! / 0 0 0 0 29396 ` sssssssٰٰٰٰqqqqqqqqqqqqq7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7xiiiiiiiiiiiiiiii VT VT VT VT VT VT VT VT 0 0 0 0 0 0 0 PT PT PT PT PT PT PT PT PT PT                                                               llllllllllllllllllllllV0V0V0V0V0V0V0V0V0V0V0V0V0V0V0V0V0V0V0V0|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||'''''''''''''''''''''''''''^^^^^^^^^^^^^^^^^^^^^^^^^^clclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclcl8888888888888888888888888888888888888888888888888888888888888888!Y!Y!!!!!!"L"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/&sl&sl&sl&sl&sl&sl&sl&sl&sl&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&(t(t(t(t(t(t(t(t(t(t(t(t(t(t(t(t(t(t+b+b+b+b+b+b+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D+D.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.2.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ.ռ//0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D0;D1111}d1}d1111t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t1t3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 3i 6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r6r787878787878787\7\7\7\7\7\8g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g08g09)9)9)9)9)9)9)9)9)9)9)9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 ;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v;v<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$<$=|=|==================???????????????????????TAAAAAAAAABBBBBBBcaml_addrmap_containscaml_addrmap_lookupcaml_addrmap_initcaml_addrmap_clearcaml_addrmap_insert_poscaml_addrmap_insertcaml_addrmap_itercaml_setup_aflcaml_reset_afl_instrumentationcaml_afl_prev_loccaml_afl_area_ptrcaml_alloccaml_alloc_1caml_alloc_2caml_alloc_3caml_alloc_4caml_alloc_5caml_alloc_6caml_alloc_7caml_alloc_8caml_alloc_9caml_alloc_smallcaml_alloc_tuplecaml_alloc_stringcaml_copy_stringcaml_alloc_initialized_stringcaml_alloc_finalcaml_alloc_arraycaml_alloc_float_arraycaml_copy_string_arraycaml_convert_flag_listcaml_alloc_somecaml_atomic_make_contendedcaml_array_lengthcaml_is_double_arraycaml_array_get_addrcaml_floatarray_getcaml_array_getcaml_array_set_addrcaml_floatarray_setcaml_array_setcaml_floatarray_unsafe_getcaml_array_unsafe_getcaml_floatarray_unsafe_setcaml_array_unsafe_setcaml_floatarray_createcaml_floatarray_make_unboxedcaml_floatarray_makecaml_uniform_array_makecaml_array_makecaml_array_create_floatcaml_array_of_uniform_arraycaml_make_vectcaml_make_float_vectcaml_make_arraycaml_floatarray_blitcaml_uniform_array_blitcaml_array_blitcaml_floatarray_subcaml_uniform_array_subcaml_array_subcaml_floatarray_appendcaml_uniform_array_appendcaml_array_appendcaml_floatarray_concatcaml_uniform_array_concatcaml_array_concatcaml_floatarray_fill_unboxedcaml_floatarray_fillcaml_uniform_array_fillcaml_array_fillcaml_record_backtracescaml_record_backtracecaml_backtrace_statuscaml_print_exception_backtracecaml_ml_debug_info_statuscaml_get_exception_raw_backtracecaml_restore_raw_backtracecaml_convert_raw_backtrace_slotcaml_convert_raw_backtracecaml_raw_backtrace_lengthcaml_raw_backtrace_slotcaml_raw_backtrace_next_slotcaml_get_exception_backtracecaml_ba_comparecaml_ba_finalizecaml_ba_hashcaml_ba_serializecaml_ba_deserializecaml_double_of_float16caml_float16_of_doublecaml_ba_num_eltscaml_ba_byte_sizecaml_ba_alloccaml_ba_alloc_dimscaml_ba_createcaml_ba_get_Ncaml_ba_get_1caml_ba_get_2caml_ba_get_3caml_ba_get_genericcaml_ba_uint8_get16caml_ba_uint8_get32caml_ba_uint8_get64caml_ba_set_1caml_ba_set_2caml_ba_set_3caml_ba_set_Ncaml_ba_set_genericcaml_ba_uint8_set16caml_ba_uint8_set32caml_ba_uint8_set64caml_ba_num_dimscaml_ba_dimcaml_ba_dim_1caml_ba_dim_2caml_ba_dim_3caml_ba_kindcaml_ba_layoutcaml_ba_slicecaml_ba_change_layoutcaml_ba_subcaml_ba_blitcaml_ba_fillcaml_ba_reshapecaml_ba_opscaml_ba_element_sizecaml_BLAKE2Initcaml_BLAKE2Updatecaml_BLAKE2Finalcaml_blake2_createcaml_blake2_updatecaml_blake2_finalcaml_blake2_stringcaml_blake2_bytescaml_init_callbackscaml_callbackN_exncaml_callback_exncaml_callback2_exncaml_callback3_exncaml_callbackN_rescaml_callback_rescaml_callback2_rescaml_callback3_rescaml_callbackcaml_callback2caml_callback3caml_callbackNcaml_register_named_valuecaml_named_valuecaml_iterate_named_valuescaml_init_codefragcaml_register_code_fragmentcaml_remove_code_fragmentcaml_find_code_fragment_by_pccaml_find_code_fragment_by_numcaml_digest_of_code_fragmentcaml_find_code_fragment_by_digestcaml_code_fragment_cleanup_from_stw_singlecaml_comparecaml_equalcaml_notequalcaml_lessthancaml_lessequalcaml_greaterthancaml_greaterequalcaml_custom_get_max_majorcaml_alloc_customcaml_alloc_custom_memcaml_register_custom_operationscaml_find_custom_operationscaml_final_custom_operationscaml_init_custom_operationscaml_custom_minor_max_bszcaml_custom_minor_ratiocaml_custom_major_ratiocaml_debugger_initcaml_debugger_saved_instructioncaml_debugger_code_unloadedcaml_debuggercaml_debugger_cleanup_forkcaml_debugger_fork_modecaml_event_countcaml_debugger_in_usecaml_statecaml_incoming_interrupts_queuedcaml_send_interruptcaml_norm_minor_heap_sizecaml_reset_domain_lockcaml_init_domain_selfcaml_ml_domain_idcaml_ml_domain_indexcaml_enter_global_barriercaml_global_barrier_and_check_finalcaml_global_barrier_release_as_finalcaml_global_barrier_num_participatingcaml_domain_is_in_stwcaml_interrupt_selfcaml_interrupt_all_signal_safecaml_reset_young_limitcaml_reallocate_minor_heap_arenacaml_init_domainscaml_update_young_limit_after_c_callcaml_poll_gc_workcaml_try_run_on_all_domains_with_spin_workcaml_handle_incoming_interruptscaml_try_run_on_all_domainscaml_try_run_on_all_domains_asynccaml_update_minor_heap_maxcaml_domain_spawncaml_handle_gc_interruptcaml_process_external_interruptcaml_bt_is_in_blocking_sectioncaml_bt_is_selfcaml_domain_is_multicorecaml_acquire_domain_lockcaml_bt_enter_ocamlcaml_release_domain_lockcaml_bt_exit_ocamlcaml_domain_terminatingcaml_domain_is_terminatingcaml_domain_terminatecaml_stop_all_domainscaml_free_domainscaml_ml_domain_cpu_relaxcaml_domain_dls_setcaml_domain_dls_getcaml_domain_dls_compare_and_setcaml_domain_countcaml_recommended_domain_countcaml_atfork_hookcaml_domain_terminated_hookcaml_domain_external_interrupt_hookcaml_domain_stop_hookcaml_domain_initialize_hookcaml_minor_heaps_endcaml_minor_heaps_startcaml_minor_heap_max_wszcaml_num_domains_runningcaml_parse_ld_confcaml_dynlink_parse_ld_confcaml_search_dll_in_pathcaml_build_primitive_tablecaml_build_primitive_table_builtincaml_free_shared_libscaml_dynlink_get_bytecode_sectionscaml_dynlink_open_libcaml_dynlink_close_libcaml_dynlink_lookup_symbolcaml_dynlink_add_primitivecaml_dynlink_get_current_libscaml_shared_libs_pathcaml_prim_name_tablecaml_prim_tablecaml_free_extern_statecaml_output_valcaml_output_valuecaml_output_value_with_compatcaml_output_value_to_bytescaml_output_value_to_stringcaml_output_value_to_blockcaml_output_value_to_buffercaml_output_value_to_malloccaml_serialize_int_1caml_serialize_int_2caml_serialize_int_4caml_serialize_int_8caml_serialize_float_4caml_serialize_block_1caml_serialize_block_2caml_serialize_block_4caml_serialize_block_8caml_serialize_block_float_8caml_serialize_float_8caml_obj_reachable_wordscaml_extern_compress_outputcaml_exception_constantcaml_exception_with_argcaml_exception_with_argscaml_exception_with_stringcaml_raise_constantcaml_raise_with_argcaml_raise_with_argscaml_raise_with_stringcaml_failwithcaml_failwith_valuecaml_invalid_argumentcaml_invalid_argument_valuecaml_raise_out_of_memorycaml_raise_stack_overflowcaml_raise_sys_errorcaml_raise_end_of_filecaml_raise_zero_dividecaml_raise_not_foundcaml_array_bound_errorcaml_raise_sys_blocked_iocaml_live_stacks_memorycaml_get_init_stack_wsizecaml_change_max_stack_sizecaml_current_stack_sizecaml_alloc_stack_cachecaml_alloc_stack_noexccaml_alloc_stackcaml_scan_stackcaml_alloc_main_stackcaml_free_stackcaml_try_realloc_stackcaml_ensure_stack_capacitycaml_free_gc_regs_bucketscaml_continuation_use_noexccaml_continuation_use_and_update_handler_noexccaml_continuation_replacecaml_raise_continuation_already_resumedcaml_continuation_usecaml_make_unhandled_effect_exncaml_raise_unhandled_effectcaml_global_datacaml_final_update_firstcaml_final_update_lastcaml_final_do_calls_rescaml_final_do_rootscaml_final_do_young_rootscaml_final_update_last_minorcaml_final_empty_youngcaml_final_merge_finalisablecaml_final_registercaml_final_register_called_without_valuecaml_final_releasecaml_alloc_final_infocaml_init_localecaml_free_localecaml_copy_doublecaml_format_floatcaml_hexstring_of_floatcaml_float_of_stringcaml_int_of_floatcaml_float_of_intcaml_neg_floatcaml_abs_floatcaml_add_floatcaml_sub_floatcaml_mul_floatcaml_div_floatcaml_exp_floatcaml_exp2caml_exp2_floatcaml_trunccaml_trunc_floatcaml_roundcaml_round_floatcaml_floor_floatcaml_nextaftercaml_nextafter_floatcaml_fmacaml_fma_floatcaml_fmod_floatcaml_frexp_floatcaml_ldexp_float_unboxedcaml_ldexp_floatcaml_log_floatcaml_log10_floatcaml_log2caml_log2_floatcaml_modf_floatcaml_sqrt_floatcaml_cbrtcaml_cbrt_floatcaml_power_floatcaml_sin_floatcaml_sinh_floatcaml_cos_floatcaml_cosh_floatcaml_tan_floatcaml_tanh_floatcaml_asin_floatcaml_asinhcaml_asinh_floatcaml_acos_floatcaml_acoshcaml_acosh_floatcaml_atan_floatcaml_atanhcaml_atanh_floatcaml_atan2_floatcaml_ceil_floatcaml_hypotcaml_hypot_floatcaml_expm1caml_log1pcaml_expm1_floatcaml_log1p_floatcaml_erfcaml_erf_floatcaml_erfccaml_erfc_floatcaml_copysigncaml_copysign_floatcaml_signbitcaml_signbit_floatcaml_float_compare_unboxedcaml_neq_floatcaml_eq_floatcaml_le_floatcaml_lt_floatcaml_ge_floatcaml_gt_floatcaml_float_comparecaml_classify_float_unboxedcaml_classify_floatcaml_localecaml_gc_quick_statcaml_gc_minor_words_unboxedcaml_gc_minor_wordscaml_gc_counterscaml_gc_getcaml_gc_setcaml_gc_minorcaml_gc_majorcaml_gc_full_majorcaml_gc_major_slicecaml_gc_compactioncaml_gc_statcaml_get_minor_freecaml_init_gccaml_runtime_variantcaml_runtime_randomizecaml_runtime_is_randomizedcaml_runtime_parameterscaml_ml_enable_runtime_warningscaml_ml_runtime_warnings_enabledcaml_gc_ramp_upcaml_gc_ramp_downcaml_ml_gc_ramp_upcaml_ml_gc_ramp_downcaml_runtime_randomizedcaml_fiber_wszcaml_max_stack_wsizecaml_accum_heap_statscaml_remove_heap_statscaml_accum_alloc_statscaml_collect_alloc_stats_samplecaml_reset_domain_alloc_statscaml_accum_orphan_alloc_statscaml_orphan_alloc_statscaml_init_gc_statscaml_free_gc_statscaml_collect_gc_stats_sample_stwcaml_compute_gc_statscaml_register_global_rootcaml_remove_global_rootcaml_register_generational_global_rootcaml_remove_generational_global_rootcaml_modify_generational_global_rootcaml_scan_global_rootscaml_scan_global_young_rootscaml_global_roots_oldcaml_global_roots_youngcaml_global_rootscaml_hash_mix_uint32caml_hash_mix_intnatcaml_hash_mix_int64caml_hash_mix_doublecaml_hash_mix_floatcaml_hash_mix_stringcaml_hashcaml_string_hashcaml_hash_variantcaml_free_intern_statecaml_input_valcaml_input_valuecaml_input_value_to_outside_heapcaml_input_val_from_bytescaml_input_value_from_bytescaml_input_value_from_malloccaml_input_value_from_blockcaml_marshal_data_sizecaml_deserialize_uint_1caml_deserialize_sint_1caml_deserialize_uint_2caml_deserialize_sint_2caml_deserialize_uint_4caml_deserialize_sint_4caml_deserialize_uint_8caml_deserialize_sint_8caml_deserialize_float_4caml_deserialize_float_8caml_deserialize_block_1caml_deserialize_block_2caml_deserialize_block_4caml_deserialize_block_8caml_deserialize_block_float_8caml_deserialize_errorcaml_intern_decompress_inputcaml_bswap16_directcaml_bswap16caml_int_comparecaml_int_of_stringcaml_format_intcaml_copy_int32caml_int32_negcaml_int32_addcaml_int32_subcaml_int32_mulcaml_int32_divcaml_int32_modcaml_int32_andcaml_int32_orcaml_int32_xorcaml_int32_shift_leftcaml_int32_shift_rightcaml_int32_shift_right_unsignedcaml_int32_direct_bswapcaml_int32_bswapcaml_int32_of_intcaml_int32_to_intcaml_int32_of_float_unboxedcaml_int32_of_floatcaml_int32_to_float_unboxedcaml_int32_to_floatcaml_int32_compare_unboxedcaml_int32_comparecaml_int32_formatcaml_int32_of_stringcaml_int32_bits_of_float_unboxedcaml_int32_float_of_bits_unboxedcaml_int32_bits_of_floatcaml_int32_float_of_bitscaml_copy_int64caml_int64_negcaml_int64_addcaml_int64_subcaml_int64_mulcaml_int64_divcaml_int64_modcaml_int64_andcaml_int64_orcaml_int64_xorcaml_int64_shift_leftcaml_int64_shift_rightcaml_int64_shift_right_unsignedcaml_int64_direct_bswapcaml_int64_bswapcaml_int64_of_intcaml_int64_to_intcaml_int64_of_float_unboxedcaml_int64_of_floatcaml_int64_to_float_unboxedcaml_int64_to_floatcaml_int64_of_int32caml_int64_to_int32caml_int64_of_nativeintcaml_int64_to_nativeintcaml_int64_compare_unboxedcaml_int64_comparecaml_int64_formatcaml_int64_of_stringcaml_int64_bits_of_float_unboxedcaml_int64_float_of_bits_unboxedcaml_int64_bits_of_floatcaml_int64_float_of_bitscaml_copy_nativeintcaml_nativeint_negcaml_nativeint_addcaml_nativeint_subcaml_nativeint_mulcaml_nativeint_divcaml_nativeint_modcaml_nativeint_andcaml_nativeint_orcaml_nativeint_xorcaml_nativeint_shift_leftcaml_nativeint_shift_rightcaml_nativeint_shift_right_unsignedcaml_nativeint_direct_bswapcaml_nativeint_bswapcaml_nativeint_of_intcaml_nativeint_to_intcaml_nativeint_of_float_unboxedcaml_nativeint_of_floatcaml_nativeint_to_float_unboxedcaml_nativeint_to_floatcaml_nativeint_of_int32caml_nativeint_to_int32caml_nativeint_compare_unboxedcaml_nativeint_comparecaml_nativeint_formatcaml_nativeint_of_stringcaml_nativeint_opscaml_int64_opscaml_int32_opscaml_finalize_channelcaml_channel_lockcaml_channel_unlockcaml_channel_cleanup_on_raisecaml_open_descriptor_incaml_open_descriptor_outcaml_close_channelcaml_channel_sizecaml_channel_binary_modecaml_flush_partialcaml_flushcaml_flush_if_unbufferedcaml_putchcaml_putwordcaml_putblockcaml_really_putblockcaml_seek_outcaml_pos_outcaml_do_readcaml_refillcaml_getchcaml_getwordcaml_getblockcaml_really_getblockcaml_seek_incaml_pos_incaml_input_scan_linecaml_alloc_channelcaml_ml_open_descriptor_in_with_flagscaml_ml_open_descriptor_incaml_ml_open_descriptor_out_with_flagscaml_ml_open_descriptor_outcaml_ml_set_channel_namecaml_ml_out_channels_listcaml_channel_descriptorcaml_ml_close_channelcaml_ml_channel_sizecaml_ml_channel_size_64caml_ml_set_binary_modecaml_ml_is_binary_modecaml_ml_flushcaml_ml_set_bufferedcaml_ml_is_bufferedcaml_ml_output_charcaml_ml_output_intcaml_ml_output_bytescaml_ml_outputcaml_ml_output_bigarraycaml_ml_seek_outcaml_ml_seek_out_64caml_ml_pos_outcaml_ml_pos_out_64caml_ml_input_charcaml_ml_input_intcaml_ml_inputcaml_ml_input_bigarraycaml_ml_seek_incaml_ml_seek_in_64caml_ml_pos_incaml_ml_pos_in_64caml_ml_input_scan_linecaml_terminfo_rowscaml_all_opened_channels_mutexcaml_all_opened_channelscaml_lex_enginecaml_new_lex_enginecaml_lf_skiplist_initcaml_lf_skiplist_findcaml_lf_skiplist_find_belowcaml_lf_skiplist_insertcaml_lf_skiplist_removecaml_lf_skiplist_free_garbagemaincaml_orphan_finaliserscaml_reset_major_pacingcaml_darken_contcaml_darkencaml_orphan_ephemeronscaml_mark_roots_stwcaml_opportunistic_major_work_availablecaml_opportunistic_major_collection_slicecaml_major_collection_slicecaml_finish_major_cyclecaml_mark_stack_is_emptycaml_finish_markingcaml_finish_sweepingcaml_init_major_gccaml_teardown_major_gccaml_gc_mark_phase_requestedcaml_gc_phasecaml_major_cycles_completedcaml_percent_freecaml_MD5Initcaml_MD5Transformcaml_MD5Updatecaml_MD5Finalcaml_md5_stringcaml_md5_channelcaml_md5_chancaml_md5_blockcaml_md5_bytescaml_modifycaml_alloc_dependent_memorycaml_free_dependent_memorycaml_adjust_gc_speedcaml_adjust_minor_gc_speedcaml_initializecaml_atomic_load_fieldcaml_atomic_loadcaml_atomic_exchange_fieldcaml_atomic_exchangecaml_atomic_cas_fieldcaml_atomic_cascaml_atomic_fetch_add_fieldcaml_atomic_fetch_addcaml_set_fieldscaml_alloc_shrcaml_alloc_shr_reservedcaml_alloc_shr_noexccaml_stat_create_poolcaml_stat_destroy_poolcaml_stat_alloc_noexccaml_stat_alloc_aligned_noexccaml_stat_alloc_alignedcaml_stat_alloccaml_stat_freecaml_stat_resize_noexccaml_stat_resizecaml_stat_calloc_noexccaml_stat_strdup_noexccaml_stat_strdupcaml_stat_memdupcaml_stat_strconcatcaml_memprof_scan_rootscaml_memprof_after_minor_gccaml_memprof_after_major_gccaml_memprof_new_domaincaml_memprof_delete_domaincaml_memprof_set_triggercaml_memprof_update_suspendedcaml_memprof_run_callbacks_rescaml_memprof_sample_blockcaml_memprof_sample_youngcaml_memprof_new_threadcaml_memprof_main_threadcaml_memprof_delete_threadcaml_memprof_enter_threadcaml_memprof_startcaml_memprof_is_samplingcaml_memprof_stopcaml_memprof_discardcaml_get_global_datacaml_reify_bytecodecaml_static_release_bytecodecaml_realloc_globalcaml_get_current_environmentcaml_invoke_traced_functioncaml_empty_minor_heap_setupcaml_do_opportunistic_major_slicecaml_alloc_tablecaml_alloc_minor_tablescaml_free_minor_tablescaml_debug_is_minorcaml_debug_is_majorcaml_set_minor_heap_sizecaml_get_header_valcaml_empty_minor_heap_domain_clearcaml_empty_minor_heap_no_major_slice_from_stwcaml_try_empty_minor_heap_on_all_domainscaml_empty_minor_heaps_oncecaml_alloc_small_dispatchcaml_minor_collectioncaml_check_urgent_gccaml_realloc_ref_tablecaml_realloc_ephe_ref_tablecaml_realloc_custom_tablecaml_major_slice_epochcaml_minor_collections_countcaml_print_loccaml_failed_assertcaml_debug_abortcaml_noalloc_begincaml_noalloc_endcaml_alloc_point_herecaml_gc_logcaml_gc_messagecaml_fatal_errorcaml_fatal_error_argcaml_fatal_error_arg2caml_ext_table_initcaml_ext_table_add_noexccaml_ext_table_addcaml_ext_table_removecaml_ext_table_clearcaml_ext_table_freecaml_runtime_warnings_activecaml_bad_caml_statecaml_runtime_warningscaml_fatal_error_hookcaml_verb_gccaml_finalise_end_hookcaml_finalise_begin_hookcaml_minor_gc_end_hookcaml_minor_gc_begin_hookcaml_major_slice_end_hookcaml_major_slice_begin_hookcaml_obj_tagcaml_obj_raw_fieldcaml_obj_set_raw_fieldcaml_obj_blockcaml_obj_with_tagcaml_obj_dupcaml_obj_add_offsetcaml_obj_compare_and_swapcaml_obj_is_sharedcaml_lazy_make_forwardcaml_lazy_reset_to_lazycaml_lazy_update_to_forwardcaml_lazy_read_resultcaml_lazy_update_to_forcingcaml_get_public_methodcaml_fresh_oo_idcaml_set_oo_idcaml_int_as_pointercaml_alloc_dummycaml_alloc_dummy_floatcaml_alloc_dummy_lazycaml_update_dummycaml_update_dummy_lazycaml_parse_enginecaml_set_parser_tracecaml_plat_fatal_errorcaml_plat_mutex_initcaml_plat_assert_lockedcaml_plat_assert_all_locks_unlockedcaml_lockdepthcaml_plat_lock_non_blocking_actualcaml_plat_mutex_freecaml_plat_mutex_reinitcaml_plat_cond_initcaml_plat_waitcaml_plat_broadcastcaml_plat_signalcaml_plat_cond_freecaml_plat_futex_waitcaml_plat_futex_wake_allcaml_plat_futex_initcaml_plat_futex_freecaml_plat_latch_releasecaml_plat_latch_waitcaml_plat_barrier_flipcaml_plat_barrier_wait_sensecaml_mem_round_up_pagescaml_mem_mapcaml_mem_commitcaml_mem_decommitcaml_mem_unmapcaml_plat_spin_back_offcaml_plat_mmap_alignmentcaml_plat_pagesizecaml_format_exceptioncaml_fatal_uncaught_exceptioncaml_abort_on_uncaught_exncaml_lxm_next_unboxedcaml_lxm_nextcaml_do_local_rootscaml_do_rootscaml_scan_roots_hookcaml_runtime_events_post_forkcaml_runtime_events_current_locationcaml_runtime_events_destroycaml_runtime_events_startcaml_runtime_events_pausecaml_runtime_events_resumecaml_runtime_events_are_activecaml_ml_runtime_events_startcaml_ml_runtime_events_pausecaml_ml_runtime_events_resumecaml_ml_runtime_events_pathcaml_ml_runtime_events_are_activecaml_ev_begincaml_ev_endcaml_ev_countercaml_ev_lifecyclecaml_runtime_events_initcaml_ev_alloccaml_ev_alloc_flushcaml_runtime_events_user_registercaml_runtime_events_user_writecaml_runtime_events_user_resolvecaml_verify_rootcaml_init_shared_heapcaml_orphan_shared_heapcaml_adopt_all_orphan_heapscaml_assert_shared_heap_is_emptycaml_free_shared_heapcaml_shared_try_alloccaml_sweepcaml_finalise_heapcaml_heap_sizecaml_top_heap_wordscaml_heap_blockscaml_redarken_poolcaml_collect_heap_stats_samplecaml_accum_orphan_heap_statscaml_atomcaml_init_major_heapcaml_verify_begincaml_verify_heap_from_stwcaml_compact_heapcaml_cycle_heap_from_stw_singlecaml_cycle_heapcaml_finalise_freelistcaml_global_heap_statecaml_compactions_countcaml_check_pending_signalscaml_record_signalcaml_enter_blocking_section_no_pendingcaml_leave_blocking_sectioncaml_init_signal_handlingcaml_execute_signal_rescaml_process_pending_signals_rescaml_enter_blocking_sectioncaml_request_major_slicecaml_request_minor_gccaml_set_action_pendingcaml_check_pending_actionscaml_do_pending_actions_rescaml_process_pending_actions_with_root_rescaml_process_pending_actions_with_rootcaml_process_pending_actions_rescaml_process_pending_actionscaml_process_pending_actions_exncaml_convert_signal_numbercaml_sys_convert_signal_numbercaml_rev_convert_signal_numbercaml_sys_rev_convert_signal_numbercaml_init_signal_stackcaml_free_signal_stackcaml_init_signalscaml_terminate_signalscaml_install_signal_handlercaml_leave_blocking_section_hookcaml_enter_blocking_section_hookcaml_pending_signalscaml_skiplist_initcaml_skiplist_find_ptrcaml_skiplist_findcaml_skiplist_find_belowcaml_skiplist_insertcaml_skiplist_removecaml_skiplist_emptycaml_parse_ocamlrunparamcaml_startup_auxcaml_shutdowncaml_init_exe_namecaml_init_section_tablecaml_paramscaml_string_lengthcaml_ml_string_lengthcaml_ml_bytes_lengthcaml_string_is_c_safecaml_create_stringcaml_create_bytescaml_string_getcaml_bytes_getcaml_bytes_setcaml_string_setcaml_string_get16caml_bytes_get16caml_string_get32caml_bytes_get32caml_string_get64caml_bytes_get64caml_bytes_set16caml_bytes_set32caml_bytes_set64caml_string_equalcaml_bytes_equalcaml_string_notequalcaml_bytes_notequalcaml_string_comparecaml_bytes_comparecaml_string_lessthancaml_bytes_lessthancaml_string_lessequalcaml_bytes_lessequalcaml_string_greaterthancaml_bytes_greaterthancaml_string_greaterequalcaml_bytes_greaterequalcaml_blit_bytescaml_blit_stringcaml_fill_bytescaml_fill_stringcaml_alloc_sprintfcaml_string_of_bytescaml_bytes_of_stringcaml_check_errorcaml_mutex_lockcaml_mutex_unlockcaml_ml_mutex_newcaml_ml_mutex_lockcaml_ml_mutex_unlockcaml_ml_mutex_try_lockcaml_ml_condition_newcaml_ml_condition_waitcaml_ml_condition_signalcaml_ml_condition_broadcastcaml_strerrorcaml_sys_errorcaml_sys_io_errorcaml_do_exitcaml_sys_exitcaml_sys_opencaml_sys_closecaml_sys_file_existscaml_sys_is_directorycaml_sys_is_regular_filecaml_sys_removecaml_sys_renamecaml_sys_chdircaml_sys_mkdircaml_sys_rmdircaml_sys_getcwdcaml_sys_unsafe_getenvcaml_sys_getenvcaml_sys_getenv_optcaml_sys_get_argvcaml_sys_argvcaml_sys_modify_argvcaml_sys_executable_namecaml_sys_proc_self_execaml_sys_initcaml_sys_system_commandcaml_sys_time_include_children_unboxedcaml_sys_time_include_childrencaml_sys_time_unboxedcaml_sys_timecaml_unix_random_seedcaml_sys_random_seedcaml_sys_const_big_endiancaml_sys_const_word_sizecaml_sys_const_int_sizecaml_sys_const_max_wosizecaml_sys_io_buffer_sizecaml_sys_const_ostype_unixcaml_sys_const_ostype_win32caml_sys_const_ostype_cygwincaml_sys_const_backend_typecaml_sys_const_standard_library_defaultcaml_sys_get_stdlib_dirscaml_sys_get_configcaml_sys_read_directorycaml_sys_isattycaml_xdg_defaultscaml_sys_temp_dir_namecaml_standard_library_defaultcaml_read_fdcaml_write_fdcaml_decompose_pathcaml_search_in_pathcaml_search_exe_in_pathcaml_sys_const_shared_librariescaml_dlopencaml_dlclosecaml_dlsymcaml_globalsymcaml_dlerrorcaml_read_directorycaml_secure_getenvcaml_time_countercaml_num_rows_fdcaml_init_os_paramscaml_plat_mem_mapcaml_plat_mem_commitcaml_plat_mem_decommitcaml_plat_mem_unmapcaml_locate_standard_librarycaml_ephe_await_keycaml_alloc_ephe_infocaml_ephe_createcaml_weak_createcaml_ephe_cleancaml_ephe_set_keycaml_ephe_unset_keycaml_ephe_set_key_optioncaml_weak_setcaml_ephe_set_datacaml_ephe_unset_datacaml_ephe_get_keycaml_weak_getcaml_ephe_get_key_copycaml_weak_get_copycaml_ephe_get_datacaml_ephe_get_data_copycaml_ephe_check_keycaml_weak_checkcaml_ephe_check_datacaml_ephe_blit_keycaml_ephe_blit_datacaml_weak_blitcaml_ephe_lockedcaml_ephe_nonecaml_search_in_system_pathcaml_executable_namecaml_add_debug_infocaml_remove_debug_infocaml_alloc_backtrace_buffercaml_free_backtrace_buffercaml_stash_backtracecaml_next_frame_pointercaml_get_callstackcaml_get_current_callstackcaml_get_continuation_callstackcaml_init_debug_infocaml_load_main_debug_infocaml_debug_info_availablecaml_debug_info_statuscaml_exact_event_for_locationcaml_debuginfo_locationcaml_debuginfo_extractcaml_debuginfo_nextcaml_debug_infocaml_raisecaml_exception_failurecaml_exception_failure_valuecaml_exception_invalid_argumentcaml_exception_invalid_argument_valuecaml_exception_array_bound_errorcaml_exception_out_of_memorycaml_exception_stack_overflowcaml_exception_sys_errorcaml_exception_end_of_filecaml_exception_zero_dividecaml_exception_not_foundcaml_exception_sys_blocked_iocaml_is_special_exceptioncaml_init_code_fragmentscaml_load_codecaml_fixup_endiannesscaml_init_opcode_nargscaml_set_instructioncaml_is_instructioncaml_code_sizecaml_start_codecaml_bytecode_interpretercaml_read_trailercaml_attempt_opencaml_read_section_descriptorscaml_seek_optional_sectioncaml_seek_sectioncaml_maincaml_startup_code_exncaml_startup_codecaml_runtime_standard_library_effectivecaml_zstd_initializecaml_stop_herecaml_event_tracecaml_disasm_instrcaml_trace_value_filecaml_trace_accu_sp_filecaml_icount// 