 22F -L\1P  8  i; F1  n i  F1k/ n  ! wFo F V fV1f1v1W   i  m 4 [1 6 i3  b Vv  p0t 1u`2, 3Z 5= :\ pPbT adrp8 Kq.tq;?84s XV^spnatP`t@t?resu Pd %yPd w P0!d tc< n\\c Pv Qu~c Qv!c c %P42" cc 7 # IG!b `c T Pztcm Pa R0c Ptc P2cZ Pt!$d  6 $hP` 6h(Pa]i ^ii!i?resjP|jPj?% %mP!` La P1 Q0!la &6aP 6#Padr70 bZK8- %( 6< Plen=\ b,K Pw4b9_ PwPbF Pt Qw Rub P2 Rw'b P$ Rw( a_ # NL( b@T # ge!a, t-P|a T a-?T ~)res/ P*a P@ QP vU!Ppa  a!= )res# P*|a P4 QP +L" ,?"-0.-1/.a -& & h-p p ,- >. p. q-/F)s ),dT4intU["K&A(H*,ZM]p|_]%l_:;`/ n 5!c o c  s   s ,  ,  ,W  5 ,dTJ a4res  4Jw ;K8?  "  j       "  %  (( % +0  .8  2@  6!H  9P y =X  A\` c Cgh  Fp / Ix t L  P 7 T F [  ` r y t v w  y  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h     Q /   1  T E\ F. G Hv8 'c b ' 5 m   m   - `% g    &K) 22( 7 5 5end 5 5ptr 5 p 5K$ 5 5  7F 8  9  : = <; <;end <; <;ptr <; p <;K$ < < s >v ? mem @ max A a C Cend C Cptr C p CK$ C C A8[d* 6'  * ^ m@!%p 0 ret% X%$!!d6 d? PPQyeK  eW ec Ptep $e|  PtHe Py    l   !ee9 QQ   S  jr +-s -Pe@9int8U["K&M(T*8/,?ZN 8Mi|_]%^`8lmO,2t9 _: ; w oP8?  " 9 j 9  @  @  "@  %@  (K( % +0  . 8  2V@  6\H  9@P y =@X  Ag` c Crh  Fp / Ix t L  P 7 T F [  `  r y tC v w  y  {  }        N P #   =  n  M  a      %(  #0  8 id %@ %H  PP  X  ` > h  p   x       *  l  P    5  =      %         h   @ Q c P F1 Q K bc m ' 5 m  @ x   6- `% g     &) 22: !@P8P 8~h! qu T  ; 8 H  ( (2;= =G  n m S 4  R R  3 n b V     &1 1;F FP n   7 [ [     - B     ! 6 K ! , G 8k/ n n !G  w o    8 8 8W   z M 8 p0A  1`2[, 3RZ 5= :PPPe 9'P4!*!6P}!y! !!^!! aP~!`x~%!! %" ""res! P:"8"![" ~!U#A ~"clo$%Q"M"#fg %7Pq"o"$le %e &Pt$e! %e- &Pw1&&Q~&R~$e9 %eE &P~&Rt%fQ &P2&Q0$,f] ')j8/s DfXK<intU["K&A(H*,ZN ,M]p|_]%^`,lm_:;`P  H  m 9; m} ,  n  9  ,k/ n   ! w   o   &  6& ,6 ,F ,W a   9 m 4 A ,   9 3  b  V F   p 0D 1E ` 2} , 3a Z 5= :,DfX2%""3""ret%""[UDdfPQQR~tf#Pt1&Q~f/Q0 J  p j0s )fH="int/,bU 0.uBi33:i3J3ZVP5V!N 3, N E6h&,"( |),- /0%1 |2 3 | 4,(80q:8?@H&HI&PJ&XZ`[_]Ol3_:;?`P 3  ~  h   ! q u= :z MYgH{ fdM8Y""errOO?#9#g(gGPt1&g4g@ePPgLPuR0 wCYTgH fdC7Yr#h#errEO##`g(hgPt1&pg4gXPPgLPuR0D% Of fd%1O##buf'No0 Oe1gd4gpPtQ1R3S}fp)$$0$*$f|P3QtR6O"O"N QQ  & & hTT 5 5 % 55 9 2s g@z@intU["Z_]%^`,lym_:;`g@evfd&_$Y$fd%$$ret%$$ge gqL Pt1&h~ h Q0  a QQ  jb3s $hdZAintU["K&A(H*,ZN ,M]p|_]%^`,lm_:;`P  H  m 9; m} ,  n  9  ,k/ n   ! w   o   &  6& ,6 ,F ,W a   9 m 4 A ,   9 3  b  V F   p 0D 1E ` 2} , 3a Z 5= :,$hd)2( %%6=%9%%b%^%[UDDh)PQQR~Hh5XhAPt1&Q~`hMhYQ0 J  ~ QQ j4s hPCintU["Z_]%^`,lym_:;`hPk9$%%fd3%%ret%%% hkB PP hw[ Pt R0 h Q0 TTv ) j5s lhxCintU["Zx_]%lr_:;`/<iLV.<,%% e> && Vi>= i PG h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8jD%'' 3''@''''^l!((*H%C(?(p1 g(c(p2! ((ret"%(( , %((|kP QvR Su;%9))j$k aPQQ0k wQ8kDkLk$k0k<Pvk<PukHPvQukUkal   l  QQ  S99   > j_ >s )k42NintU["Z_]%^`,lym_:;`k4J'.)*)73S)O)lJ:PP1&QQ1& lVQ0 "" j>s f$lDO"int/,bUZVO` H?HH$w~%ws' [_]O^`3lm_:;`P#$lD~fd&#|)t)cmd0#)) y;#)) lX retO+** O** K$p%+ + l~PtQ=RPl l~0PtQ>RPl m~XPtQ<RP4m LmtQ0Xm) QQ 5 5 %  j?s hm,"Q"intO/,gUZ[W|[_]O^`3lm_:;`+V$3&$ 6n fd6),, ofs637,3, cmd6>^,X, ret8,, <,, nPQ0n PnPu1&\n|nnQ0 *hm fd*& -- ofs*00-*- cmd*;b-\- ret,--m mPv1&m mQ0mPKR0 QQQ  6 j& & h-@s F%nRint%U["/,8 0.Bu11Tu1J1ZiP5i_]%^`1lm(W1   6   ] X@_:;4 <@>@ ` '1 5"  ,  q +L1 HE]drp, ~))A& , +  # S)  ,+S|') +#L('j*'hJ+Z"E!$3) Z+!~"*#+$%)&r&'%(,),*p$+p!, #-b!.I-/&0!1'2&3`$45%6278'9&:+;6"<!<#=!>9+? @&AE)B"C"DE,F%G+HD'I%Ji#K-LMa-N&O-PQR'S1$T}$U(V*+W+X Y %Z~#[?*\!](^*_`,!a b c dvef!gGh !iR%j"kl m,nOo"p'qS,ru%s t uI&v(wS xt y)z;-{#|*}_%~f('-$+%%',l+E"**!8( 3*x%$ "R!$$(+Dp"" ()*$)*(!&i%P$$*/' !)`, *\)k)#b ,`&,-< e', O*"7#! ++(1!O##+W&$#'()0&)*A,E6h &Q" (  )M -  / 0% 1 | 2  3  4M( 80q :8 ? @s' OH4, PTL) QP% RTT" SX)" TT\ Z`{q` [ --len.@--& @*.&.( @L.H.qePNqrr{PtQdR1$rQd&q(Q  4x.t.f)>%..qQ &`n vfd`)..$`4..)`A//&a)>/:/6-a8#aDfdc%`/^/ c %u/s/z(c%//&c%//d 4//dime ~f //f"f 00F$f$ 00stgL~V-h @00&h@:161(h@`1X1[i 11nX it411Lox, i422'nnk 85232!D"EJ2H2#Q'n (q 8a2_2!DH"Ev2t2#Q To`~ 22 22do P3QzR~$8qP3QzR~% dpdpL 22 22& ~" 33p PzQ~R1p$pPzn P|Tooe PNorpp PwQuRtS~@p+ P0Qvt"R3}zHpdpG Q0ppc Q0pq q$(qdqpq$|q 4 '1(6!4 % )fd4%*K$4/ +c6+p7%,6%!-%-! L( +_)val8./  _/K  @ @0))k1""2**Y 2##L 2""d09 0'25 5 % 0(= 022QQ 2*2!!=2j1$$2bCs -$rLtWint%=U["/,DZu_]%^`=lmO12t9_:;w & 6 =?  "  j       "  %  (( % +0  .8  2 @  6H  9P y =X  A` c C)h  Fp / Ix t L  P 7 T F [  ` r y t v w  yq  {|  }      N  #  =  n  M  a      %(  0  8id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c$ q' q5 m   /w-`%g &6) 22  =- u % ,# ={-)#=1U0--3#Ĺ-:$rL;6:%*3&3 :1L3J3 :>a3_3<;x3t3^<q33</@!<%33fd=%33j= %44-=%D4@49= %p> h4b4 ?%44%W44DrArJPPrVQvrVQv<rbrnrz PvQtRxss(PvHsXsq ! l ! G! !!-- !QQ ! S! >! jEs .psl1ZintU["Z%,_]%^`,lm_:;`-psl9%44.455 fdrp res '5%5 |sa PP su Ph s P2 Q0 s Q0TTv -- p p ,j Fs T.s$[1"intU[/,MZw_]?^`1lmO%2t9_:;w +1?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c Ch  Fp / Ix t L  P 7 T F [  ` r y t v w  yf  {q  }|      N  #  =  n  M  a      ?(  0  8 id ?@ ?H  P  X  ` > h  p  x     *  l  P    5  =     ?       h    Q   1   c  f' f5 m   $ l w - `% g    &+) 22 1 K1 L> M K$ N  Q> R  S  T  U dim V  1.(t&vfd(.>5:5O.(9`5^5*.).u5s5`.):55+&55^+f55/.+$H.+?55ofs, 6 6len,F6D6ret,a6[6buf- 66fd2?66%766t Hu Xu PQwt"R`u u u Q0 fe.s fd%66buf/77ofs:5717lenE]7S7&77^f77t.${?.?77.88ret?8|8$. {9 %%88t @t Xt i Py1&Q{`t |t Q{Rut t Q0F 1!" #o.o.h"QQ " >"j"/Hs .ut^int8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8.#up6#)88%p88^%l#99%*_!%%E9A9&v_len'%k9e9p( 99%199DvP_uuPPQyv vv9PvQ_R $v,vVPvXvdvPyl8P P 2 l   ..(QQ  S > jJs .pv`int8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8.pv5p*995:9^l(:$:.*H.