136 ` lf_skiplist.bd.o/ runtime_events.bd.o/ shared_heap.bd.o/ startup_aux.bd.o/ unix_executable.bd.o/ backtrace_byt.bd.o/ startup_byt.bd.o/ addrmap.bd.o/ 0 0 0 644 26008 ` ELF_@@p|}x!q|#x@,'At9 -Qe)̞}>I]y(|B}?Bx,*A9 }J@9@|9@d@8}IH``A@B@ y*&9)})@8}GP*,*@8!8`xcN 8!8`xcN `|<|9)K@``|8`H`9 9U} 9@>~9 `B88 }(Q*}R9J0(}(9*}:(}(1*}2(B|K|p{!x-AD;8)9@8{.H`~8s*)x899@A ,%9 GGA@y)B})>8}IA*>})B9 I>}I9*>}):IB,<xA ,$@h,=;;@xH`p!x|@x|<size)t->entriest->entries[pos].key != ADDRMAP_INVALID_KEYIs_power_of_2(sz)*p == ADDRMAP_NOT_PRESENTruntime/caml/addrmap.ht->entries[i].key != ADDRMAP_INVALID_KEYcaml_addrmap_iter_ok(t, i): LAintW.ZAlmO5N ; :Ekey#hm E !5 Z !S "e  H t(f2  ir  c  H2( 6 (2R2( 6 (2STU9 )  O2( 6 (2STU9S TUO   V2( 6 (2S TU9S TUV# h (H2 ($6 (2S T U9$S E% yty*ky3vy< pz SSTTS T U{X tX0keyX9 i^ pos^ _^ y o S T UM 3` M C /&jm'k q im poASS T Up &l  = 3 H I~S5$ S T UB~S5$S &\  = 3 H } I~S S T UYPL tP)(K &)tK(S*@  Tt@+sz@6+iE4| t4+key44 pos9 _9 ) y o S T UM 393 ] M CS T U: S T U6S T U7&HL 3t&+key&4  i+ pos+ _+  y o S T UM 3- M CS T U(! Zt!4 Zpos!? h t1key:pos ar taDS tS;iT<rL tL9iM:r@rt@@iAAr,6Ht66i6JrI~1BH}$ > : ; 9 I:!; 9 IB1RB UX Y W : ; 9 I 4:!; 9 IB 1  !I I 1RB UX Y W .: ; 9 'I ! UH} U41B.?:!; 9!'@z1RB X!Y W &I :!; 9 I8 .?:!; 9 'I@z !:!; 9! 1U4:!; 9 I% $ >  : ;9 I : ; 9 I8 .?: ; 9 'I<!.?: ; 9 '<".?: ;9 '<#1RB X Y W $H}%'&4: ; 9 I'4: ; 9 IB(H}): ; 9 I*.: ; 9 ' + ,.: ; 9 'I :SmSSmTlTTloooSS 0oooSSoSoooommmooooommooommoooommoommoomoo S S T T U nsnUSoSnS nTkT k00YyYy Ynn ̞-Q ̞-Q ̞-QA%' ̞-Q ̞-QA%'yYynnS l  l 0 1 0 0 S i S i 1$ h h 0 1 0   n 0 1SoSSmSmSmTlTlTlooollmmlooommSSmSmSmSmTnTnTnTn,h00`YyYY,`nn,`mm,8n8DYD`ooxYyxm, L,,``pxx|                 runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/includeaddrmap.caddrmap.hstddef.hstdint.hconfig.hmisc.hmlvalues.hmemory.h &Y!  >l= ". /. rJ " t u     !.w  . ,#,#. .k  .p J   J !!>^= "  /d . </1hh !". .* u  b<uX  YX+ / !,Z,Y /"! !.>jB >>.B.>>.B.>> Ct > !@ . / .  BJ   <" A>B >  / "   /n  < cJ t f / !/ .Qu =! . +.? ?g!!/!<V.Y!< Da]  D<.F<D; F  =& =!& <s Jn <  /Ig!<gh h  `h g.,   /!K/& ?n.t0B0D F2J0N2Z0\ ~20 2 2 0 0  2 2 0 0   2 0  &3&P 30&83H&P3`&@h3x&3&3  h :&* 1 #6 )D R Y ` g Dn u [|    0  !  ( ~  >    " z9 >F  P \ ys W   , ?&    G =  v n!&* ": > G&P "\ ` i m v& 7    &&  & $ B    , &&$ R( F, B1& W&8` ]p [t U} u q&8 w    &    & &d&.&t7 G K T X a&tj z ~   & &   & $&&&& &< @ I (M &V&_&v 2z 0& &  < :& $&&& &7 H; DH ^L ZY |] pj n s&&L&& &@     i  + ./ $8&A V ZZ V_ h ol iq&d&(&&       Q       ! A% 9*&XB&S&`&v&  d ^   ~&L&&& & & 4& =  M  Q  Z  ^  g  t  x  ~& &@ & &  &   & g & ' 0 U  _&P ~   . " 9 f \ & I     I   &\ &( & .& 7 Y G  K  T  X  ^&, o&P |& & & & & &@ &  &     * k . [ 3  D  H  W  [  d&, m  }        & &( & &x 1 % ! 7 5 &4 & #& 4  `       &&&pP@T.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ L@8P& , 12 E @@@0PO X>J@A8[i7>~$u0y@]0 $&f @]00/m02 3@^5p 7^afl.bd.o/ 0 0 0 644 14560 ` ELF2`@@=!A9@?(;, AA8!8`N ``| H}: ; 9 I !IH}.?: ; 9 'I< 4:!; 9 I 4:!; 9 IB 1RB UX!Y W  .?:! ;9 'I< 7I&I4: ; 9 I?<4:!; 9 I?:!; 9 IB U1B U41H}% $ >  &': ;9 I.?: ;9 'I<.?: ; 9 'I<.?: ;9 '< !.?: ; 9 'I@z".?: ; 9 'I@|#1RB X Y W $1%.: ; 9 'I &4: ; 9 I'.: ; 9 ' (: ; 9 I).?<n: ; SSSS(S(8S8LSLShSooSoooSSSoSmSmZZYm,^3 runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/caml/usr/include/powerpc64-linux-gnu/sysafl.cstddef.htypes.hstdint-uintn.hstdint.hconfig.htypes.hmisc.hmlvalues.hmemory.hdomain.hunistd.hsignal.hwait.hshm.hstdlib.hstring.hosdeps.h z  2"    " f0 "" / . 0," / < ? K!%#X5XPXO 0/ . 8 ?/! !   .Jj< <.  X1 J ..X0     0  1X v.JL /-!/ <".== tJJ!p J. </t10!-)./",000,!closewas_killedcaml_abort_on_uncaught_exnwriteafl_writeshort intsize_tintptr_tfork__pid_tlong long int__uint32_tchar_os__int128ssize_tshm_id_endvalue__builtin_memsetshm_id_strcaml_domain_is_multicoreuintptr_tunitchild_pidcaml_atfork_hookread__int128 unsignedlong long unsigned intafl_initialised__ssize_tmemsetintnatlong intstrtollong doubleunsigned charGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesfullkillsigned charuintnatuint32_tunsigned intafl_readcaml_afl_prev_locshort unsigned intshmatstatuscharshm_id_Boolruntime/afl.clong unsigned intwaitpiddoublecaml_setup_aflstartup_msgcaml_stat_blockcaml_fatal_errorcaml_reset_afl_instrumentationasize_tcaml_secure_getenv/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_afl_area_ptrcaml_stat_allocGCC: (Debian 13.2.0-18) 13.2.0zRxA tPCH BC A AABDA~d AACAA AFGJAAAAA~Q AAAAAA HC BB CBxQpA~CFA   2CPRelrx}xafl.cafl_initialisedcaml_abort_on_uncaught_exncaml_atfork_hookcaml_setup_aflcaml_secure_getenvstrtolshmatwritereadcaml_domain_is_multicoreforkkillwaitpidcaml_fatal_errorcaml_stat_allocmemsetclosecaml_reset_afl_instrumentationcaml_afl_prev_loccaml_afl_area_ptr2200J2V0Z0` r2v@   $ 4 P x       22608 D X v2z@! ! 20 2P0P 2(0(  20 &2*0, 62h:0h< ^2f@r2v@ 2@&&&3&P 3  5&*/F=D^\~h[ocvk}w6<q[C-MT% %0|BPUcj o{$&L#&3&5KVXd,qdM".9&PPZ ^  c&~& ? 7 i [      ,w)3 7 @&I AX \ a&& L  &&&&&& W$ W2&S&p&&(&@&&X&&&4 &/&8  C  Q&,t&&P&h&&&&&< &L9&`W&l&(v&$&&D&hC2M &&P.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@x@&,12E@@#0O0J@#`Y@T@$H  e 4es 0@10b67@180m0 4@1P0x X1alloc.bd.o/ 0 0 0 644 102536 ` ELF@@|(A|#x|}x!QA(A((#A,=Ap!x="a)})j,?AX?{$!J})R?H`?_|*H@Al{Ud?`})?c{c*{{{g{gc{cx?;98x?x?|)@7;@(Ads9 8xA0,(A,(@|8;;,=8;A$yJ}I88; 88B#xp!xa8!A|N ``?,)AhAD(|#x|xAL>9)>H`>^|*H@A8= a)jy)e)a)_;|*H@H= xa)y)e)a)?8!a|N <@L ??c*c{{ggcc;w; x```?|)@X;|?@@;8! cx[!Aa|N <9)*?;9?xApa??`c{c{{{g{gc{c?|)@h7;@a{$9@9=;ZHP#x}]*Iɮ8!!A|N ``<~x} })^N!A(!a|dx9)|{HP|cH`7@:a8!!Aa|N `88`H:8!!Aa|N ```<Ax(#|xA(,#Axj$!J>})R>H`>^|*H@AL{Ud?9)?cc*{{ggcc~;{~x``>|)@x7;@cxax8!|N ```H`|{x|cxax8!N `<Ad9!p9@98>8`ApAxHA8!C|N ```<A9!p9@98>8`AAxpH`|xH`9 9@})9?``I9)B8!x|N < 0wosize <= Max_young_wosize(wosize) <= Max_young_wosize(wosize) >= 1<5*P: T6int"M j"Y"c,o7WoZ:lm8 9 O.:; X(Nc"N(2(9 ;;w < >" ?  w:?< "  B   " % (7( +0 .8 2o@ 6tH 9P =X A` Ch Fp Ix Lހ Pވ Tސ [ޘ `Ҡ rި tk w޸ y { }   w     B M( 0  8=id M@ MH wP %X %` h p x   1 ;      M    E O   w8 +7sp 0  1  3  :M ; .  < (id = 0  po u7sp w  xo < 7EFG:8Hp y @       _  , 6 @ J> &? 22m TA~ - w  "@/Y ~ H \ { # ($ H0%%8"$MH w w 4$\ w M-v w v v a$  855end55ptr55 5(50 7:8 w9 : w8<<end<<ptr<< <(<0 >? wmem@ maxA 8C CC CendC CC CptrC CC C C(C0 @  :   w ! w " w #7 )-  w),   w..  Y#8w A A   /#V \ \ ~ #+ .A #/w w#$w  )X m M M B >. w  C e " Y " M Z%!w z*v!1w/# z!#0#!#M&sz$&res% w$ &i' !(w 2S7T0 JS S T U # %w *v(w/ z!0!M! w 3!w OS1T0 S T U %MH D-wE>HT&resM% w3*arr >31S TS ^wlen'  w!m2;';;;;; 2;;;;; S T U STU1V1W0  T  Fwk++zarr73 z nbr Gvww~M n w8 ST08<S0T0 S T U$wz Y kwlqs/Y len  res wH \6+?L;S<STU Swllen-fun<rmem-max; FST T3$UVIwL3len:3pKY wwqlen. w  8m;@;;;1;; ;;;;; S T U STU1V1W0 S TU S TU VST  wn,18SST0wT+-tag; wum;;;;;; ;;;;; S T U DSTU1V1W0 oS TU S TU S T U S TU "S TU MS TU S TU S TU S TU S TU (S T U SS TU ~S TU S TUwtag&a1wb:wcCwdLwe&wf/wg8whAwiJw vw~5m z~MMV'j<STUH j<STUH ST9U1V1W0 S T U;j;;;[;; ;;;;; S T U  S TU S TU(\ j  S TUw:w!tag&a1wb:wcCwdLwe&wf/wg8whAw vw! m z!~M~M'j0 j \ST8U1V1W0 S T U;;;;;; ; u;;;; S T U  S TU S TU 'j  S TUw!.:w$tag&a1wb:wcCwdLwe&wf/wg8w vw$$Jm#  z$~M~M" j" j "ST7U1V1W0 S T U;#;;;#p;; ;#;;;; S T U $"S TU S TU8$q j  S TUw$:w(tag&a1wb:wcCwdLwe&wf/w vw('m& z(~M~M& j&* j &VST6U1V1W0 S T U;&;;;&;; ;'o;;;; S T U 'S TU S TU$' j  S TUw(/:~w+tag~&a~1wb~:wc~Cwd~Lwe&w vw++)m) z+M~M)v j) j )ST5U1V1W0 S T U;*^;;;*O;; ;*;;;; S T U +S TU S TU8+P j  S TUw+:yw.tagy&ay1wby:wcyCwdyLw v{w{..{m-B{ z{{.~{M{~{M, j{, j{ -ST4U1V1W0 S T U{;{-;;;-;; ;{.,;;;; S T U .WS TU{ S TU{. j{  S TU{w.:twt2tagt&at1wbt:wctCw vvwv21vm0v zvv2vMv~vM0 jv0% jv 0QST3U1V1W0 S T Uv;v0;;;0;; ;v1j;;;; S T U 1S TUv S TUv1 jv  S TUvw2:ow5ytago&ao1wbo:w vqwq5y5qm3q zqq5yqMq~qM37 jq3R jq 3~ST2U1V1W0 S T Uq;q4;;;4;; ;q4;;;; 4S T U S T U 4S TUq S TUq5C jq  S TUqw5:jw48tagj&aj1w vlwl88Clm7l zll8@lMllM6 jl6 jl 6ST1U1V1W0 S T Ul;l7x;;;7i;; ;l7;;;; S T U 8S TUl S TUl8j jl  S TUlw8:!w;+!'tag!5# w:,m;,9;;;9;; ;,: ;;;; S T U :6STU1V1W0 :aS TU, S TU,: i.: i4 :S TU% ;S   ;NS T U& ;lST  STJ;,$w,54'iK(M< ,(=m+ 4+< + BLd<+6?L  1 1U : ; 9! 1I!I/  : ; 9 I8 ( <!4:!;9 IB"&I#.?: ; 9 'I<$'I%.?:!;9 'I@z&4:!;9 IB'4: ; 9 I(:! ;9 I).?: ; 9 '<*:!;9 IB+:!; 9 IB,: ; 9 I-'..?: ;9 'I</4:!;9!I04:!;9!I1H}21RB UX!Y!W!3:!; 9 I4 5% 6$ > 7 8GI9&:> I: ; 9 ;5I<  : ; 9 = : ; 9 I 8>: ; 9 I ?4: ; 9 I?<@> I: ; 9 A.?: ;9 '<B.?: ; 9 '<C.?: ;9 '<D: ;9 IBE: ;9 IF.?: ; 9 'I@|G4: ; 9 IH1RB X Y W I.?: ; 9 'I J.: ; 9 ' K.: ; 9 'I L.1@zM.?<n: ; *?RSSTTSTTq#0STmTTST0ST7SSSSToTTSSS1SToTTSQQSRRSRRq#0QRoQR0RRSRRSPPSQQSPP0PQZPPSPPTPPSLMSMMoMNSNNSNNoNOSOOSOOoOOSOOSOOSOPoLMSMMoMNSNNSNNoNOSOOSOOoOOSOPoMNkNNSNOkOOSLMnOPnMMnOOnMMYOPYMMnOOnMMYOPYMMoMNSNOSMNkNNSNOkMN0NN1NO0HISIKnKKSKKnKKSKLSLLnHITIKkKKTKKkKKTKLTLLkIKiKKKKiKKIJ0JJoKK0IK0JK0KK1KK0KKKKSKKKKqFFSFFnFGSFFSFFmFFoFGSFFnFFSFFmFFSFFoHHSHHoHHSHHTHHTHHUHHnHHUHHVHHmHHVAASACjCCSCCjCCSCDjDDSDEjEESEEjEESEFjBCiCCSCCiDDSDDSEEiCCYDDYABnBC3%CC3%CCS#3%CC3%CDnDDS#3%DFnBBYDDYBBoDDoBBYDDYBBnBC3%CC3%EEnBCiCCiEEiBB0BC1CC0EE0@@S@AS::S:;n;<S<=n==S==n==S=?n??S?@n::T:;l;<T<=l==T==l==T=?l??T?@l;<k<<S<<k;;Y<<Y;;o<<o;;Y<<Y;;n;<S;<k<<S<<k;<0<<1<<045S55n5555 y $57S78n88S88S88S8:n45T58T88T88T89T99q9:T45U58U88U88U89U99q9:U45V58V88V88V89V9:V45W58W88W88W89W9:W45X58X88X88X89X9:X44Y45q58Y88Y88Y89q9:Y45Z58Z88Z88Z89Z9:Z4445q#p5666q6888q#p8889q#p9:4445q#x5666q6888q#x8889Y9:56j66S67j78j77077177077178088055Z77Z99Z55o77o55Z77Z99Z56967956j67j550569668679669x666x..S./n//@// y /1S12n22S22S23S34n..T.2T22T22T23T33qp34T..U.2U22U22U23U33qh34U..V.2V22V22V23V34V..W.2W22W22W23W34W..X.2X22X22X23X34X..Y..qH.2Y22Y22Y23qH34Y..Z.2Z22Z22Z23Z34Z....q#p.000q0222q#p2223Y34/0j00S01j12m 220221222223224225226227228220220//Z11Z33Z//o11o//Z11Z33Z/08018/0j01j//0/08007018((S()n))H)) y )+S+,n,,S,,S,,S,.n((T(,T,,T,,T,-T--qh-.T((U(,U,,U,,U,-U--q`-.U((V(,V,,V,,V,-V-.V((W(,W,,W,,W,-W-.W((X(,X,,X,,X,-X-.X((Y(,Y,,Y,,Y,-Y-.Y((Z(,Z,,Z,,Z,-Z-.Z)*k**S*+k+,m ++0++1++2++3++4++5++6+,7+,0++0,,0))Z++Z--Z))o++o))Z++Z--Z))7*+7))k*+k))0))7))6*+7)*0**1**0**1"#S##n##P## y #%S%&n&&S&&S&&S&(n"#T#&T&&T&&T&'T''q`'(T"#U#&U&&U&&U&'U''qX'(U"#V#&V&&V&&V&'V'(V"#W#&W&&W&&W&'W'(W"#X#&X&&X&&X&'X'(X"#Y#&Y&&Y&&Y&'Y'(Y#$j$$S$%j%&m &&0&&1&&2&&3&&4&&5&&6&&0&&0&&0##Z%%Z''Z##o%%o##Z%%Z''Z#$6$%6#$j$%j##0#$6$$5$%6$$6y$$4ySnX y S n S S !S!"nT T T T !T!!qX!"TU U U U !U!!qP!"UV V V V !V!"VW W W W !W!"WX X X X !X!"XkSk m  0 1 2 3 4 5 0 0 0ZZ!!ZooZZ!!Z55kk05450101Sn` y SnSSSnThThTTThUiUiUUUiVjVjVVVjWkWkWWWkkSkm 0123400123401234ZZZooZZZ44kk043401234SnyhSnSSSnThThTTTThUiUiUUUUiVjVjVVVVjkSk TUV hijijjs hij hij hij hij TUV TiV hiV hijm 01230 01230123YYYooYYY33kk00123 S n p z  SnSSSnSn T k TkTTTTkTk U l UlUUUUlUl oSo TU kllsklklklTUTlklm0120 012012 YYY oo YYY 22 oo 01201012So sx S o S S S oTm T m T T T T m n S nTm m @ T m l 0 1 0 0 1 0 1Y Y Yn nY Y Y 1 1 n n 0 1 0 0 14S4mZwSSmSmSmSSmZm4T4jTTjTjTjTTjihiSShSSShiSSYYooYYmmihh0 "01010101010101010.(x10.(x#10.(x10.(x#GGSGGmGGSGGTGGnGGTGGSGGoGGS,*Pl                           " !" !"       """""""""$$'#$$&''##%%#####$$%%&''%%%%%%%%%%&&&&&&&&&&(((((((((**-()*,--()++))))))*++,--++++++++++++,,,,,,,,.........004.00234//11/////0011234111111111122222222224444444446795678995577555556777899:<<===>>>????@@@@@;;<<;<<<ACCCDEEFABDDBBBCCCJKKKKKKKKKKKLNNNNOOPMMOOMMMMMMMNNNNO+ runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includealloc.cdomain.hmemory.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.halloc.hcustom.hstring.hstdatomic.h !#i!//Mf. / X/  . ~  !~  !!!~ .. /" .~ A=J/JA+  /. A +  . / A+  /A+  / A +  /A+   < JZJXLC dC  2 200 &282084 J2PV0PX r2hv2~0h0 2h20h0 22P00P Z X C \ "2h &2 .0h 20 4 DC   2 2 0 0  28 08  2P "0P $ 62 :2P B0 F0P H ~Z X C  2h 2 0h 0  C @  2 2 0 0  28 08  2P 0P  22P00P  ^ZjXpC 2h20h0 C( p 2200 2808 2P0P 22P00P .Z:XDC r2hv2~0h0 C ` r2v2z00 2808 2P0P 22P00P Z*X0C| b2hf2n0hr0t C ` r2v2z00 2808 2P0P 22P00P Z*X4C r2hv2~0h0 C p 2200 2808 2P0P 22P00P .Z:XDC 2h20h0 C" 4 H" ` r2v2z00 2808 2P0P 22P00P V2Z0jZnXpC B2hF2N0hR0T x 2200 20 2200 Z2X C*0, B2F2PN0R0PT f2r0t ~2808 22 00  20 20 2808 2 0  "2 .0 0 >2 J0 L t Z X C  !2h!2!0h!0! " "  "x " "2"2"0"0" "2P"0P" #<' #H% #X" #% #" $(* $<+ $Z$X$C%( %x- % &2&2P&0&0P& &>Z&BX&DC& '@ 'r2h'v2'~0h'0' ' ' ' ( (6&2(:&0(<, (Z(X(C(# )22)62P)>0)B0P)D )nZ)vX)xC) )3 *"2*&2P*.0*20P*4 &3& 30&083H&P3`& ph3x&P3& 3&3&3& 3&3& p3 & (38&# @3P&#X3h&$p3&$p3&&03&(03&(P3&(3&)`3    &* / M= ED f  r y    2    t   ~   8 N   # ) "/ 5 6>  C O Q` {l  x K   ~    B    \ +  6 A L 0W  b  wm x  6 &        v 5 s    ( 3  4> J WV b n  Lz  ?    O    # a   a  $  0  <  H T  c`  l cx 6   5  Y  f m V  i  }    = TI  b  z  Y         F    n   ( >-  7  A K  !U  ab s    D d    Z   s W  "    ) 1   ~        8  H- ; G 1a  { ~     D    1     ~ )  6  K  R  W } i  o ( u  N {   7          = G  b      M  x  a (  $ 3&)` S  W  \  g  r 0 v , {  p C A N L ] W &) u s &)   O   ~ &) 3&) K&*< \&P i&  &(        p        &)   O *  .  4&) P&)L a&P n&  &(P     q   E &(0  &(@"&&9 @C&&0d 8h  m )w {        & "&&  9 5  L H&& _ [ r n&&,&&5 B F O S \ e i n&'&&h&(&'H&'&'&' T&$p* 4 8 G 2K $P \ f rj jy }      p   _  &% j  O  &%,!&%=&&N&P[&  &#     ) % < 8&#H&#H M K Y U l h$&#L<&#`]&#Dr j|&$  {      &$0&$D @  M  W& x |    m a     )   / &  D D  &! % !( 8, 42&!E&!,N O] Oa Gj zn tw O  &!&&h&"&"&&""&P9&" W&"d&"r  |& p  & x  g& )   A -     " 2&; K T X a&z ~   && $     $  &\&&h&E&Z&p&4&&\&P&&&8& &#& 8&8N& 8_&v&&&&&|&& & &)&>&T& i& & T&   @&  E 1      F  :    z'  +  8  <  I  YM  MZ  ^  k  o  t   c  ]  x       {  y       "      &6& W&<t  x  }&P&<&&P&&    #  ,&E  I  R  V  \&o&x       &  "   =  5&&&h&&8&&P6&$S  kW  g]&hj&{& Y&          J  <        # '  4 X8 JE I V Z _ l Ip Cu  x "  R   a _   { i "     ] ' + 1&$]&n&P{&& 2 2  &     & & =  )  % ' > + : 4 = = U A M F& W& d&h v& &8 & &P & &x &!&!/ L!9&!Z !^ !k !o !| G! 9! ! ! ! ! ! ! S! G! ! ! u! ! !  x! " " " "( "2 "6 "; "I "S "W "\ ""j  "t @"x >"} " K" I" " V" T"&"&"&P"&#&|# #+ #4 e#8 _#A&#Z #^ {#g #k #q&#&# # # # # # # # #&|#&#&h#&$ &8$#&$4&P$K&$h  $l $r&h$&$&$ ?$& $ A$ -$ $ % % % A% 5%' %+ u%8 %< %I %M %R %_ ;%c 5%h  x%v % % 6% % % S% Q% % % i% [% "%  % % % A& & & e&! &% &+&&W&&h&P&u&&&& & & & &&& & & & &&&&' !' ' '! ''% #'. !'7 >'; 6'@&'Q&'^&h'p&'&8'&'&P'&' l' h'&h'&(&(0  (:&P([ (_ (l (p (} K( =( ( ( ( ( (  ( ^( Q( K(  x( }( ( ( ) ) i) g) )( )2 })6 q); ")I  )S )W )\ )m )q )w ) ) )&0)&)&P)&)&) * * * * &*9 *= *F *J *P&*c&*l *{ * * 3* /* * J* B*&*&*&h*&*&8+&+&P+*&,+G |+K t+Q&x+^&+o&+ (+& p+ + + +  + h+ X+ + , , , , K, E,%  x,3 ,< ,H #,Q ,] ,g c,k a,p ,~ , u, k, ",  , , , ., , , C, , ,& H-&(-%&P-2&-G& -P -` -i -m -v& - /- +- D- >-& -& @- - ^- Z- s- o- - - -& .&.&h.-& .B&8.X&.i&P. S. . .& .& .&. .&/ / / T/! B/. /2 /?  /C /H T/U Y/Y S/^  x/h /l o/q x/z / / / /  G/  E/ / /  W/  O/ "/  /  z/  x/ 0  0  0 0  0  0&& 0R& P0c&P0p&0& \0 0 0  0  0& d0  0  0 ! 0 !0& d0& 1 1 !$1 ! 1 !91 !51) 12 !J16 !H1;& <1L&1Y&h1k& 1&81& ,1&P1 1 ![1 !S1& 1& 1&2 2)&02J !2N !|2[ "2_ !2l "2p "m2u 2 "2 "2  x2 # 2 "2 2 2 .2 2 2 #2 #2 2 2 #2 #2 "3  3 #3 #3 93. #32 #38 I3I #3M #3S&3&3&P3&3&3 3 3 #3 #3&3 $3 $4 $,4 $&4&4$&4- 4< $F4@ $B4I $[4M $W4V 4_ $t4c $j4h&4}&4&h4&4&4&h4&<4&84&`5&P5&(5: $5> $5D&5Q&$5b&5 5&5 $5 $5 %)5 %5 `5 %x5 %r5  x5 %5 %5 u6 6 6 6" 6, %60 %65 6B 6L %6P %6U "6c  6m %6q %6v 6 &6 %6 6 &6 &6&H6&6&P6&7 &D7 7$ 7- &,71 &&7:&L7S &F7W &B7` &[7d &U7j&L7}&7 7 &u7 &q7 &7 &7 7 &7 &7&7&7&h7&8&88&8-&P8D&8a &8e &8k&t8x&8&8 8&8 )8 &8 &8 '~8 'f8  9 '9 '9  9 9$&9- %9= %9F (S9J (O9S&9l (f9p (b9y (y9} (u9&9&9 09 (9 (9 (9 (9 09 (9 (9&9&9&h: & :7&t:L&8:b&:s&P: J: ) : (: U: ): )z:&:&:&;&(;&8;&l;2& ;?&;O&;m&;z&; ;  ; ); m; ; ; e;  x<&#P@A\ J*, A*y)A<A9 y)|>H@AP8xH`|wx:;``` {$6 |c x$y)$|"H`7;J@|>@@a8!~x!A|N 8`H`88`H`|wxKL<A>;F _x>x;`;::H ```9;|4H@AX};Kx? }*H|*@A^ J*, @8~x~óxH`9;|4H@@```,=A(=@T9 !Ay)a|=H@AH8xH`:::\|sx` 2 Y ,6y)$RArz$~޳xP:6A,|P*|;H`~>yAD```|;;H`|;H`7@~|;@:@`|=@@L~cxH`!Aa|{xAcx 8!0!a|N 8xH`>;z$;|{x` {$ |j 6x$|2| H@L,()A,%|#x}DPAp9e|+xAH,#A,,#A|0*}e[x9$|!*8|I*9),%|I*9)A@y} 889 |I*9) |9*|1*|A*B|?@:J@ |>@A<A;ap;;Ap899[8```?' ?i)y)* ,?@=}xfxxDx})]N!A(|xAAa8! x|} N {$cxH`|zxcxH`||yA$cxH`|{y@xH`CxH`H``CxH`xH`cxH`Aa8! x|} N ``#c8p88p8`})]N!A(8! |xx|} N `#cxcN `chc|c4Tc~N |uA #y)|) @@x$|d*N |!H````||}x|t!q#y)@,?A=y)|)@@?{$j,?A,?9)?H`?|(H@A9@= a)Hy)e)a)_;|*H@H= 8!a)xy)e)a)?|N `<y)|)@@`{$8!8`N #, A|<A`9 88`8h89p!!u9A!!xpAA(?@9 y)|?H@Ap!hq*@p?\|)P@@,a?b{[|)P@A[|)P@@<Ax9 8PaP88p89!!9A!!!pxA#y?A #q*!@), A8! N |(?8x0A H`!P(?a) At9_9?qH9A$P,)!9 A@yIB})PA9(|8*| E9PA|8*| MBH`0a8! |N ``|<!qA|px||x|+x|#x#, Al=, As@=")t|t)|=H@@="))|=H@A|<Ax$x$|@ps0P;A,|;H`yAD```|;;H`|;H`7@8`H`px|8!8`} N `|& @@|2"{$x$;P@s;A |;H`yAx|;;H`|;H`7AD|;;H`|;H`7@K `=x$x$|i|x|@@L,((A| |# @@s}$P9A| ,(|!*8AyJB}ID| }I!*9D| 8} Q*BK|``<@ps9xA<,*A$,*A}Cx;;;,>;A(y)}); BH``|sA,>9 @ax?b. {{j|<As@T:|=H@@="))|=H@Ax=")), A {,#A\x8H`AD;,)A`=] |)P@A@xH`=9I]7;@Lax@d|8!8`A} N |)@@="),>)}ptr == ref->limitHR(pASint b/[,g-AT  Wg ZA lD mDU   $A+ A  CV O5< X Y8 N[/8 28 9;W/<>/?B /-$= A?X" "% ((+0.82@6H9P=XA`ChFpIxLPT[`rtwy>{H}RW      O( D0 a8YidO@ OH P .X .` h p x   k u      O       ! /+ +  0E F G_8 H p + 0@> >       + C+ M + \+ f+ p0@,jmpAd B> C z+ =&=722 =*$g A?E, F! OF"+Z= A=F,E.d[buf/= J<i77273085& 5&,end5& 5&,ptr5& 5& 5D( 5D0 07_ 8  9  : 08< <,end< <,ptr< < <D( <D0 +0> ? ,mem@ ,maxA 08C h C h,endC h C h,ptrC h C h CD( CD0 7]:\ $ A<       ]8 ^   3]  3/ Gf3S # -a 9D-Z OD3- f-+ >5-/ -/ >5H"HKIJ  -, - -: .-$ I_d [V` r3, a 3X OO |I e V O GlK&& & val &>}|  4 .KSSTTUUVV,} # val0 ofs len fpM O9 old  ref  fS S T U  S T U bA   TU0 S T U  S1 S T U ?% %%#&val0?% &ofs&len#&d/..l al(.S TS al0.S TS al-.S TS@</ al= ~' })  |) n i l  res >A# A21ABBBBcSTUV 9S #S #S /S GS  lS S SdS0T~U}V|$ A$ AP a1( a22 Pp `` `P IA)AU  BBBB"TS2U`VPS2U`VPA#A21ABBBB4A#0A21ABBBB$` A$p Ax a10 a2: Pp `` `PA#iA21ABBBBA#0A21ABBBBS2TpU`VP{x a1{- a2{7} Pp~ `` `PA# A21ABBBBA#0A21ABBBB"TS2TpU`VPs as% ofss. lens9u pv )hw )`4x AAU BBBB"TS1S1$) A$9 AkT ak- ofsk6 lenkAm pn )ho )`S1TpUhV`cT ac* ofsc3 lenc>e pf )hg )`"TS1TpUhV`eK%K'%L&%M' %N' 9iQ'"T@"E/./ / "E>~O res  * i STU  IS Jt pos% b i&( dst) src*"J4%g+%%~%rAq A)AA2% R%%%)%H ST0 S T U .! pos7!{ i8f src9(: O!BS"8 O!_S"8 OS"8 .!ST0 !S S T U @!G ["S0 S T U  >  /"J@%g,+, , "E>~O res    pos $ i>A#:BBBB $S T U  IS $T iHS3$"J$~  $ST [$S0 $S0T %S T U  %6S T U   [%MS0 S0TK%&dst%&src,"O% 9i"J% & a1&0 a2<F n&L&&zSSTTUUVVWW')) a1  a2) n5 src dst *(J++*Aqo'A)AA2+P')++)+*)+62+DH(3)+E+O+P)+\ U3$ r(gS"8 r(S"8 r(S"8 (S1 r(S"# r(S"# r)S"# r),S"# r)IS"# )|S T U  )S T U  S T U * a1+5 a2AK n+ *T 2$ "U3$ *S T U  S T U Kk+k&dstk/&srcl5+p%m"M+D9ivw "Jw +u9i{| "J| +| /+kY+Y&.-SSgT+&lenT+O8- lenO%O0B/m,Q //|!/m -//|B1  2 1.2SS1&'/' /Q'2*"E*>**O+ +NvXNresP,~,O.0SM.5.{ i=( d>.(? ? ..CA. .BBBB /ST  /CS T U * .? /m&len .5/Clen&1"L1Olen.9"E>POhres@P~O 0 [S00i0i0 1S T U .10ST0  1YS1T1  .1ST0 1ST0 1S T U IS 52Clen+652|4A.6res  6i."4Olen-  42#A3]:A(A2A3NAA #A?3AXALAdAe S T U 4STU1V1W0 S T U .4PST 4hS [4S0 IS "P5{,9F#6 5m666(6 rS T2$ S"TU'5{"61>Jidx d .6(.!A6BBBB S T U;6/<H6idx "07P,9'7P"z9z1z>idx| d} .res~ 9)#A8U:A(A2A8FAA #A?8AXALAdAe S T U 8ST1U1V1W0 S T U#A9tBBBB S T U"nx:n%n2n?#<v :<<<(<!A\:BBBB r:S T1&3$S"TU ':"b<b*b7bDidxd de .;ii.!Af<BBBB!Ag:A(A2A>AA #A?G?rAXALAdAe S T U ?ST1U1V1W0 S T UG#AC@BBBB!AD@{BBBB @S T UC 55@5*576idx7 "*O A#*+5 A? -iAq$56i;mAo Ao ;(OA(=+ +A+jO;+B+Cval8 A *CAB4AU BBB)B'LCSSTT'*A#CA21ABBBB*@DDI@@@!A8D;BBBB *<`E1<<<<!A\DBBBB rE#S T1&3$S"TU *2Fi2%212=2I22UlE2V2`2a2m!2F"2%21)2=)2I [ F@ST  IS *1F12 .2SS1&*/m8G/|/!/m G//|B1  2 1.2SS1&'/*/QG/`.2|SS*H:Q!*}HQV4 kI~1B41BH}( IH} : ; 9 I 8  !I :!; 9!I!8 :!;9 IB : ; 9 I8 4:!;9 IB4:!;9 I:!;9 IB4:!;9 IB: ; 9 I U:!; 9 IB$ >  1U.?:!;9!'I@z 1H}: ; 9 I4: ; 9 I 4:!;9 I1RBUX!YW 4:!; 9 IB4:!; 9 IB !I/ !1RBX!Y W ".?:!; 9!'I@z#1RBUX!Y W $I%:!;9 I&:!;9 I'H}( U)41*.1@z+<, : ; 9 I8 -.?: ; 9 'I<.H}/&I0 : ; 9!11RBX!Y!'W! 2 13.?: ; 9 '<41RBUX!YW 5.?:!; 9 'I !64: ; 9 I74: ; 9 I?<8: ;9 I94:!;9 I:1;.: ; 9 'I <>! !I: ; 9 =: ; 9 I >1RBX!YW ?.?:!;9!'I !@.:!;9!'I@zA 1UB1RBX!YW C: ; 9 IDGIE !!: ; 9!F :!; 9 I8G.?:!; 9!'<H.?: ; 9!'<I.?: ;9 '<J K.:!;9! ' !LH}M N4:!;!9!IO:!; 9 IBP4:!; 9!IQ1R% S$ > T U : ; 9 V&W5IX  : ; 9 Y : ; 9 I 8ZI [ : ; 9 I 8 \> I: ; 9 ]4: ; 9 I^'I_.?: ; 9 '<`.?: ;9 'I<a.?: ;9 '<b1RBX YW cH}dH}e.: ;9 'I f g.?: ;9 'Ih4: ; 9 Ii.: ; 9 ' j.: ; 9 'I k.?<n: ; 1$OOSOOSOPSPPSOOTOOTOPTOOUOOUOOUOPUOOVOOVOPVOPVOOUOPUOPTOPSOP OPUPPUPPuPPUPPuOPt1&PP t1&uz"PP t1&uz"#PP t1&uz"PP t1&uz"#OPSPP t1&uz"PP t1&u "z"PP t1&uz"PP PP PP PP IISIKmKMSMMmMOSOOSOOmIITIOTOOTOOTIIUIOUOOUOOUIIVIMlMMVMMlMNVNOlOOVOOlIIt1&IOT1&OOt1&OOT1&IJnJJYJJnJJJJnJJJLnLLLLnMMnNOnII t2$ s"IJ T2$ "JJJJoJJJJoJJJJoJJoJK T2$ "LLLLoMM T2$ "OO t2$ s"OO T2$ s"OO T2$ "KK0KLmNNmNOmLLmNNmFFSFFTFFSFFSFFTFFSFFSFFTFFSSmSSmSSmSToToTTjSjlSlkSk0nn00TYYoYSSoSSYYyxYDESEEtEESEESEEtEFSDDTDEYEEq8EETEEYEEq8EExEEq8EFTEEq0EEVEEPEEq0EEVEFPFFqPEEq EEUEE`EEq EEUEF`FFq`EETEEpEETEFpFFqpEE2EF2EE0EE0EE1EESEEq8 EEsxEE q88EEZEEYDDSDDSDDsxDDZEEYEEYEEyxEEZCCSCDZDDtDDSCCTCDYDDq8DDTCCSCDZDDtCDZDDtCDzxDDt8DDZDDYDDq8DDYDDq8DDyxDD q88DDYBBSBCZCCtCCSBBTBCYCCq8CCTBBSBCZCCtBCZCCtBCzxCCt8CCZCCYCCq8CCYCCq8CCyxCC q88CCYAASAAtABSBBSBBtBBSAATABTAAUABUAAVAA`BBVBB`BBq`AAUAAhBBUBBhBBqhAAq@AATAApBBTBBpBBqpAA1BB1AA0BB0AAS AAsxAAY@@S@AXAAS@ATAAT@@U@AU?@S@@X@@S?@T@@T?@U@@USd S d S S d SdTi~ T T i TUl U l  U l U U l UlV V  g  g  g 0 0S c k S S k S c0 m m m0kYkY Y Yk 0 n 0 S 3$" S 3$" T T U X { U  T T S 3$" S 3$" Y Y 0 T y Y y Y Y0d d d0 e eoxfan S SHSHgSgSSgSgSgHTHxjxTTjTjHUHfUfUfUfHVVPhhh`00SgSSgS`0nnn0nn000m0m0`0ooo0ozxY0S S"00gS??S??S??S??S??T??T??T??T??U??U??U??U??V??V??V??V??W??W??W??W88S89l9:S::l:;;<S<=l==S=?l88T89o9:T::o:<T<=o==T=?o88U89m9:U::m:<U<=m==U=?m88V==V==88W8=W==W=?W99o99x;;o;;99V:;";;v3$";; v3$S"899n9:n:::;n;;n;;;;n;;<=Z==n>>Z>>n>?Z??n<=T==tx== 1&3$">>T>> 1&3$">>T>>w>? 1&3$"<=S>>S>?S<<X>>X>>X<=S==s==s1&3$z"#>> swy"8>?s1&3$y"??s1&3$y"8??s1&3$y"??s1&3$z"866S67l77S77S78l66T67o77T77T78o66U67m77U77U78m66V77V7766W67W77W78W66S66S55S55S55S55S55T55T55T55T55T55T55T55T55S55S55S55S55T55T55S55S55T55T55S55S11S44S44q#012m22v24m4445m24045022o22S24o45S55o22y:%22o22o22S24o45S55o24045033033155055133 33 55 33055033 33 55 44S22S22sx22Y**S//S/0q#0**T//T/0q#8*-m---/m////m00m+/0000+/0000++u1&--u1&..u1&//u1&00u1&//S..0..1,,0,,1..0..1--S#$S$%S%%S%&S&&S&&S&&S&'S''S''S#$o$$n$%S1&%%o%&S1&&&o&&S1&&&n&'o''n$%k%%k%&k$$Z&&Z$$k&&k$$Z&&Z$$n$%S1&%&S1&$%k%&k$$0$% S1&%% S1& "%& S1&"#S##S##S##S"#T##T##T##T"#U##U##U##U"#U##U"#T##T"#S##S"#t1&##T1&!!S!"n""S""S""n!!T!"T""T""T!!U!"U""U""U!!o!"T1&""o!"?"""""S""" T1&3$S"""?!!o!"T1&!"?"""""S""" T1&3$S"!!S!!sx!!Y!!S!!S!!S!!S!!T!!TSmSmS m S !mT T T !To T1& !o?s?s ?nSnSY Yo oY Y11nn0101SsxYSSSSSSTTTTTTUUUUUUUUUUTTTTSSSSt1&Yt1&T1&YT1&SsxWSnSSnTTTTUUUUoT1&o?"S" T1&3$S"?oT1&?"S" T1&3$S"SsxYnxYSSSSSSTTTTTTTSSSt1&YYT1&SsxXSmSmSmSmTTTToT1&o?s?s?nSnSYYooYY11nn0101SsxYmxYSSSSSSSSSSTTTTTTTTUUUUUUUUVVVVVVVV002zz8SSSSsxS8SSSSSTTt1&TT1&TT1&SsxYSSSSTTTTUUUUt1&Yt1&T1&YT1&SsxZ'(S((o((Z((w()S))S))o))S))S))o'(!()?))!.))!))!.))!))!.((S'(S((o((Z((w()S))S))o((0((z((z#((z((z#((z(( z"((z((?((?((?()?))!.))0))!))!.))S))S))T))T00S00S00S01S00T00T00T01T00T01T00S01S00T01T00S01S11S11SGGSGHSGGTGGTGG Tuy"GG Tuy"#GG Tuy"GG Tuy"#GGUGGUGGuGGUGGuGG Tuy"GG u T"y"GG Tuy"GG!GG!GG!GG!HHSHISHHTHITHHUHIUHI HHUHHUHHuHHUHHuHHT1&HH T1&uy"HHT1&uy"#HH T1&uy"HHT1&uy"#HHSHISHH T1&uy"HH T1&u "y"HH T1&uy"HH HH HH HI ,(pmHL``l                             !!""""#######%&&&&''$$&&$$$$$$$%&&((((((((((((((((((((,,,,--....------//...///11222244333334555533333333333333333455553333333333334455444444<<<=>?<<<<<<<=======>>????????AAAABBAAAABBAAAABBBCCCCCCCCCCDDDDDDDDDEEEFDDEEEFEEEEDDDDDDEEGGGGGGGGGGGGGGGGGGHHHIHHHHHHHHHHHHHHIIIIKLMMMMNOKLNOKKLLNNOOOPPPPPPPPPPPPPPPPPPP)6 runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesarray.cmlvalues.hdomain.hmemory.hmajor_gc.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hmisc.hdomain_state.hdomain_state.tblminor_gc.