%J:F:r r:j:rp ::%#::v;vDPPQvvPQ0v]PuviPuwvwPvl l .. P P 2 5  > j*vLs 00w4bint8U["/,?ZPep_]%^`8lmR  z/  [ 8/  Q@ N  g +/ 1 ; }s0 C}Z 8s/ Ff O,  2 t 9_: ;  > w 8?" j"% ((%+0.82@6H9Py=XA$`cC/hFp/IxtLP7TF[`rytvwyw{}N#=nMa %(08id%@%HP X`>hp x*lP5=%hQ  1   TE$FGcH 8 c *  w' w5 m  v 5 }  - `% g  @jmpABw/C  &) 22  /! 3%C 8?G/!}/'&/( %N0)C 8(/S}d0.buf/  75(5(end5(5(ptr5( p5(K$55   7cF8 9 :  =<<end<<ptr< p<K$<< . s > ? mem@ maxA  aCp Cp endCp Cp ptrCp pCp K$CC  8[/Axt ?/A'::/A6;;/AF;; 0B'/;+;Dt O;M;^Dwg;e;3/D5|/D%o.E |:E}l/E~U/F%|YG |;z;tvH&| tvpIz ;;J%;; resK <<!z %e<<"TyhW E #$h%|&2<0<'`y(P|)x*y q (PP(Q|(R|*$y (Q}(R|*8y (Q~(R|*Hy (Pv)y*y (Qw(Ry(Sz(}t)y*y (Qw*y (Qy*y 4 (Qz*yL (P3(Q0*(z d (PF(R0'8z(Q0 w &+>00w G00$T<L</04 <<2t <<^2w<<l3@res3D035H/3%! xXu fd6 %<<,@x$/8 =='Lx(P2(Q0-H %>6=2=)w +/# %w||G0#"Z=V=/#2 |=x=U/#>|==-F __i%8==/% =='8w"(Pu(Q0(R,8wP l&==$( fd' > > %./&/sec70(0 0[01#0#0n23`` {11e/e/ e 1QQ 1p p ,1& & h1j4 Os 0Lzg1"int?U[K&`(8*1/,RZN 1Mu_]?^`1lmO%2t9_: ;w tU 1?  " > j >  E  E  "E  %E  (P( % +0  .8  2[@  6aH  9EP y =EX  Al` c Cwh  Fp / Ix t L  P 7 T F [  ` r y tH v w  y  {  }      N U #  =  n  M  a      ?(  (0  8 id ?@ ?H  UP  X  ` > h  p  x     *  l   P    5  =     ?       h    E Q hUK1VPgcr ' 5 m  E };-`%g &) 22?&EU 1P  8  b; K 1 1J111011 0@0~00%2111 1@ 20111 0@ nr b  rK 1k/ n ! wo    1 1 1W.  p b m 4 p` 1  b3 b V  p0  1n`2J, 3.Z 5= :UF- 1 0- d*1wU~(  w(E/>+>1w2?T>P>4~ ;1aUD}F a.Uy>u>1a:U>> ofsaFU>> lenb.U>>! b9U!1bFU"retd?? ?#jd ?3?/?#.e\?T?$.fF {[g{Uh {$x} %Px$} %P|%Q{%R{$} %P{%Qy1&x"%R{}$}- %Pv1&%Q{%R{%S{%}{}& ~+%Q0KW '1S1OU| O%U??1O1U?? ofsO=U@@ lenOHU+@%@! P U"retR?[@W@#jR ?}@y@#.S@@$.TF {$|2 %Px$|\ %P{%Qw1&v"%R{|$}7 %Pu1&%Q{%R{%S{}&<}+%Q0b12UD{X!2)U@@125UAA ofs2AU-A)A len2LUUAKA! 3$U#5!AA#^5AAu15}{#15?AA(adr6U{26}{#16? BB"ret7?2B,B#j7 ?aB[B#.8BB$.9F {"res: UBB[;{U< {)l|O#%LUCCl{C${m%Px{$|L%Py1&%Q{%S{%}{%}{|$8|X%Q{%Ru$H|d%P{%R $`|p%P2%Q0||&|+%Q00ULz%U*C&C11UJCHC ofs=UaC]C lenHUCC!  U#"!CC#^"CCu1"}{#1"?DD"ret#?BD+00*Rs W2<~Dlint%U["Z_]%^`1l~m_:;`,1-2| D2<~Dm )8E4E cmd5]EYE X~m] PP1&x~y Q0N2N2 j Ss 2~mintU["ZPk!k_]%^`,lmRr,  r~_:;`t2 ~#g2 &E~E sec"   t&h ret' %EE #~~,&4@`LEE~YPX~e~q~}PuQu~Q0~PP2Ysec9(0 [0#0#0 n5 5 %  22 QQ j``{JTs 2zoint%U["Z_]%^`1l~m_:;`1 *~h! q u M ^ * ; c6 ws 1 6sH~~; &&0;;E PPZeeo^z+@Uj , 1    ,@ 10 % @2))9)'EE2)6&F FA*"VFRF*.{FwF,%FFty-%FFD)PPh5QwRv1&AQ0TTv 22f jUs 2pint%U["Z%1_]%^`1lm_:;`1:  ~  h   ! q u,E : E 3E2`9+FF2:FFA&+G'G2PGLGsvw`res pGnGty %GG`PPl8QwRv1&SXxPP2Q0<Q0TTv 22l p p ,jlWs B4Print8U["/,?ZPeN 8p_]%^`8lmR  z/  [+ 8/  Q@ _  g + O,   2 t 9_: ; > w  8?" j"% ((%+0.82@6H9Py=XA`cChFp/IxtLP7TF[`rytvwyO{Z}ekN#=nMa %(k0v8id%@%HP |X|`>hp x*lP5=%hQ  1   TEFGHF8 c   O' O5 m     U ` - q`% g  @jmpAX BO/C  &) 22  75g5gend5g5gptr5g p5gK$5k5k   7F8 9 :  =< < end< < ptr<  p< K$<k<k m s >F? mem@ maxA  aCCendCCptrC pCK$CkCk   8/!  % 8?G/! /'/( %N0)+- 8(/S d0.X buf/-  : P 5i 4k %5l %8)I 6'4[3z44N55 n45)53!4)3.p5/32532\4^M3b 3g3l45554= :^ 48a 3Q4h3Z44 44i 4j%;4k% 8  !A5p#  8 !A3}#   8 !23#  8 8( !3#8 x!3# p q q 8  !Z5%a  ~ 8!5 !5 "45 #i%#lgr #tv7$4P %vty+GG&46GG&3EGG%val&HH'tyU LHFH'opt q ~HzH(ЃC )QP1&)}t)}u$|5 @LC %vty +HH&4 6HH&3 EIH'tyU &I"I'opt q MIII()QP1&)}t*t3<+A8~IuI,ty7U II+4?%PJDJ+;4J%JJ-2,.val:!g4 h/h5I K K0<1YKWK23h4uKsK()P\5_)Px1&)Qv)Rt5t)P|5,)PF)Qu)R0(8*)Pu)Q0*4P+A8~KK,ty7U KK+4?%hLdL+;4J%LL-2,/LL/^OLL6err!"3 @74%8res LL!g4 !h5I 9/%$MM:t65?)Px1&)Qu)Rv)S)}58?3)Px1&)Qu)Rv)S)}:`K5?n)Px1&)Qu)Rv)S)}5ā*)Py)Q0:W:c:c(0)PF)Qy)R0 O;/7#0#0n>44 ?`` {>& & h>j@>55 >4>33d>55?L [s 6tw`int",/,nU 0.BuAAHuAJAZbP5b!''RAb,   E6h&d "( ): - / 0 %1  |2  3 4:( 80 q:8 ? @ H^H I^P J^X Z`[_ ],^ `A lk mw OF.  2 t 9_: ; >w   A?  " j"% ((%+0.82@6H9Py=XA!`cC,hFp/IxtLP7TF[`rytvwyt{}N#=nMa ,(08id,@,HP %X%`>hp x*lP5=,RhQ1TE! F G H4 8c' t ' t 5  m   2z-%g &) 2275U 5Uend5U 5Uptr5U p5U K$5 5 7 F8  9  : =< <end< <ptr< p< K$< <[s >4 ? mem@ maxA aC C endC  C ptrC pC  K$C C  A ] A 6/ (6H\ fd)SMMMret,MMbuf\ MMMMlP3Qt1&R\t- P1QQ0T6N 6)MM!N NN!^t.N,N2~"!,ret,ENANbuf~p !gNcN# !%NN(-PwQ~, ONNBNNP3QtR~ PPQy = Pt@Pyty6Ј 6(NN!N NN!^tOO2~"!,ret,OObuf~p !>O:O#`6 !%^O\Ol-PwQ~]8 sOqOsOOHP3QtR~( PPQy08PX PtPy6<fd&OOret,OObufP OOP P`P3Qt1&RPh-P0QuQ0ȈPKR0+6L 6&EPAP!N gPeP!^tP}P2~"!,ret,PPbuf~p !PP#!%PP -P0Qy, OPPBQQćP3QtR~d)PPQẋԇXPt$lPx4PKQx;6o\- 6o%QQ!qN >Q h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8]7,,.,,UU.UU^.lVVz%/,V*VDMl87DV7(DV@V 6fVdVC{VyVVV^lVVJ7*@7%VVp1 WVp2 1W+Wret%`WZW%)WWĊDYPQQx(YQx0e<eDqP}PvQuX`Pvh*PuMPx > l    k7k7" QQ  S j^_s w:ȋ`intU["ZPrer!r_],^`3lmQ@ y _:;>9, O8 h8 (q 8* r ;8+ / 71 r )92 5 T97 r 78 ; 7= r 8> B 7D r 8E H 7J r W8K N= 7P r 7Q U_ L8W r 8X [ 7] r 8^ a 8c r 8d g f9i r 99j m 8o r 8p u  7w r 7x |+ J9~ r 97H!x8$]9& O q    $ ( =, _0 4 8 < @ D 8 ȋ<.& WWres! WWru"+03.8'8'%WW<Pt r.8)8)%XX8<PtD .8,8,%LXJXd<Ptd .8.8.%~X|X<PtI P8QU#P0QDUP Qs7s7|p p ,77 W O gas 9"int/,bUZVWw3V z/ : 3/[_]O^`3lm O  2 t 9_: ; T >`w  T 3?  " Tj  T T "T %T  (_(% +0 .8 2j@ 6pH 9TPy =TX A`c Ch Fp/ Ixt L P7 TF [ ` ry tGv w y {  }   N T# = n M a    O(  0 %8id O@ OH TP  +X +`> h p  x  * 7l BP  5 =   O   h }  TQ ~TZ1e_T E F GQ H8vc ' 5 m  d :- `%2g= @}jmpA B/CxH &) 227 5 5end 5 5ptr 5 p 5K$ 5  5 T 7QF 8 T 9 e : T= < <end < <ptr < p <K$ <  < s > ? Tmem @ emax A ea C^ C^end C^ C^ptr C^ p C^K$ C  C  Tt 3/!  O 3?G/!/'t/( ON0) 3(/Sd0. buf/+90Tt 60,TXX`.08TXX2 XX^2YX2@!2Op3 YYret4O:Y6Ylen5 ^YXY ` %>TYY! "ԍ # #PQ" 7 #Qy! ! "! ] #Pt!. ": z #Pt$<F #Pyp9T 6)TYY`.5TYY! YY^!ZZ!@!!Op" ZZret#O>Z:Zlen$ `Z\Z Ho %-TZZ! " #PP#Qx! !( "8! #Pt!@. "H: #Pt$lF #Px%& 'l ''&(z9 'QQ 'S'jtcs 9Dnint%=U["/,DZu_]%^`=lm z/ ` =/O1 =K  6    ]  2t9_: ;yy > w  y =? " ~j  ~ ~ "~ %~  ((% +0 .8 2@ 6H 9~Py =~X A`c Ch Fp/ Ixt L P7 TF [ ` ry tlv w y( {3 }>   DN y# = n M a    %(  0 O8id %@ %H yP  UX U`> h p  x  * al lP  5 =   %   h   ~Q  y 1  T E F G{ H8 c  (' (5 m    . 