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.haddress_class.hruntime_events.hstring.hsignals.halloc.h g=!/ . K A .J. )= /  / !+}<   )c#)+X3K Y  N  ! ! !?z &)z. X! X oJ ? Y l  .J< q  ? Y+j tg=// . K A ?c. $)c .!  / !) X2 . J 4 L  ! !0/ L J- !- Z- "-   !-<++  (3 f J- J \f J<! -! #--!! | - / } <1.<u  !& !&!! &   ! =&  & & & z &.+z . .z &.+z.J z '<! X '  . <L<  .J,<<+Z5 J$ |.+   0 <  u. |.+  /) . x H)  |.+  /) <  ;<w <w  fJ <<<-= - 0 1  >I !!z $+   ~ :- 4 ^.<dJ..! /2 // /= < /=wX xX X R x<" z$+  ~ [! t +   ~ / ! ,,>.l g!+  .  !+.   0!-! .<a/  . ~. ~< ~  /~  ~   H~!. Ju~  ~   H~!. e! [. $xX  .JK  2$$#==.4< X .3  3 !< "-!-Z-"-!-5=Ylt0!  !!<"-!-0-"-!-0-"-!-tJ }.!! G } J2!< ?  !(    ! (- !  !(J'  .JKQ< <  < " !("    ! (-" ! " !("t?   <"! $ 2,!! ! !"! $ 2,!! ! !"! 0!a  .!S+|  |    " <   _X !  "/ // +0{  { $+  ~ $  { +   ~  ! ! "/ // ,/{  { $+  ~ $  { +   ~  ! !/  0 F. 9/{ $+  ~ $  { +   ~  !+|    " <   2Df) +|      " = : 8t ! .N ! .N ! .O    /  !! ./  !  #jx   u   /  !! ./  !    \ w  (x  Rx  "!w < XY  J"J&   "&   "&    ".& "& "&  "&  >, =, !   Jw ! /  !  ! < Yz . =  .L  ! . J  <   < v   . .X/pX.//K . MX" StX tXu    <.t@ Rx  (u  /  !! ./  !   7 EV_C_MAJOR_SLICE_BUDGETcaml_floatarray_subcaml_array_unsafe_getc_stack_linksize_tallocated_words_resumedmark_stackcaml_floatarray_blitwosizeEV_C_FORCE_MINOR_ALLOC_SMALLcaml_array_set_addrmemory_order_acquirecaml_array_unsafe_set_addrdependent_sizenewvalbacktrace_slotephe_infoDEBUG_clearcaml_allocmemprofcaml_process_pending_actionsEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLEcaml_raise_out_of_memorycaml_array_get_addrextra_heap_resourcescaml_floatarray_getcaml__roots_initshared_heapcaml_heap_stateEV_C_MAJOR_DEPENDENT_WORKcaml_stat_alloccaml__dummy_vrequested_major_slicecaml_ref_tabledom_stcaml_floatarray_fillepheslice_targetheader_tresultcaml_minor_heaps_endcaml_custom_tableEV_C_MAJOR_HEAP_LARGE_BLOCKSstat_promoted_wordsmlsize_t_maxcaml_marking_startedlong intlocal_rootsmemmovetrap_barrier_offlimitstat_forced_major_collectionsuintnatEV_C_REQUEST_MAJOR_ALLOC_SHRcaml_intern_statestat_blocks_markedcaml__roots_rescaml_final_infomemprof_domain_scompare_unorderedcaml_initializeEV_C_MAJOR_SLICE_TARGETcaml_minor_tablesntables__atomic_store_tmpsigned chartrap_sp_offunsigned char__int128 unsignedbacktrace_last_exncaml_custom_elt__atomic_load_ptrcaml_statefinal_infocaml__dummy_initEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLEPhase_mark_final_BoolEV_C_MAJOR_WORK_COUNTERnum_arrayscaml_make_float_vectvaluecaml_floatarray_fill_unboxedcaml_gc_policycharcaml_ephe_ref_tablenvalscaml_process_pending_actions_with_rootcaml_uniform_array_makecaml_stat_alloc_noexcextra_paramscaml_array_length__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml__roots_vPhase_sweep_and_mark_mainextern_state__jmp_buf_tagyoung_startruntime/array.cEV_C_FORCE_MINOR_MEMPROFgathercaml_domain_alonecaml_alloc_smallarraysweeping_donecaml_array_subtablescaml_floatarray_unsafe_getreservecaml_exception_contextCAML_FROM_CAMLindexcaml_uniform_array_blitcaml_array_appendcaml_atomcaml_array_gathercaml_invalid_argumentcaml_uniform_array_fillEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKSoo_next_id_localminor_heap_wszcaml_array_blit__uint64_tcaml__framecaml_array_getlong unsigned intcaml_array_unsafe_setcaml_alloc_small_flagsdependent_allocatedslice_budgetexn_bucketlongjmp_buffer__mask_was_saveduintptr_tyoung_endcaml__dummy_lencaml_check_gc_interruptexternal_raiselengthsc_stackcaml__roots_arrayssigjmp_bufEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEstatic_lengthsEV_C_MINOR_PROMOTEDcaml_floatarray_setofs1ofs2gc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockcaml_ephe_infomemory_order_consumememory_order_seq_cstcaml_floatarray_concatdoublecaml_minor_heaps_startwo_memmoveCAML_DO_TRACKgc_phase_tcaml_extern_statememory_order_releasecountswept_wordsthresholdEV_C_MAJOR_HEAP_POOL_LIVE_WORDScaml__temp_resultunsigned intcaml__roots_blockintptr_tgc_regs_bucketscaml_modifyrequested_external_interruptgeneric_array_concatEV_C_MAJOR_HEAP_LARGE_WORDSPhase_sweep_ephecurrent_ramp_up_allocated_words_diffatomic_valuecaml__dummy_rescaml_uniform_array_suboffset__saved_maskblockcaml_ev_counter__jmpbufEV_C_MINOR_ALLOCATEDEV_C_MAJOR_ALLOCATED_WORK__jmp_buf__atomic_store_ptrnitemsEV_C_REQUEST_MINOR_REALLOC_REF_TABLEallocated_wordscaml_floatarray_appendnextcaml_floatarray_gatheryoung_limitv_ofslong doublePhase_sweep_mainEV_C_MINOR_PROMOTED_WORDSgather_implcaml_darkenstatic_arraysunique_idallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcaml_alloc_small_dispatchEV_C_MAJOR_ALLOCATED_WORDScaml_stat_blockcaml_array_of_uniform_arraycaml_make_arrayev_runtime_countercaml_floatarray_createwo_memcpyEV_C_MAJOR_HEAP_POOL_FRAG_WORDSallocated_words_suspendedcaml_is_double_arrayephe_refinside_stw_handlerv_lencaml__roots_lenEV_C_MAJOR_HEAP_POOL_WORDScaml_failed_assertwsizechar_osCAML_FROM_C__int128backtrace_activeinitcaml_floatarray_unsafe_setstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policycaml_floatarray_make_unboxedcaml_array_makecaml__temp_d__atomic_load_tmpcaml_alloc_shrcaml__temp_icurrent_stackatomic_uintnatEV_C_MAJOR_EXTRA_WORKshort intuint64_tis_val_young_blockrequested_global_major_slicecaml_array_setatomic_intnatextra_params_areatag_tEV_C_REQUEST_MAJOR_ADJUST_GC_SPEED__valexn_handlercaml_uniform_array_concat__int64_tcaml__dummy_arraysextra_heap_resources_minorcaml_array_bound_errormemcpyyoung_ptrcaml_local_roots_ptrasize_tdls_rootmlsize_tstack_infocaml_make_vectstat_minor_wordslockedoffsetscaml_stat_freecaml_array_fillstatic_offsetscaml_realloc_ref_tablearrayscaml_minor_collectionshort unsigned intCAML_DONT_TRACKbasemajor_refEV_C_MINOR_ALLOCATED_WORDSintern_statecaml_array_concatHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_array_create_floatcaml_domain_statestack_cacheEV_C_MAJOR_HEAP_WORDSminor_tablescaml_ephe_ref_elt__sigset_tcaml_gc_phaseEV_C_MAJOR_ALLOC_COUNTERcaml_uniform_array_appendcaml_uniform_array_gathercaml_check_urgent_gccaml_alloc_point_hereEV_C_FORCE_MINOR_MAKE_VECTmajor_slice_epochcaml_floatarray_makeGCC: (Debian 13.2.0-18) 13.2.0zRxA C A CIA~NCAACAAABIAA A~IKHAAAJC A CJ A~N A CCAhAB zAAB AAABBIAA YAAAAE KAA K HAAA 8pL<E ADA~FCACAk AAAAFAAFA bAAAAFAAFCA~FKGAAF DLpA~<C AFA~h MAB I MAB @TPpA~X`DpA~K CAA 8xBDL EA D AFA~DAB AAA~ xGpA~KCADpA~<C AFA~b MAD I MAB 00,BDF EC D AFA~DA`PIpA~CCApB AEA~DACiAAODACA~HDDADA~JBABDB ACA~CeACACA~CCAAA~<TPLC AFA~eFPA_ EAC GJCm EAB SAG8L BCg CA A ADA~lAACCA AFA~E AD  84HD\BC AAABCA~PAAAAABBA~LBDFB AAABCA~{AAAAADFBA~F TGA~HBA(TGA~HBA$HEA~O BAB CBApxFA~RBAxFA~RBA$EA~Z BAC MBA(<,CDGFk ABA~EsCAAHFAA~FQFACFBA~F`AA AFA~DAAgnu  :0LH<   al!1GVo`x DT`(4HxW r80PhP.LFcs8 (8@Xp6K [ToTxx0H` x8M[,sarray.ccaml_floatarray_gathercaml_uniform_array_gathercaml_array_gathergeneric_array_concatcaml_statecaml_failed_assertcaml_allocmemcpycaml_atomcaml_invalid_argumentcaml_num_domains_runningcaml_alloc_shrcaml_initializecaml_process_pending_actions_with_rootcaml_alloc_smallcaml_stat_alloccaml_stat_alloc_noexccaml_stat_freecaml_raise_out_of_memorycaml_array_lengthcaml_is_double_arraycaml_array_get_addrcaml_array_bound_errorcaml_floatarray_getcaml_alloc_point_herecaml_alloc_small_dispatchcaml_array_getcaml_array_set_addrcaml_modifycaml_floatarray_setcaml_array_setcaml_floatarray_unsafe_getcaml_array_unsafe_getcaml_floatarray_unsafe_setcaml_array_unsafe_setcaml_floatarray_createcaml_floatarray_make_unboxedcaml_floatarray_makecaml_minor_heaps_endcaml_minor_heaps_startcaml_uniform_array_makecaml_process_pending_actionscaml_ev_countercaml_minor_collectioncaml_array_makecaml_array_create_floatcaml_array_of_uniform_arraycaml_make_vectcaml_make_float_vectcaml_make_arraycaml_floatarray_blitmemmovecaml_uniform_array_blitcaml_check_urgent_gccaml_array_blitcaml_floatarray_subcaml_uniform_array_subcaml_array_subcaml_floatarray_appendcaml_uniform_array_appendcaml_array_appendcaml_floatarray_concatcaml_uniform_array_concatcaml_array_concatcaml_floatarray_fill_unboxedcaml_floatarray_fillcaml_gc_phasecaml_uniform_array_fillcaml_darkencaml_realloc_ref_tablecaml_array_fillZ*X0C228008 0 p   220 0  "2&2.0204 T d v2(z0(| ZXC22:0>0  D p    "2&@.222:0>0@ T  2200 2200 "2(&0(( x     ! " ," @# L# T$ d# p# |# ( Z X C $* 2 2 0 0  (+ B2 F2 N0 R0 T ~2 2 0 0  ( ) ( @. \( 2 2 0 0  ( l. / ( ZXC * 2200 + 2262>0B0D n2r2z0~0 1 2262>0B0H . 3 ZXC$*   2200 $ h+ z2808 2200  x  2P0P 6 ZXC2@2@22`00` ( |; < =  8  2200 2P"0P$ d: x6 5 ZXCx  ; F2J2R0V0\  : 6 5 @ pE 2200 2200 n2r@2@. . . (G . . . . . "2&@2200 2200 "2&220608 LE F D $    ! ! " " " #&2#*0#, H#F2#J0#L H#f20#j00#l H$2$@$2$@%Z%X%C%2%@%2%@&V &DW &2&@&G '2'2'0'"0'$ 'B2'F20'N0'R00'T 'b2'f2'j0'r0't '2'2'0'0' 'U &3& 30&@83H&P3`& h3x& @3& `3& 3& 3& 3& p3&03 &(38&@3P&X3h&pp3&3&3&3&3&P3&3&3(&03@&H3X&`3p&x3&3&3&3& P3& 3&!@3&! 30&"@83H&# P3`&#@h3x&#`3&#3&$3&$3&'3&8&9&T&   &*1 6ODrK#^j#q nx o W1L; u,l:iEm]c io @u8{ $  b~  k"I WNes ~ P+  Mn  |) J7EaSVa Fo [},,X F!W-k9 EQ-]w uMpDW+7CcO@[ g 9s<UB*Kn   q<$ 11D N]g .q{[,   > kKv |z 5 #w \F gQ SS,Z8E R`lF gQSS  F ' g AQ NS [S n: | }   6    r    v    }   % a   # q )  /A 5 ; A7 G M S Y _* e k q wU }        $ :( P gG  8 D    1  / J \ s    0  &'     &= *7 / :^ >V N R [&' e&'         &' 8       q o C y!&'LV&$mx| +#VNyiD OM)^-X2(FxJtO&&Lg&',|&&&'\&0&&%&%&& &'|&(&:&&N&'_&l&~r h} &#`AEJ&#p[&0mw&#@&#P& &# &#0 & %&<GKZK^?c s~y  H 7-&'&C]G[P&Z&ogse|&qo}{&& & & 4& H0& TH& \U& lm& x& & &"@  $)8G HZ&"d`t7x){p&"95PLmi &#*&"N&"hXh~l|u&"p&"p&"p&"&"&""&"7;DHq{&!  H&!E + %&!&!/ F3 B<&!Q ZU V^ rb pn&" xU ~ z&" &"   &"     &" Z&!@@ D S W \kz H&!p* * $&!|&!| E A&!| Y U q o&!:, }0 y9&!C&!X \ e&!z ~   &!"&       ' ##2 HE& O[ C_ 9h wl mu y     &      % #&!& : D& Pd 3h -x P| L f b H& & ~ x& * : > CRa Hp& (B H&&B " '2 .6 ;F J qO HZ ^ cXoWz~  X@<aQS6&&0 &(+&KO Tf jo1)`\&`yo&`   &t - 1 : C G S&\ c& &H & & P G ? [ k e &!!! f! U!!!!&&L!C&x!`&!|&!&!&!&!&!v! !!!&"&"'&"4&"U v"_&"vB""""R">"""" H"""X"W""" X"#=#9#Y#M#S#)#-#2#=#A#Q#U#Z #l#p #y&#&#&#P#N#\#Z#&#&8#&$&$&($ !$2n$6d$;&x$U&$j $u$y$&8$&$&$&$&$&%&<%&%&&%7&\%N&l%h7%%%%%<%&%%% &&&& &  &+>&/6&=i&Aa&F&&{&&&&&&& &&&E&5& &&''''')'-'2 U'=A'A1'J&<'T'd'h'q'u'~%''&<'''A';'&p'']'W'&t(($(((4&T(K&(h&(&(&0(&(&(&)&)-&)J&)_&)l&)}&)&)&)&@)&)&)y)&* ** *9*#/*2j*6`*; *F*J*X*\*a&x*&*&*&*&*&*&* +++ +7D+Q +]D+x+++&++++&+M++&,,,"$,-#,1,:&,D&,\N,`F,iy,mq,v&,&,,,,,&,&,,,,,&-&--&-6$-A-E-JX-VW-a-e-j-z-I-E--d-Z-S---l-8---- .  .%.,.0.5?.C.G .Lw.Q.\-.`).e.pD.t>.|. ._.].& ..i.g..s.q..}.&/&/&d/&&/3&/D&/R/n/$//&///$///X/W///0  000+09 x0C0G0LS0V60Z,0_0h 0ru0vs0{&000}00000 000& 0&`1&1&011&1>&1Z&1g&1&@1& 1&1&1&,1&P1*2 $22&S22$2J2b2n2} 2&2222C2/2222]2k2&$2w3 w333&,383<3E3I3O&,3b&x3l3{33333/3'3&3&3&3&p4&4&4"&43&4Q&4i&,4&4&844&p44n4f4444444&|5M5555#5,5055M5>-5B)5G&5n&5|)5&55O5E55~5v55555555B66  46 066 P6# H6-&67&6R 6V 6_&6t 6x 6 6 6&P6&6&66666,7&77' 7+ 707: 7> 7C&7Q87Z&7q7{ 7 77!97!17!b7!\7!7!}7!7!77k7& 7 8 8 !8!8&80"84!8="8A"8G&8Z&L8d8s"&8w""8";8"788"R8"J8&8&8&8& 8&L9 &9&9.&989G"u9K"s9T9]"9a"}9j"9n"9u&9&9&9t9&099"9"99"9"99#9#:&<: :#[:#S:'#:+#~:4#:8#:=:F#:J#:S&P:]&P:x$:|$:&P:$):$':$5:$3:&t:&:&: ;& p;;!$G;%$=;*;4$v;8$n;=;G$;K$;Z$;^$;k$;o$;t;};%,;%(;;%H;%@;& ;& ;%{;%y;& ;%;%;%<%< & <& <0%<4%<=& =M&*=Q&$=Z&I=^&C=c=l&j=p&b=y& =& =&=&=& =&=&=&=&=& =& ==& >>&>#&>(>2'>6&>E'0>I'*>V'Y>Z'K>i'>m'>r9>{k>& $>g>g>'>'>& ,>'>'>'>'>& ,>& d?r?'?'?$( ?((?1r?:( ?>(?C& ?T&?a&?s& 0?& \?&?&?& ?.?(C?(A?.@(M@(K@(Y@(W@& @'& @B(c@F(a@O& @d(m@h(k@q(y@u(w@|& @&@&@& @@@@{@& @AA(A(A$A3A@%AMAYArAAA !AkA AAAABBB0&@BK(BO(BX(B\(Be)QBi)ABr)Bv)BB)B)B&`BB* B* BB*B*B&|B&C&C& C0*(C4*$C=& $CG& $C\*>C`*:Ci& $C~*TC*PC*lC*jC& `C*|C*tC*C*C*C*C& hC& hD*D*D& hD$*D(*D1+ D5+D<& DN& Di+Dm+Dv+DDz+<D+oD+gD+D+D& $D& $D+D+D& $D+D+D+D+D& HE$& dE6&EQ,EU+E^,lEb,^Ek,Eo,Ex,E|,E& E- E-EE-ME-GE-}E-sE&E&E-E-F-F-F&F#& FA&FN&F_&PFn&F-F-F-F-F&F&PF.F-F.-F.%F&pF&pG.TG.PG".jG&.fG/&pG9&pGQ.GU.|G^.Gb.Gg&|G&hG&G.G.G&G&#G.G.G.G.H/@H /6HH#/nH'/hH0/H4/H?&$HZ/H^/Hg/Hk/Ht/Hx/H&$HH0 H0 H0 H0H0RH0HH0H0HH0H0H1H0HGH' &E&K&&<@P  @ ` D \ | p00dp@TP$8L` , PL t!@!"@# #@#`#,$@$'.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @(p@ &(,(12(GE*@@'O. J@/`Y/HT@/ exs~1(0@01q)@0H0W?0 @xoX hbacktrace.bd.o/ 0 0 0 644 50520 ` ELF@@|?|}xj!,>A9Ap9 88^99A!x8!!!pxAH`!, AaH`|ixa!H`8|ix8` !H`A9 a, A9 #9@! !y)9)(!y)9)(!y)9)( !y)9)((!y)9)(0!, @!I8!AI@a8! |N 88`H`A9 a, A9 #a8! |N 9@Kt``<PA0|9@8i8IH`|8!N |<,)AXI|?PA0|9@8i8IH`|8!8`N ``|<|K|!?j?,)A$)8`,)A8`8!N |<>>>!?"A~j?;?a?B:;9:;;;Z:7,)A\`I|?P@x){$|i*H`|yA,~x@ ?b;{.;HT``,@0,x@Fx=")exxiH`xH`|yAxxH`!aAa,A,A@D,@<Hx8| P@888`H`8! |N `,a x@;`{8ap{e$H`8cxH`,a @ ;;h {$|i;`H`|;a Aa 8! |N <A,>A,'A99 ]yJG`B_,*@4``Hy'$9)9yJ}F9*_|*HA8!8`|N `;,'@tH`,AK\``8!8`|N ``<A9Apa@9 8@9^9A!xc!!!!xpAH`|ix8`,)Aa#H`8!|N ``<+CAb:;gqA://0  w? ::  @H/  W Z: l mA) O.1[x  X5'NA&'2'9 ;B <) >) ?[  :?C " d  d d "d %d  (n( +0 .8 2x@ 6}H 9dP =dX A` Ch F)p I)x L) P) T) [) ` r) t w) y { }     )))) p(:0)8Did p@pHP.X.`)h)px:D))))p}disnEFG K8H p@   g $ 5?@}jmpA BCI( & 0 2285 5 end5 5 ptr5 5  5:(5:0d7 K8 9 : 8< < end< < ptr< < <:(<:0 > ? mem@ maxA 8C TC TendC TC TptrC TC T C:(C:0  d w:0# $p%p& ' (p)p*p +p$,p(-p,& w 3(* $ 4:?2 h  3! p3"E 4 y:(F h2. Fbuf/ y 1p(  ~ } |? 4d ), , (2 >4b N*Tp)- o+ . G^ p H*=pC  )F    w@ *7p5Y :d5 e V pc!c3"e e+arrfP+resfHf@f fpin odbgp "q q  68 nI#U V b wI8mI#U V b  T :S T U eI'!I3dbgK "M MM Mp+vN`N~ Np X  :S T U M<d ,bt<.!<8i> )dbg? -8B I.U V b  S 7 ,bt70689 I#U V b ,bt1"  p@~ pi   4dbg   XQdbg* / / /!S   S{ 4-8I.U V b-8(I.U V b  ;ST0 :nS T U  >S  X! 6 JSS  >S K0n7dbg/ $pPH@~p$li w  ST ( ( #S9T0 ?S1T1 :S T U7exn1< %iL8 QI#U V b #pST N :S T U&7$res@p& p%i XSU3$ ST0 S0T0 :S T U7M:8x0 Nh$lij w~%ir p%dbgs OypPQ   BTU ZT T  S ST S :S T Ur  ;S T1USeS T1UFS T1U?S T1U S T1URR@ 8li@99@ApBC 33, :S T U5,,,S., #T1 :S T U#T!89!,pU+p8val8V p )W, #T1 :S T U#::I~ : ; 9 I8  !I : ; 9 I 8  :! ; 9!I!8IH}H} : ; 9 I 4:!;9 IB H} 41B $ > < U : ; 9!1B : ; 9 I8 4:!;9 IBI!I/ .?: ; 9 'I<4:!;9!I4: ; 9 I4:!; 9 IB( .?:!;9!'I@z 4:!; 9 I.?:!; 9!'I@z:!; 9 IB ( !:!;9 IB"4:!;9 I# 1$4:!; 9 I%4:!; 9 IB&&I':! ;9 I(: ; 9 I ).?: ; 9 '<*.?:!; 9!'I<+4:!;9!I,:!;9 IB-1RB UX!YW . 1U/7I04: ; 9 I?<1> !I: ; 9 2 !!: ; 9!3 :!; 9 I84.?:!; 9!'<5.?: ;9!'<61RB X!YW 7:!; 9 IB8: ; 9 I9:!; 9 I:.?<n:!;!;% <$ > = >: ; 9 ? : ; 9 @&AGIB5IC  : ; 9 D : ; 9 I 8EI F : ; 9 I 8 G.?: ;9 'I<HI1RB X YW JH}K.: ; 9 'I@zL1RB X Y W M!I/N.?: ; 9 '@zO1RB UX Y W P1Q UR.: ; 9 ' S1RB UX Y W T.?: ; 9 ' U.: ; 9 'I V W.1@zS!S!!S!"S l  !l!! !0 0 o !!!o s  !S!!S!!S!!T!!@ !!@8!!Y H qH!!H!!qH S @ sx @8 SSSq#0w SYo00`q`SSSSTTTT1&TT1&SSsxYSSSSsxS8SSSq#0ll0000nknoknnSSSoSnST@S0Z08zxYYZZzxzxYYSoSo4S4mSmSmSm<ooo0PYPSSlSlSSlTmTmTTmnnn01YyYmxnSSSSmmm00nkk0nn0@q@SSS m mm S o S o S o n n n     XXXXSSSSSSSSs1&S1&s1&S1&SnSSn, '                  !!  !  !!!! runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includebacktrace.cmlvalues.hstddef.htypes.hstruct_FILE.hFILE.hstdint-intn.h__sigset_t.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hstdio.hbacktrace_prim.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.hstartup.halloc.hstring.h =!!/ .!w+.g0= K !  /  ! ! / !. !z  /  .!  .!  .!  .!  .!< !z 4 J.) K !. # ...x.oJ.X~X//<.=!!":!!12..y .J. tv.  v   ..=!!":!!Mts .J.t /J.  .!< .J.4t[.pXxJ J< c  <h  9 . y %   J=YXU.T . ! ##t;1./M z00  w.   t    0 !%;.33   .t <  . 6 C + $ !!f yJ x :  $ r2 =$ %"j &zfr f =/ -!=!-/ .x !J'y Q!%0,0 J  ..q<)@ M K ! ./ 7!7;&z .& < ^..XX (t%i%#+%1 0L+l   !44 3!8)!'.8g)' 8- )!' 8<J uX u   /.4Jt!!J %dJ  XXY.1 !. =/!/!. /;'y  5z ;!/.1+ . L'.= 0 / . .  +    .  J   "+   >'.=?     !.;.. .  +    . .. a<.X3+   ![$!+~  .   1   =<* <m?91#.  /; $!;/0 ." # >  <tJ.XX=!-/ .!h...  . sJ  "!"+~     .! /!4" /   <4+~ < 4 M  . mX.Xc_stack_linksize_tallocated_words_resumedmark_stackmemory_order_acquiredependent_size_IO_codecvtcaml__temp_offsetbacktrace_slotephe_infocaml_allocmemprof_IO_save_endcaml_convert_debuginfocaml_debug_info_statusextra_heap_resources_IO_write_base_lockshared_heapcaml_heap_statecaml__dummy_slotblock_IO_save_basecaml__dummy_vrequested_major_slicedebuginfocaml_ref_table_chainephe_cur_columnslice_targetcaml_convert_raw_backtraceheader_tcaml_debuginfo_locationcaml_custom_tableloc_start_lnumstat_promoted_wordscaml__roots_arrlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_failed_assert_IO_markerdnamecaml_ml_debug_info_statuscaml_intern_statestat_blocks_markedcaml__roots_rescaml_final_infomemprof_domain_scompare_unorderedcaml_initializecaml_minor_tablesntablescaml_get_exception_raw_backtracesigned char_IO_FILEtrap_sp_off_IO_wide_datacaml_failwithunsigned char_freeres_listbacktrace_last_exncaml_custom_eltcaml__temp_valcaml_statefinal_infoBAD_BYTECODE_Boolcaml_raw_backtrace_slotvalueloc_end_offsetcaml_gc_policycharcaml_ephe_ref_tablecaml__dummy_arrayloc_filename_IO_lock_textra_paramscaml__roots_array__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml__roots_v_IO_read_ptr__jmp_buf_tagyoung_startextern_statebt_sizeloc_end_chr_markerscaml_alloc_smallloc_is_inlinedarraysweeping_donetablesreservecaml_exception_contextcaml_raw_backtrace_lengthcaml__roots_btvunit_offsetcaml_convert_raw_backtrace_slotindexcaml_invalid_argumentcaml_debuginfo_extractoo_next_id_localminor_heap_wsz__builtin_fwritecaml__framelong unsigned int_flags2dependent_allocated_IO_read_baseslice_budgetcaml_debug_info_availableexn_bucketloc_valid_unused2longjmp_buffer__mask_was_saveduintptr_tloc_start_chryoung_endcaml_alloc_some_old_offsetexternal_raisec_stacksigjmp_bufgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockatomic_uintnatfnamecaml_ephe_infomemory_order_consumememory_order_seq_cstdouble_IO_write_endprint_locationcaml_loc_infocaml__dummy_btcaml_extern_statememory_order_releaseswept_wordscaml_debuginfo_nextthreshold_IO_buf_basecaml__temp_resultunsigned intcaml__roots_blockintptr_tgc_regs_bucketscaml_modifysaved_caml_backtrace_pos__pad5requested_external_interruptflagNO_FDS__int128 unsignedcurrent_ramp_up_allocated_words_diffcaml__dummy_rescaml__dummy_p_flagsoffsetcaml_get_exception_backtrace__saved_mask_mode__jmpbuf_codecvtsaved_caml_backtrace_buffer__jmp_bufnitemsallocated_wordsnextyoung_limitlong doubleFILEcaml_alloc_backtrace_bufferinfocaml__dummy_arrunique_idallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcaml_restore_raw_backtrace__off_tallocated_words_suspended_freeres_bufcaml_print_exception_backtraceephe_refinside_stw_handlerdomain_state__atomic_load_ptrcaml_record_backtracecaml__roots_pruntime/backtrace.c_IO_backup_base_shortbufcaml_copy_stringchar_oscaml_record_backtraces__int128__off64_tbacktrace_activestat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policy_IO_buf_endloc_defnamefprintfloc_end_lnumcaml_modify_generational_global_root__atomic_load_tmpcurrent_stackstderrshort intrequested_global_major_slicecaml_backtrace_statusinlined_vtable_offsetbacktraceextra_params_areatag_tWRONG_MAGIC__valexn_handler__int64_textra_heap_resources_minormemcpyyoung_ptrunitcaml_local_roots_ptr_IO_read_endasize_tFILE_NOT_FOUNDcaml__roots_slotdls_rootmlsize_tstack_infostat_minor_wordslocked_fileno_wide_datashort unsigned intbasemajor_refslotloc_is_raise_IO_write_ptrintern_stateHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tcaml_raw_backtrace_next_slotfwritemajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 80C AGA~X EAA N EAA 8TBCI ADA~FAA BA A AFA~EA8BCJ ADA~FAA CC A AFA~EA(BL AA A AFA~EAEA~FE A C A CACACACA AAAAAAAAAAAACAAFD lJCAAFA A~F8CpA~CDAPC AFAA~\ EAB BPMABEAAAA~LA<C ACFA~g GAB N GAC $HXB ACA~E DAA 4p H ACA~` GAA  dDpA~J CAA (C AEA~a DAC HC AFA~\ EAB A`BEADA~ 0   $/GXi|0H` $;CWnux8 X)7 R^ xd 8backtrace.ccaml_convert_debuginfocaml_statecaml_debuginfo_locationcaml_copy_stringcaml_alloc_smallcaml_failed_assertcaml_record_backtracescaml_modify_generational_global_rootcaml_record_backtracecaml_backtrace_statusstderrcaml_print_exception_backtracecaml_debug_info_availablecaml_debuginfo_extractfprintfcaml_debuginfo_nextcaml_debug_info_statusfwritecaml_ml_debug_info_statuscaml_get_exception_raw_backtracecaml_allocmemcpycaml_initializecaml_restore_raw_backtracecaml_alloc_backtrace_buffercaml_convert_raw_backtrace_slotcaml_failwithcaml_convert_raw_backtracecaml_modifycaml_raw_backtrace_lengthcaml_raw_backtrace_slotcaml_invalid_argumentcaml_raw_backtrace_next_slotcaml_alloc_somecaml_get_exception_backtraceZXC     2200 :ZFXHC 2200 ZXC4 f2j2r0v0| ZXC2200 4 N2R2^Zb2PnXr20|C2@22`00000@00`0P 2 0:2>@L X p 20002@  &2*220608 P! z2~@20" 2@( R20Z00z2~@2h0h" 2@2h0h" 2@2`0`" 2 @20 " L! ZXC % P& `% ' 2 2 0 0  :Z BX DC d ) r2 v2 ~0 0    2 0 + Z X C   % < T l- x 2 2 0 0  2 0 + \ z2~00 ZXC 42 b2f2n0r0t ZXC D$ \% |  - 2 2200 &3&0 30&83H&P3`& h3x&@3&3& 3& 3& 3&3&03 &(38&@3&   Y]&*/ =DaPW^ Heql x:.  } *; ) -+=8 mER^_ly[  } q   b"0 <Dh[r ( ^  g)*x;T |Zm`7flr{I yR= $f21@AN \ j.x +v p,)    . <J #X4f7t :  MKY   \* D P\hDtL=I  Z C(64g@L Xjt6  u, U H  ^%16@Jc7py T H   $ 1 1 > Lf X r  T  H   7     -T : H G \ c x  .   9  3  M R C x o  5# @ h N [ U z~      K   g ) ? O Y& p_   E    4  $ Z ; W 8 a& xp   u | ? 7    b `  s k )( , < @ E&Zgfq u z&&&&&  &       6  %&T.&TK O X&Tm -q )z E~ C& &H&d&& &&&)% S) M9 s= mBuN|Y ] bq&|  K  &< 6  & &<&| &&(%2&0S W \g k y  }  6 4&8  @ >  J H V T&d&& &5 b9 ^B&K&c xg tp&    &   u|    #2z= A O S Xc 5g )l&  f b& & & 0 { u g     & X"& t0& D=& R& g 6r v &         &      % ! < 8& & <& Q&^&o&&& ) S K& & & &&1 5 s:uF|P T eXs K      6  &&&&$&@&Q&^&o x&      ` RJ      & l& l  %& l: > G  K R& lq& (~& &&P&p  u| F <  & r* n/ 8 zH R V [ l p u& & X& h  6  & &  &&8A&@Xpb f k&Ty &  ,    7 - !& Q ^ X p | t  %&TC&[&0q&~&`&x&&@&&&<&X&'&<&Q&hf&{&h&&`&(&  " +&BL P U&f&s& 5&    &  @ 8&<&&&  - 9VW #c z&0 y o&&&&_-k&0&P&P&0 &0&X0 @  L t 0 .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @n(&`,`12`EEP@@OJ@`YT@x9H e4x:us@` C0@ 0CE+Dp@P0SF0cW cxP@hPf kbigarray.bd.o/ 0 0 0 644 166992 ` ELFP@@ c$88yjy)|*H@tG&|*H@d,*9!A9 AH,`9} |*H@t9)y)$|H*}&H*|%HA@@9@8!}CN }JHP}CN Aa8!9@}CN `;99 `9)9y&$} |*H|0*1AUk>( A(=BJyk}*Z})R})N hD88 L,?As9'9HA(|;x} Cx|'@AA ,?A{B} H(A 9)9J|'@AAB@| 9)9J|'@@K,?C$AP9J9)H AB@8 |@@@KT,?C$A9J9)H`AhB@ |@@K,?As9'9HA(|;x} Cx|'@AA,?A{B} H,`A 9)9J|'@AAB@l 9)9J|'@@K,?A@s9'9HA(|;x} Cx|@AHA,?A {B} H(Ah 9)9J|@AALB@܀ 9)9J|@@K,?C$A9J9)H AB@ |@@@K,?At89H`AB@XG(}Jt})t| H@Kl,?AAa="?b{;=";{j;;@H,tIA pA;|>@A\UIi$!p`Bpp`BpL@Ae=UJ}JCxAtU*i$Ap`Bp2p`BApL@AeJU)t})Sx!p`Bp`A,ApA\;,)@4|<@AtAAA;,)@|<( A=BJyk}*Z})R})N XHxh88X,H;KC$;K;K;Kl;KC$;KpC$;KAa;K8Aa;KAa;K|Aa;KAa;K\9@KT|A,>A,>Axc Hx,(}CxAx,(@|;8``?xc ;;Q$x H`|>@|s@8xxc Hd``,(@}CxA,(@|;9 `` y# H`7|ix@`|8!N y,( }Cx@; ,(@\|;9 H`````>y# H`7|ix@Ky,(@}Cx@;@,(@|;9 ````>y# H`7|ix@K$,(}CxA,(@|x;;c9@H<``U)>8| A}$KxyC T>H`7|jxA4>U(j,|@q(8|@K,(@}CxA$,(@ |;9 ``y# H`7|ix@KD,( }CxA,(@|;9 H````` y# H`7|ix@K&( A=BJy)}*J})R})N 8$`Lt x|K|8`Kt; K4;@K;KD;@K ;K;K|_UJ?U)@.})Sx_xc }JKxyD H`|K;8`Kx;8`Kl|;K|;KX|x;K|;K|;K|;K<|;K|;Kt|xc H`x|K|9 K|9@K8`K8`Kp|9@`}^,){ @@;;{ ;H$;;{$|~I*|?@@H*|HI,'@9J}I|(HA{ ,= A=B{d9J|jJ}#|c,)@tH`,#~||xA( A=BJ{}*})R})N xxx88xx8xH`8!~8cxc$|N ``xH`8!~8cxc$|N ``xxH`8!~8cxc$|N H`,@,?;@8sax;A,H`yx|A<````H`;;}H`7}@axKxH`8!~8cxc$|N {H`8!~8cxc$|N {H`8!~8cxc$|N ;Kt;Kh!`Ba2 с`B!L@Ae)Tc|cKxa`B!N ``=@G`BaTi~| P@A4=9@|| @@@9@~Tc |cSxTc>N ```=@8| P@@8!=BTc `B`*`BA|cSxTc>N =Iy)9JTc })Ry*"|cSxTc>N |gx,&@d9@8`9 `9)9Jy($}I|)0}@*|cAL 9)9Jy($}I|)0}@*|cAAN ```8`N ```9,&@D9@9 H`````9)9Jy'$}I|)0|8*}9A#=B9Jy)d|jJ|cAN ``}&||+x|}x|#xT~>.!Ad,A, A,?A|9p|3x}Cx{HH`,9?Apy) 9)|hx})@,`B@0( |H}JI,'AaH`9 })B="{9)})} PQ0|A,%@,<AW,8, x$@xAK`|,|~x|#x|+x!X`h!pAxA,9X@Ds9Ah9(8@d{B} 89 9)9JBxx8pxH8!|N `,'} Cx|* x q@K`<0|%H@,%|x9h@( A\=BJy)}*J})R})N  T`$<l ```$,*|( x8})t(q@HKp?|ixc8c08! |N ?xc=B=B}). U*i$A`Ba2 с`BAL@AeJU)})Sx!`B!H`K?xcd|).H`Kh?xc$|)H`KP?xc|ixc8cK8?xc|i.xc8cK ?|i|ctxc8cK?xcd|iH`K?xc$|i*H`K?xc$|i*xc8cK?xc$|i*H`Kxi$88`_} JL.H`Kh_xi&88`} JH*H`K80}*8@9)yH$}*|>P|A*Ax; H{$|2|hxK```|) x|3x qK\8pK(``<A9@8a!89p8PA@8890AH})tApAU)@.}'08EUH|'@A|qC|cKx,$@Lp9$y)$9Ah}%J9@xB} 89 9)9JB`c8p||cH!ap)#`Bpa88cHap8!|N ```,(|* x q@XK``8!N ```|<( A =y)}(J})B})N @@8Dp|@``,?tAqJA H`,?@xW>xH`H`,?tA dqJ@d,?@8sx8x9IA y} IIIIB,ADH,;U) }?;xA @8s9<8xA4,(A ,(Ax|3x;,>A,yJ}IB```,@4[8!8`Aa|N ,?AqJ@,?@8s9<8xA4,(A ,(Ax|3x;,>AhyJ}I BKH,?AqJ@p,?@p8s9<8xA4,(A ,(Ax|3x;,>A yJ}I B,@[8!8`Aa|N ,?A8qJAH`,?@8Hx``{,)A qJA(H`,?9@@Ds8xAH,(A,,(A|;x;;;,>;A4y)}); B, @K{,)A qJALH`,?9@@xs8xAH,(A,,(A|;x;;;,>;Ahy)});@BK4,?ADqJA H`,?@8H,?tAqJ@,?@8s9<8xA4,(A ,(Ax|3x ;,> A0yJ}I9) BK ,?AxqJAtH`,?@8Hh`H`[8!8`Aa|N GUI>( A<=y)}(J})B})N tt4`tt```< ATyJ}I9) BK0H`,?@X8Kp`,?@9@K,?@x9@K,?@88s9<8xA4,(A ,(Ax|3x ;,> AyJ}I9) BK,?@8s9<8xA4,(A ,(Ax|3x;,>ApyJ}I BKPH`,?@88K`qJt;AH`;K8H`K,KqJtAH`;8K@qJAH`;8KqJAH`;8K4qJAH`;8KqJ@|;9@KqJ@;9@KqJtA\H`;8KTqJ@\;8KqJ@;8KH`8KH`8KH`8K,>@8KH`KH`8KTH`8KH`8KpH`8K,?