9 _- J`% \g g @jmpA7 B(/C r  &) 22 7 5@ 5@end 5@ 5@ptr 5@ p 5@K$ 5  5  ~ 7{F 8 y 9  : y= < <end < <ptr < p <K$ <  <  Fs > ? ymem @ max A a C Cend C Cptr C p CK$ C  C   ~ = /!  % =?G/!/'/( %N0) =(/Sd0.7 buf/   -u % ,g =CW 9g :"D I 9[HX !fd["%ZZ" [2RZZ"9[AyZZ# ]% [[$А( %Pt%Q1%R0$A %Pt%Q2& %Pu%Qv >:SlH !fdS %![[" S0RC[?["9S?ye[a[# U%[[$ %Pt%Q1%R0$ %Pt%Q2& %Pu%Qv'TK%84A "9Ky[[ D( "6D!y[[" D4R\[$  %Pu&8 %P2%Qt%Ru(?$ " ?R"\\"9?-yD\@\)& %Qt%Rl(& $8 ":$%g\c\" $/R\\"9$>y\\#& ]]#^&(]]A'yL*err'yP*arg'yT'X+'%,res( y?]=],exn)`]R]-x?  + #K + ]].w #+:1 ]]#91]])Ԏ&$L/ %Pw$\" %Pv$p; %P4%Q0)G)S)ď/)؏_ ( '%,"")y^^/3y\0:$%19%2err y3"DD44N^H^5A|^z^5N^^6"hh44^^7A5N^^&t;%P1%Q0&`k%Pt%RD%S 8) 9 q85 5 % :8P P 28p p ,899[8T:T:<8""d8  Xgs v:Ҋ`/! 9PII?int nz/n~~I /W G/! /', /( P N0) I(/S IU[" /,Z P2 e2Y  _ ]P ^ `I  ll  mx R 9Q@  9 E g +E O2Qt9 _:; > wFVI?"  j   " % (( %+Q0 .8 2&@ 6,H 9P y=X Ag` cCrh Fp /Ix tL P 7T F[ ` r yt vw y { }    N #=nMa P(08idP@PHP %X%`>hp x*lP5=P`h2=Q:1!TEgFG*H82cm ' 5 m  = x-%g @2jmpAB/C48&V) 22\C d0.buf/b755end55ptr5 p5K$55 7*F8 9 !: =<<end<<ptr< p<K$<<s >? mem@ !maxA !aC7 C7 endC7 C7 ptrC7 pC7 K$CCM Ie: 6'^^63__)@__  ._,_^ F_D_ x! Ptv!  t! ]_Y_ p" S__ ret#P__ at$ %__ mt$%(`"`!z %5h`f`" + # ~`|`$% & ``' (@AR%(P" ,, 6 # ``$% & ``'< (@AP%(P)$ *p" T (PP)x. ). ); )đG *БS (Pt(Q)ؑ_ *k (Pt)lw  I+/ ,sec7%-(0 %-[0%.#0#0n/.l 0``{...o:o: .QQ .S.j. 5js :P"1"intU[/,MZw_]?^`1lmO%2t9_:;w +1?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c Ch  Fp / Ix t L  P 7 T F [  ` r y t v w  yf  {q  }|      N  #  =  n  M  a      ?(  0  8 id ?@ ?H  P  X  ` > h  p  x     *  l  P    5  =     ?       h    Q   1   c  f' f5 m   $ l w - `% g    &+) 22 1 K1 L> M K$ N  Q> R  S  T  U dim V  1:_8fd_-``buf_7aa*._B'a#a`.`-OaEab8aa^bfaat.b${?.b?aaofscbblenc 2b,b.d?kbebretd?bb$.e>{8%r | PtR{  Pw1&QtR{  ̕ Q0 fFO!1::0 vfd:/ccO.::5c3c*.;/JcHc`.;;_c]c:;Gtcrc=8cc^=fcc/.=$@.=?ccofs> cclen>cc:>ddret>)d%dbuf? IdGdfdD?^d\d  %Tudqdԓ @ \ PvQwz"Rt % Ĕ Ԕ  Qtؔ :, fd&ddbuf0dd*.;ed`.GVeLe!8ee^!feet.!${?.!?eeofs" f flen" 1f+f:"bfZf.#?ffret#?ff$.$>{\ %7 0 PvR{4 D PxQvR{L X%   "# /#$::n#QQ # >#j#5 5 % "Wls :ԕintU["Z_]%^`,lym_:;`:ԕt&1g-gPP1& ::ls ;Oint8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8:z6&VgRguid2gvggid=ggzgg^lhh*@!%5h1hp [hUhret%hhX%!hh P PPQzX`pCPuQvx&Rwx&x`PuPzl l    ;; QQ  S > jns ;|int8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8;@6'hh@hh^lii*@!%;i7ip ai[iret%iip%!iiȖF OPPQy[g$s Pu,4&PuP\Pyl l   ;; QQ  S > jUps #;dint8U["/,?Zp_]%^`8lmO,2t9_:;w +8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c Ch  Fp / Ix t L  P 7 T F [  ` r y t v w  yf  {q  }|      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q   1   c  f' f5 m   $ l w - `% g    &+) 22 8DIR =;I;dvd)iiii^fjj\;$H.;%Aj=jd ejajܗ%%jj|ȗ(Pv̗4@LP9Rv f  S;S; QQ  >& & hrs k;intU["Z_]%^`,lym_:;`r;9%jjfd14kjfd2?_kWk@K Pt RP1 L`n Pu Qtx Q0  Pt >:>:~ TTv ;; j 99 lss ;H"intUZ[_]O^`3lym_:;`;Hmfd'kk 1kk0Okk m yT Pt1& Qu1& Ę  Q0 ;;% QQ  jTts ;P|intU["Z_]%^`,lym_:;`;Pfd'lluid1ElAlgid<glcl0%ll p Pt1& Qu1& Rv1& 4 Q0  ;; QQ  j(us $<8VintU["Z_]%^`,lym_:;`;6$fd64lltPP1&R0;0$dfd02llPP1&R0;&Tfd&/ll (%mm PtQ3R0 PtQ4ܙQ0 <8Ttfd-/m+m %RmPm PKPtQ3R0 hdPtQ4Q0 99 >:>:~ ) jus y=(intU["Z%_]%^`,lmar_:;` =%M<%, ?G < ^= < e< ,< k= = t<:=:==S O=$T  .$%imem ret&%mm \r p~8Pt  ̚  Qu ;<88 @TP5<(r =mm8P4!=!=L<< <<& j b<< <<< Kws =$t"int/,bUZVWw[_]O^`3lm_:;`+=(p`fd(-nnlen(7HnDn0*Omninofs+nn R PQ _ k Pt1& x ̛ Q0=$LRfd*nnlen4nn0 Onn 4_ Dk9 Pu1& Lx l Q0  (=  QQ  jws =ЛintU["Z_]%^`,lym_:;`=Л.( oo؛==xs >intU["Z_]%^`,lym_:;`=.(EoAo== ys >*intU["Z_]%^`,lym_:;`>.'jofo#>#> ys > Ģint8U["/,?8Zp_]%^`8lmO,2t9_:;w -= 8?  "  j       "  %  ( ( % +0  .8  2@  6H  9P y =X  A%` c C0h  Fp / Ix t L  P 7 T F [  ` r y t v w  yx  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q !1  c+ x' x5 m   6~-`%g &=) 22 8D> *V*> , d> - > . ]> /  n><XPgid<)ooA?>oodxPu1&hJ>,\hA,)ppA?.MpEp/Pu(LPu8hHT2> A?.pppp^xppAD>HmemL6P%ppres pp؜D%)pp$xP4Q0 x 5 5 % x>x> e k j!q T>T> k" P P 2 nn3 p p , >{s >intU[",Z_]%^`,lm@k_:;`>R.*qq> R?q5qn!%qq>! %qqres" rr i2 %(r&r X Нd P0 Q0 q Pu Qt2$ d Pt Qu } Pt H Pu ` Pu p. Q0 xB Pu  Q05 5 % >> >> >> . S jL|s >,intU["Zx_]%l_:;`>,*.)@r>PP P 2& & h}s ?intU["Z_]%^`,lym_:;`?.(rrĞ??wa ~s ?Оint8U["/,?88Zp_]%^`8lmO,2t9_:;w 9I 8?  "  j         "   %   (( % +0  .8  2 @  6&H  9 P y = X  A1` c C<h  Fp / Ix t L  P 7 T F [  ` r y t  v w  y  {  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h     Q -1,c7 ' 5 m   B-`%g &I) 22  8g> 1? 3 m? 4 w? 6 $? 7 ? 8 ~? 9 +? : G?BTPuidB)rrA?Drr`tPu1&  Z?2\A2)8s0sA?4wsos \Pu$+ yPu4D P 4?О(A?0ssss^ssAg>@?DdirH.?LBP%ssres tt%/'t%t7 T@ d@ p@ @ @ L P7Q0X  5 5 % Q?Q? n k j!q d?d? t" P P 2 p p , ><s ?8intU["Z_]%^`,lym_:;`?.'>t:t??ŀs ?`ҭintU["Z_]%^`,lym_:;`?`s?+ct_tD>7ttȠs.PtܠJPtQu1&cPFRt Q0 q ?? & & h jzs @`int,U["ZPwew_],^`8lmQ@ ~ _:;>@8YN @ l@ ?Y@iv?lc@n 3 8v @1 @=T@=*ttval?NhlQ`P`̢xQ0 {@3@3*tt-@37ttnew5NPold5N`Pu PH(Pu0PPPQDRX`PXxxQ0?'ttp'9"uures* TuNu}.8+8+%u}uPu .8,8,%uuPuP4QNC@ lftv4fuusec?%vv (0 %h[0%?v=v,\@A@%P`H#@#@{ j``{@@ s7s7|p p ,#0#0 n>@4@ fs AԢDްintU["Z_]%^`,lym_:;`@ԢDtpid%]vYv@0v{vsig%vv tE PQ1& [ Pt1&   Q0 @@c @@p @@" j;s A"int/,bUZ3V[_]O^`3lmO2wt9_:;w !1 3?  "  j       "  %  (( % +w0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      O(  0  8 id O@ OH  P  X  ` > h  p  x     *  l  P    5  =     O       h    Q 1c l' l5 m   *r}-`%g &1) 22 3An6'vvA3vvnvv^l'w#w*@!OIwEwp yowiwretOww`<Oww%(xx4t} PPQy7PuQvTPuԣPyl l   AAZ QQ  S > jls 'ATintU["Z_]%^`,lym_:;`.ATJ=A%xxret%>x:xJ V9 Pu1& 8c Qv 5 5 % 8A8AV js BA< int8U["/,?Zp_]%^`8lmO,2t9_:;w !1 8?  "  j       "  %  (( % +0  .8  2@  6H  9P y =X  A` c C$h  Fp / Ix t L  P 7 T F [  ` r y t v w  yl  {w  }      N  #  =  n  M  a      %(  0  8 id %@ %H  P  X  ` > h  p  x     *  l  P    5  =     %       h    Q 1c l' l5 m   *r}-`%g &1) 22 8DIR=;LA<6(`x\xxx^lxx*@!%xxd xxres yyp! 8y2yؤ%,cyayT PPQy0PuMPuԤgPwQPyl l   VAVA QQ  Sp p , > jaɈs ATDintU["/,3 0.|pZd_]%l_:;`A@AAAHA AA! @P, DIR\ =;pA ^AT vd(~yvy d! yy e"yy(Pt 44@HLP9RtLXPaAhAQQ P P 2& & hAA i\s AP4intU["Z_]%^`,lym_:;`DIR=;AP4Avd*zz d ACz=z dG S P9 AA & & hCs A0cintU["Z_]%^`,lym_:;`A0-gid'pzlz-PP1& :Q0 BB jls B%intU[",Z_]%^`,lm@k,   6   ] X_:; <>`B\>*zz >! \zz K$" zz n#%zz  i'{{ b%  s4{2{K{I{ХPu 8PwQvLPv8Q0 +val8  K  r r Z%B%B S jaΌs @B<0intU["Z%_]%^`,lmar_:;`/B<0K.'b{^{pid {{DK hX Q0 9B9B jCs IBl0HintU["Z_]%^`,lym_:;`RBl0-uid'{{x-PP1& :Q0 \B\B j*Js CP "intO/,gUZ z/ : 3//3[[_]O^`3lm O  2| t 9_: ; G > Sw } G 3? " Gj  G G "G %G  (R(% +|0 .8 2]@ 6cH 9GPy =GX A`c Ch Fp/ Ixt L P7 TF [ ` ry t:v w y { }    N G# = n M a    O( 0 8id O@ OH GP  X `> h p  x  * *l 5P  5 =   O   h p { GQ q G M1 X RT E F9 G H8 ic  ' 5 m     -- `% %g 0 @pjmpA3B/Ck ; v &) 22 /!  O 3?G/!/'/( ON0) 3(/Sd0.3buf/ 7 5 5end 5 5ptr 5 p 5K$ 5 5 G 7F 8 G 9 X : G= <F <Fend <F <Fptr <F p <FK$ < < s > ? Gmem @ Xmax A Xa C Cend C Cptr C p CK$ C C L  3BZ G 3 V3 3# B53 oBdGXq uCd(G{{setf ~gO{{CgO~ 0hi% !I||!=*|&|"Ux #VL|H|$d%p&Pu%p|&P~$'I &Pu&Q~$$ĩ%&Pt&R0`CXGȨ{ BX+Gn|j|setZ ~[O|| 0ب\< !I||!=||"U* #V||$d%p&Pu%|&P~$'Y &Pu$ $8%T&Q0BHG .H+G} }J ~+CK 3}/}(x_ )iM O[}Q}( * N K N }}+Hd)jPO}}'xpG &Pw&Qt%p&Pw&Qt!'t &P~'@ &Pw%&Q0 B7G8B7,G~~B7;G9~5~)how9OY~W~set: }0C:~;Op~l~ 0\X> !I~~!=~~"Uh #V~~$td%p&Pu%`|&P}$' &Pw&Qu&R~$$' &P~%ܧ&Pt&R0,B'G$-set''$~~)*^)64res*GD|*H.*O()i+ OSI( B- G'&Pt% &P0%&Pu&Qt(@%2G$$  /B d0B!G1set2$23sig" O4@@c47C7C 4CC 44yByB 4QQ 4ACACd4& & h4jCjC 45 5 % 4j4BB 4zCzC 4@@"4CC4cBcB 5rs D++int"UZ7a}[_]7^`Llm2_:;`%!7$ L L+ b C-7 C.7 D/g C0 CbjD1$ /DQC&  !C!! D"!HDD#! % ph & 6'Ȁƀpid( src)7ۀr) 7 act*mLL?DBldst6 7(i=7QPwQuRvت]PwQu ]PwQui4PyQz$uNPwQzXcPwPwPxPuRyHPQyRwS~1&}x}zTPw\Px,PQyRwS0@PzuQzCC CC  l  rDD IDID   s & & hDDH "D"DU ߒs EЫeint%U["Zp_]%^`1lm_:;`EFE1E1gE< E )F E >E D  D  D 4 D! 8  1 1  E qF WEEnd 1 wF D w 1pF)]* D^ E_% *? 1/E`? ,f 1VE0fEWf , 1FbFEfHfdf'KGCf1pl PP1&а" Q0D[LDfd[(oE[2h. yPP1&" Q01FP0fdP(߂ۂ(: PP1&H" Q0EE4SfdE,DE6)%F CPP1&QQ1&" Q0]F4̭sfd4*NJ\E44{oarg4@у˃W6U( =&nbNH( zL( P  څօ   <6R oPy^ Py( ) jf  ׆ӆ #!j PFR0v APwQ cPwQxRy" Q0IF$ЫUfd$*:6 res& a[W'K ,d X p 0 q ' ` u 31 QG P  dPx Px! 8 Ɖ‰|     ?= YW om    v 1PP1&Q EP&" Q0"'E 9 #dst49 #srcI$ok%&pc? '(aEE &msk'(aEE &ofs %&num %)msk)i %'( @  %E  %)res  %%)i %%@ %w"uE  #dst4#srcI9 %&pc? ' (CFE &msk' (CFE &ofs %&num %&msk%&i%' (@ %(D%&i%%(@ %*PEPE^ *j*EEZ *;F;FV *EEP *DD6 *DD9 *& & h*SFSFB *gFgFF *EE0*EE3*>> .$ s Fذ"intUZ[_]O^`3lym_:;`}Fذ &ڊ֊PP1& FF4D s Fpint%=U["/,DZu_]%^`=lm z/ ` =/O1 2 t9_: ; ; > Gw q ; =? " ;j  ; ; "; %;  (F(% +0 .8 2Q@ 6WH 9;Py =;X A`c Ch Fp/ Ixt L P7 TF [ ` ry t.v w y { }   N ;# = n M a    %( 0  8id %@ %H ;P  X `> h p  x  * l )P  5 =   %   h d o ;Q e ; A1 L FT E F- G Hu8 ]c  ' 5 m      !- `% g $ @djmpA'B/C_ / j &) 22 u/!  % =?G/!/'/( %N0) =(/Sd0.'buf/  7 5 5end 5 5ptr 5 p 5K$ 5 5 ; 7F 8 ; 9 L : ;= <: <:end <: <:ptr <: p <:K$ < < s >u ? ;mem @ Lmax A La C Cend C Cptr C p CK$ C C @ ; = , =FV FZ;8l  Z(;FZ5;& pid\%VR7E\ %tj\%xt P !PP"X h !Pt1&!Ql!Rd"p !Pt# !Q0FE;L .E%;pidG%7EG %t"  w !Pl"  !Pt#4 !Q0$F*; %pid*'%ދ7E*0%%, ^\^,vt&st-;DF-H'F-%res. ;(tn %B;" & L/ !P1!Q0 `/ !P2!Q0 / !P1!Q1"; #Ա/ !Q2 )G))FFd)QQ )j)FFM*)p p ,)ACACd% $ > &I: ; 9 I$ >  : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I 4: ; 9 IB U11B1 .?<n!.?<n: ; 9 ".?<n: ;9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8  : ; 9  : ; 9 I I !I/ .?: ; 9 'I@B : ; 9 IB U4: ; 9 I1B11.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > $ > : ; 9 I : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > &I$ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 I U 4: ; 9 IB  I% $ > $ > &I: ; 9 I> I: ; 9 ( : ;9 I  I .?: ; 9 '@B : ; 9 IB 4: ; 9 IB 1B1B.?: ; 9 'I@B: ; 9 IB4: ; 9 IB U11RB UX Y W 1B 1U41B1.: ; 9 'I : ; 9 I 4: ; 9 I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 1 B 1  I .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB 4: ; 9 IB 1 B 1  I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB 4: ; 9 IB 4: ; 9 IB 1 B 11 I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % : ; 9 I$ > $ > &I  I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9  : ;9 !.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I  4: ; 9 IB!1RB UX Y W "1B# U$41B%41& 1U'1(B)1*1+ U,.: ; 9 'I -: ; 9 I.4: ; 9 I/4: ; 9 I0 1.?<n: ; 2.?<n: ; 9 3.?<n4.?<n: ;9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I 4: ; 9 IB 1 B 1 I!I/ I.?<n: ;9 .?<n: ; 9 % : ; 9 I$ > $ >  I&I : ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB4: ; 9 I U4: ; 9 IB11B !I/!: ; 9 IB".: ; 9 'I@B# $'I%I&B1'.?<n: ; 9 (.?<n: ;9 ).?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I1 B 1 I !I/ .?<n: ;9 .?<n: ; 9 % : ; 9 I$ > $ > &I : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 11B !I/!.?<n".?<n: ; 9 #.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ;9  : ;9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB1BB11.: ; 9 'I@B4: ; 9 I4: ; 9 IB  .?<n: ;9 !.?<n: ; 9 ".?<n% $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ;9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB1RB UX Y W 1B1BB11.: ; 9 'I@B4: ; 9 I4: ; 9 IB !.: ; 9 'I ": ; 9 I#.?<n: ;9 $.?<n: ; 9 %.?<n% $ > $ > : ; 9 I &I I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I4: ; 9 IB 11B1 .: ; 9 'I@B!.?<n".?<n: ; 9 #.?<n: ;9 % $ > $ >  &I: ; 9 I I' I > I: ; 9  ( (  : ; 9  : ; 9 I8  : ; 9 I8 I!I'I> I: ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 IB U1B1!I/ .: ; 9 '@B 1RB UX Y W !1B" U#41B$1%B1&.: ; 9 'I ': ; 9 I(4: ; 9 I).?