@LxW>xH`K4<y8}:y"K8;8Kd;KHH`;8K;8K|H`;9@Kx;K;8KH`;9@KH`;8Kh 0input_value: wrong number of bigarray dimensionsinput_value: size overflow for bigarrayinput_value: bad bigarray kindinput_value: out of memory for bigarrayold+1 != 0Bigarray.set: wrong number of indices0 <= num_dims(flags & CAML_BA_KIND_MASK) < CAML_BA_FIRST_UNIMPLEMENTED_KINDnum_dims <= CAML_BA_MAX_NUM_DIMSBigarray.create: bad number of dimensionsBigarray.create: negative dimensionBigarray.get: wrong number of indicesBigarray.dimBigarray.slice: too many indicesBigarray.sub: bad sub-arrayBigarray.blit: dimension mismatchBigarray.reshape: bad number of dimensionsBigarray.reshape: negative dimensionBigarray.reshape: size mismatch_bigarr02wG?WUJVVint](Wgw %&'()]*<,C-VX ->O` q    WC ZV l mYZ    V#V  O .[OJ\<nX;N;2&;9;]<>?<   #V?^ " ZuZZ"Z%Z (d(+&0.82n@6sH9ZP=ZXA`ChFpIxLPT[`rtwy{}u ](/08_id]@]HP5X5`hpx.8]`q{Z $ _$ i dE F G i8 H p x$ @        $ $  $ 5$ )$ 3@q!jmpA B C =$ v< &= 22  C 4<     4<5354<@V554]   >  C      >  &  E=]' <* B C R#V?D   5E! ]E"b R #V<F D. cbuf/  85 0 5 0!end5 0 5 0!ptr5 0 5 0 5/( 5/0 Z7 i 8  9  : 8< < !end<  < !ptr<  < </( </0 5> ? !mem@ !maxA 8C r C r!endC r C r!ptrC r C r C/( C/0  Z #Vd? Fi@ FfA . . d #V  e  f )+ G /& ! & ) JG, B  Hl7 ^ 6 t `5 O4 5Id /O/] &  &  &  & //]IB /] ]r &  &  &  &  ` ] O  5  .2  `M  h  g  ] J8  &A    h)& JHfJe  ]KvbK& K0MMMM])resN`N~N])dimP }Q R &iY ] S PiMTMMMMK`KKKKH\V}"GS T U M fS  S   #V vb# -~]b & A ]p  !  !'M M%M]MgMq0M}M~ .]p ! ! !' 5]p ! ! ! ]]p VSTU VSTU ! ! !O ] ]&p  ! ! !$ O%]p%$ ! ! !5) `*] p* ! ! !. /]p/ ! ! !3 4]p4 ! ! !8 .9 .:]yp: ! !> 5? 5@]p@ ! !-EKKKKKS T U  hS T C   . 5 > ` $\ # /]srcdst & & ]i@/i ]M6_KK1KK0K4K ! STU   STU@S T U  S X_vb" , 8])resP~]ofs len ]mul  (i]i]H\"CS T U  S y vby, y6{{{{])res|`|~|] ] }hi<H\V}" S T U {C|"vbC$ C.EEE~E])resGG~G]H }I]J K L (!diU ] 79S!i_]!ia]!rMO"MMMM79"*SH\"OS !T""S T U E S ?(""b1(9"b2)9+ #%vb %"]#[vb#H#vb$'%A %]%Q%i%s S  H$vb $'%A %]%Q%i%s S H%Avb$'%A %]%Q%i%s S L%~"vb""vn,bn %vb'b'vb* 4 @b1b2b3b4b5!b6%b7)b8-idx val `b B'vb* 4 @b1b2b3b4idx val b B`(vb* 4 @b1b2val idx b B)vb* 4 @M/)hMMMM@,SSTTVU *vb 'Z 1]@,SSTTU U1 $ &L*vb$ . ; H  *` ,SST`U3VW *#VD+vb$ . ; H +p ,SSTpU2VV +#V@,vb$ . ; ,SST8U1VUMO.vbO$ O9 P% P1bRS ~T ,i[ ](- pv -1p{M a-M%M]MgMq0M}M~79-ST~h-S T  S 0/8vb0* 04res2 b13b23b33b43b53!b63%b73)b83-idx4 b5 ^ B0"vb* 4res b1 b2 b3 b4 idx! b" t B T0vb *  4res b1b2idx b B1vb* 4jM-1M0MMM@3<SSTTH2Evb$ . ; H *` 3<SST`U3D2vb$ . ; +p 3<SSTpU2<3<vb$ . 3<SST8U16vb 0 :]b ~ 3i ]84p6'66662747727477+ 'S2T05p6'6666275u7727577+ 'S2TM6MM796ST~ 6=!P.5   t ^ Hh6S T  S  $N79"d0&5"d115res 675&5M7b5 A 7i] Bi] 94 % 2 A)dim  ]8i ] S M8MMMMH\9S T1&8$S1&!U0 S LD9"dstD/&bFG G69iO ]&lenP &iV ]?29+22&+2?4]&n9p9O;v) )  ) b :i ]len :S:S S;i ]]r;;tU@K$V ;;U@J$V ? hS T )?<2+0&+0+0+@]6<np&npd?Jv&b h w<i ]=p?J=nMM=pp=bnMM=p?OnM=pn2>3pn>pn'K4KKM>p n?'pn hS T  q 0] tF8v10&v200b12b234 5 5@Fi> ]d1? d2@ AWp1bF8p2bF8nbe1b.e2b.Mb@MMMbA%1MM S T U bAp1f6p2f6nfe1f.e2f. S T U fBp1j6p2j6nje1j5e2j5 S T U jCp1mF=p2mF=nme1mqe2mqCp1oFBp2oFBnoe1o-e2o-Cp1qF8p2qF8nqe1qe2qDmp1sFGp2sFGnse1s>e2s>Dp1uFLp2uFLnue1uOe2uOEUp1wFQp2wFQnwe1w`e2w`Ep1zFVp2zFVnze1ze2zKKDF1KK0K,K hS T {  } 9 J [ l O,GOv(bN7" GNHNT S T UF hS T *H\ )] 4] E&kap )dim ~res Hi ]H\H,STUV~ S T U  AKB]B]B/&Pdim>7 777]8res 8bl ~I8i ] VS~U 3$I8i ]QN INNNJ@i ] VS(T~U 3$QNJNNNJS JSJS TUKS TUK@S T UKkS TU S TURK*b=RK*b<( &,i ]-L95*dDALmx15!nM M%M]MgMqM}M~A5hM Px1SMLMM-[M*d[-.3] 3^ G3_ ?(a,fc ,od (e &(-H.M*dH-3J w3K G,oM -+N*val8&( N(  u-MN79M>N,oldO -CNa9C>N,oldE o4N94;N*n4L&(6N(6N]N"a,"b7"resD .;hP^;;;;;:<OY<<; P,;;;;%;:<P<<&MPS0 MS0MPCS1 ]ST.94,S9D9Q%9[%9g94DS9D%9Q9[%9g:9sQ,9x99&:9Q9NW QNNN 1S N]QNNN9{R99929tR99    RST RS2$" $ & RTST S+T SET1$ S_T1$1S~S 1SS  hS T |BB 1S ."tU""%"N 2 TNN* S T UP'"( """Na7U5NzNnNNNpKT;)U1KqK@ 1KKKKUSH.KVKKKK.KxVKSKP KKKK.%AXV%Q%]%i%s S TTI~4:!;9 IBH}41B U1B4:!;9 IB U I  !I :!;9 IB : ; 9 I8 H}H}:!;9 IB : ; 9 I 8  :!; 9!I!8.?:!;9 'I@z: ; 9 I4:!;9 I( &I4:!;9 I1RBUX!YW $ > 4:!;9 I : ; 9!.?: ; 9 'I<.?:!; 9!'<  1U I! : ; 9 I8 ": ;9 I#!I/ $<%41& '1RBUX!YW (4: ; 9 I)4:!;9 I*: ; 9 I+:!;9 I,4: ; 9 I-.: ; 9 'I ..1@z/.?:!; 9 'I<0 1112 134:!; 9!!I 4>! !I:!; 9!5(6 74:!; 9 IB84:!; 9 IB9: ; 9 I: 1U;:!;9 I<: ; 9 I =4: ; 9 I?<>'I?.:!;9! ' !@H}A.?:!; 9 'I@zB:!;!9 IBC'D !!: ; 9!E :!; 9 I8F :!; 9 IG.?:!; 9!'<H.?:!; 9!'<I.?: ; 9!'<J.?: ;9 '<K1UX!YW L.?:!;9 'I !M.:!;9 'I@zN.: ;9 'I O.?:!;9!'@zP:!; 9 IBQ1RBUX!Y W R.?:!; 9!'I !S1RBX!Y W T.?<n:!;!U% V$ > W IX YGIZ : ; 9 [&\> I: ; 9 ]5I^  : ; 9 _ : ; 9 I 8`!Ia!bI c : ; 9 I 8 d : ; 9 e4G: ; If4G: ; 9 g.?: ;9 '<h.?: ;9 'I<i : ;9 j1RBX YW kl4: ; 9 Im: ; 9 In1RBUX Y W o.: ; 9 ' p1X YW q1X Y W _SĔSĔהq#0TTהq#8nnn0000TTTTTđ1ĒzxĒ̒W1w1đ0010`SZzxTؒUUUؒ1X11ؒ0ZzZ00vwSSˆq#0vwTwymyyTyymyzTz|m|}T}}m}~T~mTmTmTȃmȃȄTȄmTmTmTmTmԉTԉĊmĊ܊T܊mTmTmTmTmTmЍTЍmTmTmTmTmT̏m̏TmTmw|j||}jjjԆjw0Ԇ0wyWyyWzzWz{#}}W~~WWWԁWWWȄWWԆ#WWWWWԉWĊˊW܊WWWϋW܋WWWW#W#ǍWЍ׍WW#WWWÎW̎W#WW#W̏܏W܏#WWWlllāll̂̂̂lԂ؂؂llxxxyyoyynzznzzzznzzzz1{{n{|Z||n||||n||}}n}}n}}}}n}}~~n~~n~~~~n~~nnnnnȂnȂ̂̂܂n܂nԃnnnn1nnnnnnЈnЈnnnnԉ܉nnn̊܊n܊1n1ȍЍn؍nnnnnnnĎ̎n̎Ԏn1{|oo||y||y||y||y||yzz5.z{ {{Y{{5.ԆYYz{0{{W{{oԆ00x=%z{ .<@K${{y@K${{5.<@K$Ԇy@K$5.<@K$y@K$x=%1 y =%1؄?ԉĊ?ċ܋?Ѝ??yyyyĊy~?????~~y~~y~~y~~yyyymm̎myzmĊ܊mm̎mmzzyzzyzzyzzyzzy}~mmmm̏ԏm}}y}}y}}y}}y~~ymmmmmyyyyymԉmmmmyyyỷԉyȃȄmmmЍmԏmyyyyȄyā?Ј?̌?̏?ā>Ј>̌>̏>ll lāl?Ј?܌??>Ј>>>l̂̂̂lԂ؂؂ll|}111wxWWww1xx xxxxx1ww0wxZxxzxxZ0rrSvvSvvq#0rrTvvTvvq#8sukuuuukuuvvksv0vv0stWtt#uu#vvWst[uu[vv[sunuvnvvnsuouvovvotuluulss0stZttYvv0uu1uv1ttXttZttzttZmnSqqSqqq#0mnTqqTqqq#8mnUqqUqqq#@nplpppqlqrlnq0qr0nq0qr0noWoowopWpqWqrWnpnpqnqrnooooo|oo1ooZopZpq1qqZqr1rrZop$s2$" $ &wz|"pq1qqXqqxqqXqr1oo0ooXooxooXppPppSijSmmSmmq#0ijTmmTmmq#8jlolmommq~jm0jm0kkSllSkk0kk x#3%#ll z#3%llSlmSbcShiSiiq#0bcThiTiiq#8cglghliilch0ii0ch0ii0dgoghoiioffSffXhhSffVhhVff!2$" $ &s"ff!2$" $ &x"gg0gg x#3%gg x#3%gg1hh z#3%hh z#3%#hhYhhyhhYii0dd0dd1dd2dd y3%#eeu#3%#hh0ee0ee y#3%ee y#3%ee y#3%#ee y#3%ee y#3%ee y#3%ee y#3%#ee y#3%#hh y#3%fffgScdY cdyxddobbSbbSbb s bb S# bbSbbSaaSaasxabSaa5ab5aaSaasxabSaaSaaSabS#aa2ab2aaSaasxaaSaa3aa3aaSaasxaaSaaSaaSaaS#aa1aa1``S``sx``S``1``1``S``sx``S``S``S``S#``0``0__S__S__s__S#]^S^_Y__S__S__S]]T]_T]^U^_U__U__U^_z8%^_z0&^_z(&^_z &^_zH&^_z@&^_z8&^_Z]]t1&]_T__T1&^_Z]^s^_y__S#__s__S#\]S]]Y]]S]]S]]S\\T\]T\]U]]U]]U]]U]]zH&]] w $ &H&]]z@&]] w $ &@&]]z8&]] w $ &8&]]W\\t1&\]T]]T1&]]Z]] w $ &\]s]]y]]S#]]s]]S#\\S\\Y\\S\\S\\S\\T\\T\\U\\U\\U\\U\\u9&\\U9&\\u1&\\U1&\\u1&\\U\\t1&\\T\\T1&\\s\\y\\S#\\s\\S#[[S[[S[[T[[T[[U[[V[[U[[T[[tx[[U[[S[[S[[T[[T[[U[[u[[UZ[S[[SZ[T[[t[[TZ[U[[Z[[UZ[V[[Y[[VZ[W[[WZZSZZSZZTZZZZZTZZUZZYZZUZZVZZVYZSZZSYZTZZtYYUYZVZZU:;S;<o<<S<<o<<S<=o==S=?o??S?@x::T:<T<<T<<txn>>V>?n??V?@V:<m<<<<S#<=m====S#=@m;<S<<S<<S==S=>S>>S>>S>>S>>S??S??S::0<<0<<1??Z>>Z=>5.??5.=>0>>W>> z@% w!??0??x=%=>z@K$??z@K$??x=%1?? z =%1XYSYYSYYSYYSXXTXYTXXxyt"#($yt"# $!yt"#H$!yt"#@$!yt"#8$!yt"#0$!yt"8$!yt"#!XXkyt"#($yt"# $!yt"#H$!yt"#@$!z8$!z0$!z8$!yt"#!XXzT1&y"#($T1&y"# $!T1&y"#H$!T1&y"#@$!z8$!z0$!z8$!T1&y"#!XXT1&s"#($T1&s"# $!T1&s"#H$!T1&s"#@$!z8$!z0$!z8$!T1&s"#!XYwT1&s"#($T1&s"# $!T1&s"#H$!T1&s"#@$!z8$!z0$!T1&s"#!t!YYju($T1&S#"# $!T1&S#"#H$!T1&S#"#@$!z8$!z0$!{!t!YYu($T1&S#"# $!T1&S#"#H$!T1&S#"#@$!T1&S#"#8$!T1&S#"#0$!{!t!XXyt"XYzYY T1&S#"XXyt"#XX T1&y"#XYYYYT1&S#"#XXyt"#XX T1&y"#XY T1&s"#YYUXXyt"#XX T1&y"#XY T1&s"#YYT1&S#"#XXyt"#XX T1&y"#XY T1&s"#YYT1&S#"#XXyt"#XX T1&y"#XY T1&s"#YYXXXyt"#XX T1&y"#XY T1&s"#YYSYYT1&S#"#XXyt"#XX T1&y"#XY T1&s"#YY[XXt1&XXTXYT1&YYTYYT1&XYsYYS#YYsYYS#WWSWXSXXSXXSWWTWXTWW8zt"#@$zt"H$!zt"#8$!zt"#!WW0zt"#@$yH$!zt"#8$!y!WW-st"#@$zH$!st"#8$!y!WW3S#t"#@$zH$!S#t"#8$!y!WW<S#t"#@$zH$!S#t"#8$!S#t"#!WWHS#t"#@$S#t"H$!S#t"#8$!S#t"#!WWzt"WWyWWZWW S#t"WWzt"#WWst"#WW S#t"#WWzt"#WWst"#WW S#t"#WWzt"#WWst"#WW S#t"#WWt1&WWTWXT1&XXTXXT1&WWsWXS#XXsXXS#VVSVVSVWSWWSVVTVWTVV"st"8$st"#! VVy8$st"#! VV!y8$S#t"#! VVst"VVyVVst"#VVSVV S#t"#VVt1&VWTWWT1&VVsVVS#VWsWWS#VVSVVSVVTVVTVVTVVtxVVUUUSUVSUUTUUZUVTUUUUUYUVUUUVUVVUUSUUSUUTUUZUUTUUUUUYUUUTTSTTSTTTTTtNOSOOoOPSPPoPPSPSoSSSSToTTSTTxNNTNOTOPTPPtxPTTTTTTTTNOUOOUOPUPTUTTUTTUNOsOOOPsPPPPS#PSSSS#STTTsTTnOOSPPSPPSQQSQQSQQSQRSRRSRRSRRSRRSRRSSSSSSSSTSNN0OP0PP1SSXSS?SS>SSSSS0SS>SSsSS1SS?SSsSSXSSoSSnSSSSS0SSnSS1SSoPPs1$"PP y=$ PQZQQPQQZQQy@$@K$z!""S"#S##S#$U$$S$$U""T"#T#$T""0"#S##S##0##S#$S$$0##0##X##x#$X""W""Y""y{""s 1"" S# 1LMSMMPMMSMNPNNSNNSNNSLMTMMTMNTNNTNNTNNTLLULLYLMUMMYMMyxMNUNNUNNULL{:%LM[MN[NN{:%MM t1&8$s1&!MM t1&8$p1&!MM T1&8$p1&!MMT1&8$S1&!LL0MM0MM1MM2LLULLuxLL[NN[''S'+l++x++S++l++x++S+,l,,x,,S,,l,-x--S--l--x--S-.l..x..S..l''T'+j++T++j++T+,j,,T,,j,-T--j--T-.j..T..j''U'+k++U++k++U+,k,,U,,k,-U--k--U-.k..U..k'+o++S#++o++S#+,o,,S#,-o--S#--o--S#-.o..S#..o))1))T..1'(0((n((((n()))n..n((m()m..m))0))X))x))X..0SvxSSvxSSSSSSSSSSSSSSSSvxSSSvxSvx!S!!S!!S!!vx!!S!!vx!!S!"vx""SVS#VS#VS#VS#VS#VS#VS#VS#VS#VS#!V!!S#!"V""S#1XnXmXXXXXX1X 1 2 !1!!2!!n!!m0SS0SS0YS0YS0YS0ZSZ0YS0YS0S00S!0!!S!"0%H0H%$!0)(8/%|H0H%$!0)(8/0 @$ !~ @$| !0ZY y!Z!!00ZzZ0!0o|ooo!!o00!!0o|ooo!!o!!o0~0!!0nnn n0 0nnn n0 0nnn n0 0nnnn n0 0YYZZnn n n0 0 0nn n!!n0 0!!0|S|SSwxSS S S S S SSSSwxS|T|TTTT T T T T TTTTT |W|S#WS#WsWsWsWsWsWsWsW S# W S# W S#WS#WsWsWsWsWS#|V|T#VT#Vt T# t T# t T#tT#VtT#oooooooo o1212o$Z$|{ { { { (Y(8t t 0L0L|XXY0L`Ul|UUUUUUUUU U UUULXYp|Yl   lmm0 n0  Z   Y    z=$  Y  X z@$@K$x!  @$@K$x! Z y=$  Z  Z y@$@K$z!  @$@K$z! Y l   ll m mm 0 n00 ? ? > > l   ll m mm 0 n00 ? ? > >ZzzzZYyY00zzzyyyWwwwWXxX00ZZYYZzzzZYyY00zzzyyyZzzzZYyY00zzzyyyWyWX xwy"#X020yy|yzz|zWyWX xwy"#X020yyxyzzxzWyWX xwy"#X020yyxyzzxzoXxXSxSSxSSxSSxSxoS#oS#oS#oZZYYIJSJKnKKSKKnKKSKLnIJTJKoKKTKKoKKTKLoIJUJKmKKUKKmKKUKLmJJXJKKKXKKYKLXKKSJJ0JJ yH3%#KK yx#3%KL0DESEGmGGmGGSGGmGGSGHmHHSHHmHHSHImDETEGoGGTGGoGHTHHoHHTHHoHHTHIoDEUEGlGGlGGSGHUHHlHHUHHlHHUHIlIISDEVGHVHHVHHVHHHHVHIIIVEE1EEZFFZHH1II1FFTFG3$GGT#3$FFnGGnIInFG  $@%$)FGSGGnGGSFGsGGGGsEE0II0II0EE0FF0HH0II0EEEEEEZEExEExEE1EEZGG0FFFF $ &2$" $ &FF  2$" $ &FFZAA!5.AA AASAA AB!5.BBSBB AA0AAZAA .<@% z!AB0BBZBB!5.<@% z!BB0BBZBB .<@% z!AA .<@K$AAs@K$AA .<@K$AB!5.<@K$BBs@K$BB .<@K$BBy=%1BB s =%1BB z=%1@@S@@S@@S@@ s=$ @@p@@Y@@s@$@K$y!$%S%%m%%S%&S&&m&&&&n&'S''S''S$%T%%o%%T%&T&&o&'''T''o$%U%%U%&U&'U''U''U$%V%%V%&V&'V''V''V$%0%%1%'0$$0%&0&&2''0$$S%%z%%z%&z&&&&s''S''S&&U&'U''U''U&&V&'V''V''V&&T&&o&'''T''o&&S&&m&&&&n&'S''S''S&&0&&#&&''0&&&&&&''S//S/2n22S23n33S33n33S35n55S55n55S56n66S67n//S/2n22S23n33S33n33S35n55S55n55S56n66S67n/2n22n33n34n55n55n66n67n00101o661//0//m/000m0001m66066m/0S00S01S66S00001Z660000000o00z $ &#3$"00100o1667112$" $ &672$" $ &12o23o33o34o4445o55o55o67o34o4433S34l34S34044144044144044134l4477S78o88S88S88o88S89o99S9:o77T78T88T88899T9:T::877Z9:Z77y9:y88q#888S88o89o::o88S89S::S88288S89S89289199X89099Z99z99ZBBSBCWCCSCCWBB1BCSCC1BB0BBZBBzBCZCCzCCZCC0CDSDDSCDSCC1CDXCC0CDZDDzDDZ__S__sx_`S__T_`T__s__S_`S#_`T1&,J 048<D`                     !!!!    !!!! !!         ! !  ""#######$$$$$$%&&&'''&'''((((((((()))))../////222222233333333333455555555555556666667/////0//////00000000016600000011113334779:888899::88889999:;<<=====>??@@@@AAABBBBBBBBBBBBCCCCDEEEEIIIIEEEFHHIIEEEEFFFFJJJJKKKKLLLLLMMNNOPPPPPQSSSSSSSS[[[[````````aaaaaaaaaaaaaabbcccccddddeddeehighiiklllkkllooooooqqqqttvvuuuuwwwxwwwwwxyy̎yyyy̎yy̎yzĊ̎yyyzĊ̎yyyz̊ԊĎĎz|Ԇzzz{{{Ԇ{{{|{{||||̄Ѝԏ||ăȃ̄Ѝԏԃ܃̄ȍȍ||}~̏ԏ}}}~̏ԏ}}}~~܋~~~~~~ԉԉԉāЈ̌̏āЈ̌̏āЈ؈āЈ̌ā܁܁ЈԌ،Ȉ̄ԉĊЋԋ܋Ѝ̄Є؄ԉĊċЋԋ܋Ѝԉ܉ĊЋЋ؍؍đ̒ВԒؒВԒؒJAP runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesbigarray.ccamlatomic.hmisc.hmlvalues.hstddef.hstdarg.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hbigarray.hcustom.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hsignals.hstring.halloc.hintext.hhash.hstdlib.hstdatomic.h  !y !! ! !0   0s   s  .&<  / = !.' > %J9 'B>  ~J! ).E% E  2.%. ) #f   J< . .<     .  < < p   .      <$   . .    <#   J< . .J     .  < <#   J< . .<     .  < <"z   .      <#   . .      < s   }f }<!. }    . . .< .}!!K=/ ! $ ! }!K=/ !  } J   <  J $    X..   X .  . .  .   <  J Lx     X..   J .  . .  .   <  J  .  .p~) #f  ~.   ~.#  ~.#  ~.#  ~."  ~.$  ~.   ~.f   ~.f  4d  z.Ld  *." . 3/!"<0 ( !!(  !u " "=%##% //./%##% ./   =, .<%-  A  0~.;  J / ! !#X(2<I!-!jX2<<!-!XJ<!-!7 0%1u %- !  4%Y %-4 %   %- !4%   82<<!-!x<6<<!-!s<6< <!-! U< 4 z 1Xt` X<t +@  1!x Y.. iJ   =.!w?.w  ?"!?!" ","x< ! .)JE% E  2.%.   JJ   J.<.~f=!yC 1).42. 4 2.% )2%   ."( )c4 2  4 2 % ."$ " 5 J.p<$" ."p ; < j.#%.# 6 t z  y z K'2A 1f  $ 2! )  ! ! ! v"$." 6 o #! #.7."$" .8  '  !