<n: ; *.?<n: ; 9 +.?<n: ;9 % $ > $ >  I: ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1 B 1 : ; 9 IB.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I: ;9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 4: ; 9 IB 1 B 1 1 I.?<n: ; 9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I4: ; 9 IB 1 B!1"1RB X Y W #1B$.: ; 9 'I@B% U&.?: ; 9 '@B'1(1RB UX Y W )4: ; 9 I*B1+.: ; 9 'I ,: ; 9 I-.?<n: ; 9 ..?<n: ;9 /.?<n% $ > $ > : ; 9 I I : ; 9  : ; 9 I8  : ; 9  : ; 9 I I !I/ .?: ; 9 'I@B : ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B B1 1 .?<n: ; 9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U11B1.?<n .?<n: ; 9 !.?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<> I: ; 9 ( ((&I7I : ;9 I8  : ; 9  : ; 9 I : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB 4: ; 9 I!4: ; 9 I"4: ; 9 IB# $1%1&B'1(.?<n).?<n: ; 9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 : ;9 I> I: ; 9  ( ( ( .?: ; 9 'I@B : ; 9 IB4: ; 9 IB11BB11.: ; 9 'I@B4: ; 9 I U4: ; 9 I1RB UX Y W 1B.?: ;9 n'I : ;9 I I.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B11.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 B 1 .?<n: ; 9 % $ > $ >  I: ; 9 I4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1RB UX Y W  1 B B1B1.: ; 9 'I .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB 1 B 1 I !I/.?<n: ; 9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I: ;9 I : ; 9  : ; 9 I8 I !I/  : ; 9  : ; 9 I : ;9 I8  : ; 9 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB 1 B B1 4: ; 9 I 1.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U1B11.?<n: ;9 .?<n.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB : ; 9 IB 4: ; 9 I 4: ; 9 IB 4: ; 9 IB 1B1.?<n: ; 9 % $ > $ > &I: ; 9 II!I/ 4: ; 9 I .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB 4: ; 9 IB 1B1B11.?<n: ;9 .?<n: ; 9 % $ > &I$ > : ; 9 I > I: ; 9 (  I > I: ; 9  ( I !4: ; 9 I?< : ; 9  : ; 9 I8 .?: ; 9 '@B: ; 9 IB: ; 9 IB4: ; 9 IB1B1B1.?: ; 9 'I@B: ; 9 I4: ; 9 IB4: ; 9 I  U1RB UX Y W  1B! 1U"41B#41$1%1RB X Y W &41'!I/ (.: ; 9 'I ): ; 9 I*: ; 9 I+4: ; 9 I,.?: ;9 n'I -: ;9 I. /4: ; 9 I0.?<n: ;9 1.?<n2.?<n: ; 9 % $ > &I: ; 9 I$ >   I: ;9 I I !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<4: ; 9 I> I: ; 9 ( .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB4: ; 9 I U11B .?<n!.?<n: ; 9 % $ > $ > I!I/ : ; 9 I.?: ; 9 'I@B: ; 9 IB 4: ; 9 I 4: ; 9 IB 1 B 1.?<n: ; 9 .?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 !I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1 !I/!.?<n".?<n: ; 9 #.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U1B11!I/.?<n: ; 9 .?<n .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   : ; 9  : ; 9 I8 I !I/  : ; 9  : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 I 4: ; 9 IB! "1RB UX Y W #1$ U%41&41B'1(B)1*1+.: ; 9 'I@B, - U..: ; 9 'I /: ; 9 I04: ; 9 I1.?<n: ; 9 2.?<n3.?<n: ;9 4.?<n: ; % : ; 9 I$ > $ > &I : ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8 I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<> I: ; 9 ( (( : ; 9  : ; 9 I : ;9 I8  : ; 9 4: ; 9 I.?: ; 9 'I@B: ; 9 IB1 : ; 9 IB!: ; 9 I"4: ; 9 IB#4: ; 9 IB$1%B&1'!I/(4: ; 9 I) * U+.?<n: ; 9 ,.?<n: ; -.?<n% $ > &I$ > : ; 9 II!I/ 4: ; 9 I .?: ; 9 'I@B : ; 9 IB : ; 9 IB 1 B1.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 .?: ; 9 'I@B: ; 9 IB 4: ; 9 I U 4: ; 9 I 4: ; 9 IB 1RB X Y W 14141B1B11.: ; 9 'I : ; 9 I4: ; 9 I.?<n: ; 9 .?<n: ;9 % $ > &I$ > : ; 9 I> I: ; 9 ( ( (  : ; 9  : ; 9 I8 I !I/  I7I<4: ; 9 I?.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB1B1.?<n: ; 9 % $ > &I$ > I!I/ : ; 9 I> I: ; 9  ( ( ( ! 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB1B1.?<n: ; 9 % $ > : ; 9 I$ >  &I : ; 9  : ; 9 I8 I !I/  : ; 9   I : ;9 I5I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8  : ;9  : ;9 I8 > I: ; 9 ( ( > I: ; 9 !4: ; 9 I" : ; 9 # : ; 9 I$.?: ;9 'I@B%: ;9 IB&: ;9 IB'4: ;9 IB(1)B*.?: ; 9 'I@B+: ; 9 IB,: ; 9 IB-: ; 9 I.: ; 9 I/4: ; 9 IB01RB UX Y W 11B2 U341441B5164: ; 9 I74: ; 9 I 84: ; 9 IB9 U:1;.: ; 9 'I <: ; 9 I=4: ; 9 I>.?<n: ; 9 ?.?<n: ;9 @.?<n% $ > $ > &I: ; 9 I  I : ; 9  : ; 9 I8 : ;9 I I !I/   : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8<: ; 9 I 4: ; 9 I?< : ; 9 I8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I1RB UX Y W 1B1B11 : ; 9 IB!4: ; 9 IB"4: ; 9 I # $.: ; 9 'I@B% U& U'41B(.: ; 9 'I ): ; 9 I*: ; 9 I+4: ; 9 I,.?: ;9 n'I -: ;9 I..?<n: ;9 /.?<n: ; 9 0.?<n% $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 14: ; 9 I4: ; 9 IB U1B1.?<n.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 > I: ; 9 ( (  : ; 9  : ; 9 I I8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I U4: ; 9 I 4: ; 9 IB1B 1.?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I  I : ; 9  : ; 9 I8 I !I/ : ;9 I 5I   : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 IB U!1"1#B$1%.?<n&.?<n: ;9 '.?<n: ; 9 % $ > &I: ; 9 I$ >   : ; 9  : ; 9 I8 I !I/ > I: ; 9  (  I: ;9 I5I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I4: ;9 I4G: ;9  .?: ;9 '@B!: ;9 IB": ;9 IB#4: ;9 IB$1%B&1'.?: ;9 'I@B(.?: ;9 '@B)1*4: ;9 I+4: ;9 I ,4: ;9 IB- U. /.?: ;9 'I 0: ;9 I14: ;9 I24: ;9 I3.1@B41B541B61RB X YW 7418.?<n: ; 9 9.?<n: ;9 :.?<n% $ > : ; 9 I I!I/ $ >  : ; 9  : ; 9 I8 : ; 9 I   : ; 9  : ; 9 I 8 : ; 9 I8 I   I : ; 9 : ;9 I5I  : ; 9  : ; 9 I 8 : ; 9 I 8< : ; 9 I8 4: ; 9 I?< : ; 9 I 8 .?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 I 4: ; 9 I 4: ; 9 IB! U"1RB UX Y W #1B$ U%41&41B'1(B)1*1+.: ; 9 'I ,: ; 9 I-4: ; 9 I..?<n: ; 9 /.?<n0.?<n: ;9 % : ; 9 I$ > $ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?< : ; 9 I8 !I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U4: ; 9 I11B 1!!I/".?<n#.?<n: ; 9 $.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >  : ;9 II!I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8  I< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB 11B1.?<n.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB1 B 1 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 4: ; 9 IB 1 .?<n: ; 9 % $ > $ > : ; 9 I I'4: ; 9 I?<> I: ; 9  ( .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB 11B.?: ; 9 '@BB1.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB 1 B 1 1 .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB11BB1: ; 9 IB.: ; 9 'I@B4: ; 9 I4: ; 9 I4: ; 9 IB  .?<n: ; 9 !.?<n: ;9 ".?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB U 1 1 B 1 I.?<n: ; 9 .?<n: ;9 % $ > $ >  I: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB 1 B1 1 B .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB11BB1: ; 9 IB.: ; 9 'I@B4: ; 9 I4: ; 9 I4: ; 9 IB  .?<n: ; 9 !.?<n: ;9 ".?<n% $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1.?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > &I: ; 9 I : ; 9  : ; 9 I8 > I: ; 9  ( I !I/ 4: ; 9 I .?: ; 9 'I@B: ; 9 IB4: ; 9 I1B1.: ; 9 'I@B: ; 9 IB4: ; 9 IB U4: ; 9 I 4: ; 9 IB  I.: ; 9 '@B1.?<n: ; 9 .?<n: ;9 .?<n: ; % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB: ; 9 IB4: ; 9 IB 1 B 1 1 .?<n: ; 9 % $ > $ > : ; 9 I  I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB U11B1.?<n.?<n: ; 9 .?<n: ;9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B 1 .?<n: ; 9 .?<n: ;9 % $ > : ; 9 I$ >   I: ;9 II !I/   : ; 9  : ; 9 I 8 : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 I4: ; 9 IB 11B1.?<n.?<n: ; 9 % $ > $ > : ; 9 I : ; 9  : ; 9 I8 I!I/ : ; 9 I < .?: ; 9 'I@B : ; 9 IB 4: ; 9 IB11BB1 I.?<n: ; 9 % $ > $ > : ; 9 I: ; 9 I<.?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 1 1 B  I.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I> I: ; 9 ( .?: ; 9 'I@B: ; 9 IB 4: ; 9 IB 4: ; 9 IB U 1RB UX Y W  1 1U41B1B1 I.: ; 9 'I : ; 9 I 4: ; 9 I.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB1 1 B .?<n: ;9 .?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B 1 .?<n: ;9 .?<n: ; 9 % $ > $ > &I: ; 9 I  : ; 9  : ; 9 I8 I !I/ : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 I4: ; 9 IB 1RB UX Y W !1B" 1#41B$1%1&B'1( U)4: ; 9 IB*4: ; 9 I+ ,.: ; 9 'I@B-: ; 9 IB.4: ; 9 I /.: ; 9 ' 0: ; 9 I1: ; 9 I2 34: ; 9 I4.?<n: ; 9 5.?<n%  I$ > &I$ > : ; 9 I4: ;9 I?<I !I/  : ; 9  : ; 9 I8 < .?: ; 9 'I@B: ; 9 IB: ; 9 I4: ; 9 IB4: ; 9 I4: ; 9 IB : ; 9  U 1B1.?<n: ; 9 % $ > &I$ > : ; 9 I5I I : ; 9  : ; 9 I8 I !I/ > I: ; 9  ( ( 4: ; 9 I : ; 9 4: ;9 I4: ;9 I.?: ;9 'I@B: ;9 IB: ;9 IB1B11RB UX YW 1B U 1 1U41B 1U 4: ;9 IB! 1".: ; 9 ' #: ; 9 I$ : ;9 % &4: ; 9 I' (4: ; 9 I)4: ;9 I*.?<n: ; 9 % $ > $ > : ; 9 I.?: ; 9 'I@B: ; 9 IB1B .?<n: ;9 % $ > &I: ; 9 I$ >   : ; 9  : ; 9 I8 I !I/ : ;9 I 5I  I  : ; 9  : ; 9 I 8  : ; 9 I 8 : ; 9 I 8< : ; 9  : ; 9 I8 : ; 9 I 4: ; 9 I?<  : ; 9  : ; 9 I8I  : ; 9 I 8 4: ; 9 I.?: ; 9 'I@B: ; 9 IB4: ; 9 IB4: ; 9 IB 1!B"1#1$.: ; 9 'I@B%: ; 9 IB&4: ; 9 I'4: ; 9 I ( ).?<n: ; 9 *.?<nc /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlaccess.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.halloc.hsignals.hunistd.hDI3K-/-/2*2Ff*.2/.K/ /KL-.H i /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arpacamladdrofstr.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hin.hinet.hsocketaddr.hfail.hJJ /.(JL  K JjJ J#JW /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlchdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.hJK-/.1+1G+.g1/g/ g/KK-.H z /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/syschmod.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hstat.h@KK-/-/2*2F1+1+.*.2/g/ /KK-.H i /usr/include../../runtime/camlcst2constr.cstdint.hconfig.hmlvalues.hL.I /...Kf.J ./- ./$ ../../runtime/caml/usr/includecaml/usr/lib/gcc/arm-linux-gnueabihf/10/includecstringv.cmlvalues.hstdint.hconfig.hmisc.hmemory.hunixsupport.hstdatomic.hXL+ ~ ..~.J/ J"I#.i,JJK./%.-#. /"-. 0 ,/)../.  . 0 .f .  .K/-. /usr/include../../runtime/camlcamlexecv.cstdint.hconfig.hmisc.hmlvalues.hunixsupport.hmemory.hunistd.hsignals.hP<K-/-K-KfK-/;.- z.-/ P.KJ<*CJJKJPJP.J/ /JKJL/-// $.fw. .fw./2/ z4z/  f/". g-/ L H./G0e/ ..0. ..J/.K.K. ./ / -//K1  3) 3/)$/....-5.3../ /-/ .. +f t.89.8.9.. K3J /*89.8.9.. K .'f ,)f ...PJ fz. f3...L /usr/include../../runtime/camlcamlgetcwd.cstdint.hconfig.hmisc.hmlvalues.hunistd.halloc.hunixsupport.h(T& MK KH.J /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinetgethost.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hin.hnetdb.hsignals.hfail.halloc.hhT.-g.I/ *K 2 1+1K .1jL K ,0 K./K.(hH1(6JK.oJd .uJu /..U /..U&xf6.Q  vJ-  .I///.J&0. .K /Yf ./I, 0/'Jwf  ..Lf/ =/.J2*20 .K /&`f /usr/include../../runtime/camlgethostname.cstdint.hconfig.hmlvalues.hunistd.halloc.hWL /-/ / /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetnameinfo.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hnetdb.hfail.h@W$-f/-/.fe/y.5y.QyJ/ym/ /Z0K  J/  K -/ K-//.K.i.= /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlgetproto.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hnetdb.hfail.halloc.hxX-g./ #+K  K-/  / -/ KKKf/.uJJ. 0.K KK -&+5 , 0/K -*-.EJ /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlgetserv.cbyteswap.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hnetdb.hfail.halloc.hxY -g.-/ +K 1 K-/  ./  K-/ KKKv y.JJ/K.sJJ. L.)JJL gK -+5J 0.Jgc f. .KK I'+ /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/typescamlgmtime.cstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hstruct_tm.htime.halloc.hunixsupport.hZ 0, 0./.J/f/f/f/f/f/f/f/*/1M/ -K/K /HJJ[M/ -K/K /HJJ\-g.-/  .r.3 ./ 6r.4 ./y.5./J/ J//-./-/./K / -//  K I/  / - / -/ /./K.iJ. ../../runtime/caml/usr/includemmap_ba.ccamlatomic.hstdint.hconfig.hmlvalues.hbigarray.hcustom.hmemprof.hstdlib.h\]//.M.` ./^/.K1+*Jmy..w .-w..  J3z.1.f.J  0/ zJ/ / //0/. /0.K5- ./htf ...J 3 )// // / /D /usr/include../../runtime/camlcamlputenv.cstdint.hconfig.hmisc.hmlvalues.hstdlib.hunixsupport.hmemory.h^ . O.)JJL././ KN.v../. 1.Q LM.t. .  /usr/include../../runtime/camlcamlrename.cstdint.hconfig.hmisc.hmlvalues.hunixsupport.hmemory.hsignals.hstdio.h_.2*2J/g g. K/ /KKLHW /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlrmdir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.h8`K-/.1+1G+.g1/g/ g/KK-.H ~ /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlsocketaddr.cbyteswap.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hstring.hunixsupport.h.`.K.-/..f-.-K-/ /-Ig. K/-//-.EJ  3..|a 0..a . /-K ./- J-K-K3)KC.: F..:2/V. / ./ K ,/ 2 #f..M i+/1. I / 3)K N. / Q../2/ m.0f-g-K.f/h,fg1.)JKZ  .v. / /;z. 2; LJ2 J1.   K -/ K./ fJ/.lJ  K -/c.f.0JJp /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arpacamlstrofaddr.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hin.hinet.halloc.hunixsupport.h,deJ./ 0H02Pz.4/ /H.J /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/include../../runtime/camltime.ctypes.htime_t.hstdint.hconfig.hmlvalues.halloc.htime.hd/./i // -X /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlunlink.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hunixsupport.hsignals.hunistd.hdK-/.1+1G+.g1/g/ g/KK-.H  /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/netinet/usr/include/arm-linux-gnueabihf/syscamlaccept_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hin.hun.hsocketaddr.hunixsupport.hsignals.hsocket.halloc.hsocket_type.hPe-g-/.f//  3) O 0 M)00 /N /.,/ K/K.fJ. M /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlbind_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.hDf f3 K.H. /usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/include../../runtime/camlcamlchannels_unix.cstat.htypes.hstruct_timespec.hstat.hstdint.hconfig.hmlvalues.hunistd.hsocketaddr.hsignals.hio.hunixsupport.herrno.hsocket.hsocket_type.hf% J|.. J.|KJ + ifrJJoJ - // .L2 fJTg.0/ g/K / --.0/ g/K / --  /usr/include../../runtime/camlcamlclose_unix.cstdint.hconfig.hmlvalues.hsignals.hunistd.hunixsupport.hg.0/ ..//KH ] /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlconnect_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsignals.hsocket.hunixsupport.h$h f3/ /Kd  /usr/include../../runtime/camlcamldup_unix.cstdint.hconfig.hmlvalues.hunixsupport.hfcntl.hh1/ -N /E. - /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sysenvir_unix.cstdint.hconfig.hmlvalues.hauxv.halloc.hh/-/JK 0 fjn...nJK fK *0 , /usr/include../../runtime/camlcamlerrmsg_unix.cstdint.hconfig.hmlvalues.hunixsupport.hsys.halloc.hPih/ f/T /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetpeername_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.h|i  P - / e/ /K H.v /usr/include../../runtime/camlgetpid_unix.cstdint.hconfig.hmlvalues.hunistd.hi /./T /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlgetsockname_unix.ctypes.hstdint-uintn.hstdint.hconfig.hmlvalues.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.hsocket.hunixsupport.hi  P - / e/ /K H.d /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sysgettimeofday_unix.ctypes.hstdint.hconfig.hstruct_timeval.hmlvalues.halloc.htime.h@jLg 4. . .4J/ // -v /usr/include../../runtime/camlisatty_unix.cstdint.hconfig.hmlvalues.hunistd.hj /.K^M /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamllink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hunixsupport.hsignals.hjK-/-K.fj*jFg*2/gg.K/.Ng J./KKK-.sJ0zf v.. /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamllisten_unix.cstdint.hconfig.hmlvalues.hsocket.hunixsupport.hk.-/.LH  /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamllockf_unix.ctypes.hfcntl.hstdint.hconfig.hmlvalues.hfcntl.hsignals.herrno.hunixsupport.h$lx. .w. 4/,/2 I.K .z -/-/'f /e/ ./K.WJN.// /l.N /e/ /K  i. Ks J .K  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/sys/usr/include../../runtime/camlcamllseek_unix.ctypes.htypes.hstdint.hconfig.hmlvalues.hio.hsignals.hunistd.halloc.hunixsupport.hhm*Jh/ +/ -"/gg /c k)360,K/  //g K I-  ../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bits/usr/include/usr/lib/gcc/arm-linux-gnueabihf/10/includecamlmmap_unix.cmlvalues.hstat.htypes.hstdint.hconfig.htypes.hmisc.hio.hstdatomic.hconfname.hstat.hbigarray.hunistd.hmman.hfail.herrno.hsignals.hunixsupport.hn% Jv.  ./u.  .v./ .=J-1=,s...p. ./K+ + 0.M$G%.KK -/.LfK }j$ +M$+..// .."$-J JfJJ.6 g .+0 +03/ wJ .J2/#/-$.o /J.m  =fJ/ jK+I-/g/ifK }j$ +M$+.././ff.Jq KJf0Mf0.0-6 wJJ0!+/,0LLH.W /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlopen_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.halloc.hsignals.hfcntl.h$r:K-/-K-Kf+Ji+Pz.3)O/-)g 3/g-/./Q0.L//KN/-.nJ M Lq. /usr/include../../runtime/camlcamlpipe_unix.cstdint.hconfig.hmlvalues.hunixsupport.hunistd.halloc.hpsN. J g.J/f/tJ Lg /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlread_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hbigarray.hsignals.hunistd.hunixsupport.hstring.hsf/-/-K-/f. 3)/ /K ./-.sf .K-/-g.fy.Jy.5y.N*/z.2/-/0/ /K/-.sJ . Q\ /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlreadlink_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.halloc.hunixsupport.hsignals.hunistd.hu#g-/.-/f*.2*2*2*gN/g/ /KK/-/..sf . O /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlrealpath_unix.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hstdlib.halloc.hpvK-/..f*.2*2F2/gK././-.vJ4J( caml/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sysselect_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hmathcalls.hsignals.halloc.hw#./K....NJgJ0).K. 0/ +0-,.3 -N-g-//L, L+./(J,J*../ ./ JKg./K J..vJ ..JxK-/-g. ./t.. v..Y Kv ./I/./ I/L./ Kig*IK .../ /K g -/K-/ -/ /- / -/ /./KK.lJ  /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetcamlsendrecv_unix.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunistd.hsockaddr.hsocket.hun.hin.hsocketaddr.halloc.hsignals.hsocket.hunixsupport.hstring.hLz f/-/-K-/f.3) -// /K ./-.rf .f/-/-K-/fegeKRw..x6w . 1H0+// Z/K . /.,/ K/K.hf.  f3E3)3E3 /0/K/ /K /yf5yJ5y.5yJ5//./ /J/ /K / KJf0 /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamlshutdown_unix.cstdint.hconfig.hmlvalues.hsocket.hunixsupport.h<~6..J-/.LH . caml/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/typessleep_unix.cunixsupport.htypes.hstdint.hconfig.htime_t.hstruct_timespec.hmlvalues.hmathcalls.herrno.hsignals.htime.h~ K/iKz., E.~.wf/  /Jgf{ /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bitscaml/usr/include/arm-linux-gnueabihf/syssocket_unix.cstdint.hconfig.hmlvalues.hsockaddr.hsocket.hunixsupport.hsocket.hsocket_type.h*.L,(0.,0020 .,%. (,0 O /zJ. /usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/sys/usr/include/arm-linux-gnueabihf/bitssocketpair_unix.cstdint.hconfig.hmlvalues.hunixsupport.hsocket.halloc.hsocket_type.hi+(1.+.1000.H%.(,0 J g.J/f/uJ_ caml/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/sys/usr/include/netinetsockopt_unix.cunixsupport.hstddef.htypes.hstdint-intn.hstdint.hconfig.htime_t.h__sigset_t.hstruct_timeval.hselect.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hunistd.hsocket.hsocketaddr.hmathcalls.hsocket.halloc.hin.hP-g-g/./  wf!J N.w a"JJ9..-9K -L .YJ yf"J J b..bJl . i. ..uJ.M  ./ .t. JJy. w(N*M ././JNff JD.J0M/-K/./-g&0.@.0.4.@/JhJ//Jfh,0...L KH,0,0.L KH  /usr/include../../runtime/camlcamlkill.cstdint.hconfig.hmlvalues.hsignals.hsignal.hunixsupport.hԢ. 0../..L/G em /usr/include/arm-linux-gnueabihf/bits/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcaml/usr/include/arm-linux-gnueabihf/sysmkfifo.ctypes.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hsignals.hstat.hK-/-/.f2*.j*2F+N/H/// /KL-.sJ .  /usr/include../../runtime/camlcamlnice.cstdint.hconfig.hmlvalues.herrno.hunistd.hunixsupport.h.0 .. 0,0 2K /H f.4V /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlopendir.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hunixsupport.hsignals.hdirent.halloc.h<K-/..f).3a k/g/g/KK g/.qJ . H /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/camlcamlreaddir.ctypes.hstdint.hconfig.hmlvalues.hdirent.hsignals.hdirent.halloc.hunixsupport.hfail.h1/K/g/K / -)&2 /usr/include../../runtime/camlcamlrewinddir.cstdint.hconfig.hmlvalues.hdirent.hunixsupport.hP //K/G. /usr/include../../runtime/camlcamlsetgid.cstdint.hconfig.hmlvalues.hunistd.hunixsupport.h-/.K#H 9 ../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/usr/include/usr/include/arm-linux-gnueabihf/syscaml/usr/lib/gcc/arm-linux-gnueabihf/10/includesetgroups.cmlvalues.htypes.hstdint.hconfig.htypes.hmisc.hmemory.hgrp.hunixsupport.hstdatomic.h+ ~. ..~/J/-/'31J".LJL./KH , /usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/syscamlsetsid.ctypes.hstdint.hconfig.htypes.hmlvalues.hunistd.hunixsupport.h<0/K 3zJ. /usr/include../../runtime/camlcamlsetuid.cstdint.hconfig.hmlvalues.hunistd.hunixsupport.hl-/.K#H  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/bits/types/usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include../../runtime/camlcamlsignals.ctypes.h__sigset_t.hsigset_t.hstddef.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.hsignals.hsignal.hunixsupport.herrno.hsigthread.halloc.h'-g./ /-e./ g . 0+/ 0- /-i . Q-.J8)O.c..h../ `/K*.g..,1.J -/ 0/K KHMcML #H J.#H KzJ/(I)../ / -/.J,/(I).K K#z GJ9. E.KK*.g..,1.J</ g/Kd.(fJ. .KK*.g..,1.J/ /K gd  /usr/include/arm-linux-gnueabihf/bits/usr/include/arm-linux-gnueabihf/sys/usr/include../../runtime/camlcamlspawn.ctypes.htypes.hstdint.hconfig.hmlvalues.hspawn.hunistd.hunixsupport.h#xRx.6xJ/ guJ  J/1 i +g ./ -/ .sJL / -//  .0 ..J / .%IM J/ ... ./Kgp ../ .. /-M ./KgK gvJ 5af JJ K /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bitscamltermios.cstdint.hconfig.hmlvalues.htermios.htermios-struct.htermios.hunixsupport.halloc.hЫNf.L %Ja..%.a.%.,a. ./ ., %I/f /,X8.;.,.81J H / / %J .&J'. %K . K;`. .Jf /,_..8k,J f  / /- / /J-"J#.  K gJJ / ,n . /.p/f /,z 4.,z. Q%J ..P.z.4.)z4.L$Qd.. .,$dJ,./ *.,T.,.-/. /8S;.,.81J  .- /  /&J'. $K J K.<. J,];....8h,.!/-N f ., /  /H. /  /$..$.. 2  /,j ..m / -. /  6w.0 .0f  .<..). .-/.LH -/.K#H -..J-/.LH -..f-/.LH  /usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/sysumask.cstdint.hconfig.hmlvalues.hstat.hذ /.K /usr/lib/gcc/arm-linux-gnueabihf/10/include/usr/include/arm-linux-gnueabihf/bits/usr/include../../runtime/caml/usr/include/arm-linux-gnueabihf/bits/types/usr/include/arm-linux-gnueabihf/syscamlwait.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hsetjmp.halloc.hsignals.hwait.hunixsupport.h*-g-//N*I./M f/ . g../K.pJ0d2  . / -3 K-/..JE K-/ M/ g/K gHM+1J// /K gH  | (DIBBPX B | $<JB B(j  B F  B | (tJBBHD B | (@KBBHR B | LTH\ | XLB  M4BV | p "W j |iX    0   * ( = Q f }  Ј     @j@  &  7 H XP [ m DI ~  |a  W0  LO iX d , ;XL Qq( m ԢD +:G YizT L LT Ȩ .J >H Vl|j s _ g@ *=  [|N m~X P  Jk4  n ;K \n(T@ M4 N` ^ d (U @Uhz< @L <0 DfX ( 0t H\$rL n x ذ (E[P pX_X ̭   8 /hm ?$L SdxgH jD `  Pi, ,; Ji [8l m~q`  , ] T~ +, >O_{$lD @W8  u +BRT k$ Л P  8 TP 0DGILT  ?" (%b