/= u%# .8 z  ..  #" "   ZJ <zJ.x,/K=/ !  C w ='/ .    [XA    n #f g.  # ( z  "  X# . )/E% E  2.%.) E% E  2.%.X "th ! .)E% E  2.%. * Kty w 'y 5!//1. v ! 1,  ~"<!  .~.!.", .~.  J~23  $!    O  " !! !0 <.X p< K=  p .. =? ..< =X  .JXK<g   .t Af]!! X&./- /.- "<&-"   Y< &8/ -  ". .   K!J+|  |<  0 X ./ !"!! !"3% %  !  !=zt/ !" ?J <5</!<1 f).42. 4 2.% )2%   ."* )4 2  4 2 % ." .1`fzz./!!K=/ !   i9 .L .P .L .zJ .R .L .N .H .J2-Q .//N./  - / N .2!K./  0   [f .<*J !. / ! ? 1  ! ! ? 1  % -! !+{  -  .O # ./ .  $!(w. (A. f%  3# ./!x $ ' "   "  '  2=(uJ.f%  3# ./! n (  # !  "!  !-!/!"/"#  .=(kJ.< /. / !w ? 1  ! ! ?  0  % -! !*:  <@+z  z    N # </#z  w '% z '(t  (A.< # </ # %o "v!! %v. %v. % v  (n  (A.f # </" #  e !!! q!!% n. %n. %n. %n. %n. %n. % n  (b  (A.#<  !k  ./ <!","#+"1yv ! /  &"y." %") tq ! /   "t. "v   "v.tl ! /   "o."q   "q.t  !k- !! f=//K/. " x  >":>=+x  x   ! .1"  .%"++!) $  /+-+!).$)$.?J6t?2 6 ? 2 6 ? 2 6?2 6?2.6?2  /!" ,"" "." "  "1# ". > .J.<bJ/J$f/ - / -    $.-/ - / -<  $-   !6. - )6  6.) !!! !J6? ? 2  Jd  XX <zJ)J/!;/.<' -//'1-$ ##(20  > .  #  / . 0; 0   .M # !. =.&<tX !0; J  % ,%" " % ", "1# "0","" .. bf. +Y8' 8  /.'.!qJ   J  X" .JX=/!//. /! u ! !  .  z ! !/ .K.'I  w+v   "#= J,XZ/ !"$"! !"".$v $ v . !)tE% E  2.%.  1 J>" ". > .. n</ !"" < v.   X.$ x v $ v < J  JJcaml_ba_element_sizeint8_tc_stack_linksize_tallocated_words_resumedmark_stackmemory_order_acquiredependent_sizecaml_ba_byte_sizeint32_tbacktrace_slotephe_infomemprofcaml_alloc_custom_memcaml_ba_uint8_set64caml_ba_fillcaml_raise_out_of_memoryextra_heap_resourcesdenorm_magicsignshared_heapcaml_heap_statecaml_ba_deserializecaml_hash_mix_uint32CAML_BA_SINT8requested_major_slicesub_dimscaml_ref_tablecaml_deserialize_block_1caml_deserialize_block_2caml_deserialize_block_4caml_deserialize_block_8caml_atomic_counter_initephecaml_ba_num_eltsslice_targetvind1vind2vind3vlenheader_t__uint8_tcaml_custom_tablestat_promoted_wordscaml_leave_blocking_sectionlong intlocal_rootsmemmovetrap_barrier_offlimitstat_forced_major_collectionsuintnatsixtyproxyCAML_BA_FORTRAN_LAYOUTcaml_intern_statestat_blocks_markedcaml__roots_rescaml_ba_serialize_longarraycaml__dummy_vbuses_resourcescaml_final_infomemprof_domain_scompare_unorderedcaml_minor_tablesntables__atomic_store_tmpsigned charuint8_tcaml_ba_finalizetrap_sp_offcaml_deserialize_sint_4caml_float16_of_doubleCAML_BA_MANAGEDunsigned char__int128 unsignedbacktrace_last_exnnum_bytescaml_ba_dimcaml_custom_elt__atomic_load_ptrcaml_serialize_int_1caml_serialize_int_2caml_statefinal_infocaml_serialize_int_8__builtin_va_listdimcopycaml_debug_abort__gnuc_va_list_Boolcaml_ba_reshapenew_dimvaluecaml_ba_serializecaml_gc_policycharserializecaml_ephe_ref_table__uint16_tcustom_operationsextra_paramswsize_64CAML_BA_INT32__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicesflagscaml_ba_managedextern_stateCAML_BA_CHAR__jmp_buf_tagwas_infnanmax_valyoung_startvinitcaml_hash_mix_intnatvindcaml_enter_blocking_sectioncaml_ba_slicecaml_alloc_smallcomparemant_oddmallocsweeping_donecaml_copy_int32tablesfloat_bitsreserveCAML_BA_SINT16caml_exception_contextcaml_umul_overflowblit_errordst_dataCAML_BA_C_LAYOUTCAML_BA_INT64caml_ba_subarraycaml_invalid_argumentcaml_hash_mix_floatoo_next_id_localminor_heap_wszcaml__dummy_vsrc__uint64_tcaml__frameCAML_BA_FLOAT16long unsigned intfinalizedependent_allocatedslice_budgetexn_bucketruntime/bigarray.clongjmp_buffernindcaml_copy_int64__mask_was_saveduintptr_tyoung_end__builtin_memsetexternal_raisec_stacksigjmp_bufcaml_ba_dim_1caml_ba_dim_2caml_ba_dim_3vkindCAML_BA_FLOAT32caml_float16_to_floatgc_regs__uint32_tGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_doneva_listcountertrap_barrier_blockcaml_serialize_int_4caml_hash_mix_int64caml_ephe_infomemory_order_consumememory_order_seq_cstdoublerefcountcaml_double_of_float16caml_ba_createlayoutcaml_ba_set_genericcaml__roots_vsrccaml_extern_statememory_order_releasefloatcaml_ba_get_genericcaml_ba_blitcaml_ba_deserialize_longarrayswept_wordsthresholdcaml__roots_vbcaml__temp_resultunsigned intcaml__roots_blockintptr_tcaml_atomic_counter_decrCAML_BA_COMPLEX32gc_regs_bucketsCAML_BA_FLOAT64requested_external_interruptcompare_extcaml_ba_arraycurrent_ramp_up_allocated_words_diffCAML_BA_UINT16offset__saved_maskblock__jmpbufnewvalCAML_BA_SUBARRAYnum_elts__jmp_buf__atomic_store_ptrnitemsallocated_wordscaml_ba_layoutf32inftynextvdimyoung_limitsign_maskcaml_ba_kindflags1long doublecaml_ba_subnum_dimsflags2CAML_BA_COMPLEX64caml__dummy_resunique_idcaml_ba_hash__int8_tallocated_words_directaction_pendingbacktrace_poscaml_ba_opssizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcaml_ba_set_auxchanged_dimuint16_tcopy_two_doublessub_datacaml_ba_offsetcaml_copy_doubleoverflow_32allocated_words_suspendedf16maxcaml_ba_get_1caml_ba_get_2caml_ba_get_3deserializeephe_refinside_stw_handlerfixed_lengthCAML_BA_NATIVE_INTcaml_ba_get_Ncaml_ba_uint8_get16memsetcaml_ba_proxycaml_serialize_block_1caml_serialize_block_2caml_serialize_block_4caml_serialize_block_8__int16_tsrc_datacaml_failed_assertCAML_BA_CAML_INTmin_valchar_osdestvofs__int128caml_deserialize_uint_1caml_deserialize_uint_2caml_hash_mix_float16caml_deserialize_uint_4caml_deserialize_uint_8backtrace_activeinitcaml_ba_alloc_dimscaml_ba_num_dimsvlayoutstat_major_wordsmemprof_young_triggerCAML_BA_FIRST_UNIMPLEMENTED_KINDCAML_BA_UINT8caml_float_to_float16requested_minor_gcyoung_triggergc_policycaml_ba_alloccaml_ba_uint8_get32CAML_BA_MAPPED_FILEcaml_ba_comparecaml__temp_d__atomic_load_tmpcaml__temp_icurrent_stackatomic_uintnatshort intuint64_trequested_global_major_slicecaml_ba_uint8_set16int16_tindexleave_runtimeextra_params_areatag_t__valexn_handlerinit0init1asizebsize_32caml_ba_set_1caml_ba_set_2caml_ba_set_3caml_copy_nativeintCAML_BA_EXTERNAL__int64_textra_heap_resources_minorcaml_array_bound_errorcaml_ba_set_Nmemcpyyoung_ptrcaml_hash_mix_doublecaml_local_roots_ptrasize_tdls_rootmlsize_tstack_infostat_minor_wordsnum_indsuint32_tlockedcaml_ba_uint8_get64caml_atomic_counter_incrfreeshort unsigned intmagiccaml_ba_change_layoutnargsbasemajor_refcaml_ba_uint8_set32intern_statecaml_deserialize_errorHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_ba_update_proxy__int32_tparser_traceint64_tvsrcintnatbsize_64custom_fixed_lengthcaml_domain_statestack_cachehashvdstminor_tablescaml_ephe_ref_elt__sigset_tdatawsize_32identifiermajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA  tPQBDAAAAAAAA CB ҜAEAAAAA AFA~EAAAAFAAAA] AFA~EAAAAFAAAA\ AFA~EAAA AA AAAAAAAAAABAAAAAAAv ABAAAAC A ABAAAAC A ABAAAAC A ABAAAAC AABAAAACAAC ABACAAAAAA~\,BH AA N AAA~IBABA AAA~EBAAA ADA~E A AFA~DA8dDo AACA~OAAJG ACA~NACK AAA~NAA BA I AAA~PAI AAA~NAG AAAA~[AG AAA~LAG AAA~PAXA~BAAKBC AAA~MAF D A ABA~B A ABA~B A AABA~B A ABA~B A ABA~B A ABA~B A ABA~B A ABA~BAA ABA~EAAB ABA~A A ABA~A BBA ABCA~XdpA~DA<thB ACA~CB_AACABA~cC ACEA~KACArAAA^ MAA E MAB D MAC D MAA F MAA FMAAA~AAAAGABAd,B ACA~FAAc AAAFAC D AAAFAC E AAAFAA IWE AAAFAA D AAAFAA D AAAFAA GCBABABB C B C C@tEN AD A ACA~S BAC XAA AFA~D AA 8\C ADA~} FAB D GAA hxPD ADFFA~] B f HAAFA KKCMKI A G,<E AEA~_ EAB l CA~k BAD DA ABCA~A ABAA RALAP AC BA<DpA~EBADFA~EBAHFA~FBA8LTPpA~dDpA~U BAA DpA~` BAA @EpA~EBADFA~EBALGA~FBA ,`SpA~D\pA~\kpA~tXQpA~HMpA~HMpA~HMpA~< |C AKA~u JAC @ PBBe ACA~i CAD HAB BD A AFA~EA0 XC AGA~X FAD @ $C AHA~N HAC J HAA C AJA~ IAA bcB IAA NArAAAnnMAAD IAA tHdH]\RAJ I A H I AI A AG XDODYBECEEEHA( C AEA~j DAB Agnu H`h7tL   \ tlw,0d%<Qh}x,*BZaz %;hRiz x8Ph ,=<KDYHg{T(@@XDpL `+?PX\0HjHHx`Hx|X$ ,3 C @O 8bigarray.ccaml_ba_offsetcaml_ba_serialize_longarraycaml_ba_update_proxycaml_ba_set_auxcaml_ba_comparecaml_statecaml_failed_assertcaml_debug_abortcaml_ba_finalizefreecaml_ba_hashcaml_hash_mix_uint32caml_hash_mix_intnatcaml_hash_mix_doublecaml_hash_mix_floatcaml_hash_mix_int64caml_array_bound_errorcaml_serialize_int_1caml_serialize_block_8caml_serialize_int_4caml_ba_serializecaml_serialize_int_2caml_serialize_int_8caml_serialize_block_4caml_serialize_block_2caml_serialize_block_1caml_ba_deserializecaml_deserialize_uint_4caml_deserialize_uint_2caml_deserialize_uint_8malloccaml_deserialize_block_2caml_deserialize_block_1caml_deserialize_block_8caml_deserialize_uint_1caml_deserialize_sint_4caml_deserialize_block_4caml_deserialize_errorcaml_raise_out_of_memorycaml_invalid_argumentcaml_double_of_float16caml_float16_of_doublecaml_ba_num_eltscaml_ba_byte_sizecaml_ba_allocmemcpycaml_alloc_custom_memcaml_ba_alloc_dimscaml_ba_createcaml_ba_get_Ncaml_copy_doublecaml_copy_int32caml_copy_int64caml_copy_nativeintcaml_alloc_smallcaml_ba_get_1caml_ba_get_2caml_ba_get_3caml_ba_get_genericcaml_ba_uint8_get16caml_ba_uint8_get32caml_ba_uint8_get64caml_ba_set_1caml_ba_set_2caml_ba_set_3caml_ba_set_Ncaml_ba_set_genericcaml_ba_uint8_set16caml_ba_uint8_set32caml_ba_uint8_set64caml_ba_num_dimscaml_ba_dimcaml_ba_dim_1caml_ba_dim_2caml_ba_dim_3caml_ba_kindcaml_ba_layoutcaml_ba_slicecaml_ba_change_layoutcaml_ba_subcaml_ba_blitcaml_enter_blocking_sectionmemmovecaml_leave_blocking_sectioncaml_ba_fillmemsetcaml_ba_reshapecaml_ba_opscaml_ba_element_size2@B 2FZJXR 0V 2\Cf 0F2J2R0V0\ ZXC22&0*00 zZXC2200 2@ 62 F0 `   , N2 V0 \ v20 z2P 00 0P  2 @ < ! (" # h $ 2@  20 % & ' (& @( l( x( & ( ( 8* l* x+ 2 @ X' , - @.  ` `J2Z0d 0 0 1  2  2 03 2(@(44 t5 6 7 8 @8 T8 t9 6 9 .2608: B2XN0XX: b2j0l: v2~0: 20  3  2 0202000 ;  H20@0 2 020 20<  2  0  2  0 2 0"& 2"* 0"B "; # 2# 0#Z2#^0#`C #B #3 #2#28#0$08$ $*2$.2$60$B0$D $b2$f2H$r0$v0H$x $2H$0H$ $2H$0H$ %A %2%2%0%0% &A &2&0&< '2' 0' < ' H'28'@8(R 2(V 0(Z 2(b 0(G (G (G )8H )PI )J )K )K )2*0* *2*&0*(< *\F *F *F +,F +% +H ,% ,I ,% - -D - - - .L% .% /% 0200 000< 0V200Z000d< 0200000< 0200001< 1nZ1zX1C2 H3 23 034A 3\ 4@ H424240404 42@40@4< 4Z4X4C5A 6  626260606 6Z6X6C7 27 08A 8H 828280808 92h90h9< 9>Z9JX9PC:F 2:J 0:hf :|g :h :g ;2;2;0;0;  ;:2;>0;@< ;nZ;zX;C<62@<:@@<f <j = 2= 0=f ?f @,f @f Af Bdf Bh B2HB@HC22C62C>0CB0CD Clf Cf D$f EDf Epf Ef Ef Ef Ef F f F|f Ff Ff Ff Gf G f Gf G,f G<f G`j Gf Gf Gf Gf H 2H0H H>ZHBXHDCIA I J>2JB2JJ0JN0JP J~2J0J< J2J0J< J2J0J< &(&& (& &(&0&8&'@&b&h qlv4a  Gr(6DR`n | $h " ~H 8*  0$ y2 @N\jx  |@s B ): FR^+jhv|=;pE/' U* 6BN`jya&HH  = H  5* ,43>qWdwV ] g 2nOb O  } Q. %&,4`BHbOWe my  k Z  B + 89 K W ds q ~t    _ B * 6 S ^ l y  ,   \    #Z 6 B' O \ j v\    Z   t \ 1 K X eZ zF  O m& l&   " ( CF I _ u8   3 O   'g2CN^s h| }3NYiL"#r&H0$( - B88<2AMEX`\Xa q|X    =H@ &J&'&I< GuKqU&H_ .os| .&IX Z Z ~ &I&I&JX*&7&H&J]&g&Jx&&;`OImE  c _.2w7BFK V Zy_hs w |8Q  &=&B&G&=d - ! w  k   &Gl5 19 -B KV `Z V_ dp   &Bl&E&F p    &C &E&G$(91<N@HEMJVmi&<&Gh&<&Ex&Erh !'&EL4&EA&GDP Ydhm "r~ P &D,&F&G4 :ND ^ | &A&F'&G6 ?JNS Xd 2vz&?&G&Gj@6xn&Ct&F &F T%049DHM xR^ p tz&@4&G nf  $&A&G $"(2&;<LAP=U^ZbRk)tx&CL&&&H$& m&90-&*/y:>COEZ^c s)~2.KC|v&;8&9&*0 9 DHS du~&: )#&:p&:&:&:&;(#&0&A&;HR&] }h&6GAAga\E  X (,<@P(T"YtdBh>xa|S&8L !&8 &8L&8&&3&D&9U&h`@k&471WQEwq X   )Z48=M_ci&6$~ &5&6$&6p &6& &  &1` @ D I T& X ] iE tF x@ }  ` \ X  u q y     !!! !!!!!,!0!5!G8!K$!P&4D!e!w!{!!!!&3`! !!!&1!!!!!!"" "&3"+&38"P&3`"]&4"r&"&"&4"&@""" %"&1@## # ##  #& ]#1&1 #R4#V0#\ S#g&0#L#F#&0##k#g##|######&1 #&0# E$ &0$*$.$7&0$Ap$M$Q$Z$^ $cp$l0$p*$yO$}K$&0$&0$ 7$&00$f$`$&00$[$$$%%[%%%%%$&0l%5&0%B%%&/%%%%%%&.%'%%&U& Q& &o&g&.&2&A&E&T&X&g&k&z&~&&&&&&&&&)&'&;&1&&/'k'&.`'0y'4o'9'D'H'M 'X'\'k'o'~ ''*'&'I'G'W'Q'z'v'''&.'](&.(!(%(*(5(9(> (I!(M(\H(`D(od(s`((|(((((&.T( (&-((() ) )  ) () ")!&-)+P); C)? A)HP)Q M)U K)^ Y)b W)i&-)])&-) e) a)) {) w)V) ) )&-**!&-p*B *F *KJ*V *Z *_P*j *n *sV*~! *!* *!&*!"**&-**&- +!<+!8+J+"!T+&!N++P+6!s+:!m+? +J!+N!+S+b&-H++&,+!+!+J+!+!+ +!+!+&-,d,*&0,K!,O!,T,_"\,c"N,h,s",w",| ,",",#u,#g,y, ,#,#,X,$,$,&p-$:-$8- &-($D-,$B-6&-@c-P$P-T$L-Yc-g$w-k$m-t$-x$-&-$-$-&-&-&-& -&..&,0./$.3$.8.C%!.G%.W%A.[%3.j(.n(.}(.(.)!.).)_.)W.).).).).*5.*+.*.*/*/*/+/*/&,/+&,/9/D&+/e+4/i+,/n/y+[/}+W/+y/+m/,/,/-"/-/-U/-O/-/-/-/-/-0-0&,0&,0#p0.&+@0O.,0S.$0X0c.S0g.O0w.k0{.e0.0.0.0.0/+0/%0/R0/J0&+0 Y0&+ 1/1 /}11/1/1'&+ 11&+ 1N/1R/1[&+ 1p/1t/1}/1/1&+01 1&*1/1/1J1/1/1P101/2V2 0!2022%&*2F2Q&*2r072v032{J20O20I2P20n20h22&*22&*@20303J30303&*`3=b3H&' 3i03m03r3}1"31331k31_31313y3 320323$32323&)4 2424&)4!:4-24124:24>24C:4L24P24Y&)4r24v242424&)434343434&)4&)43%43#5&)5E53/53-5'395+3750E593C5=3A5F&)5_3M5c3K5l3X5p3V5z&)53b53`53m53k5&)5&(H5/53w53u5/53536&'6 &(6>&(6K&(6X&)@6e&)X6r&)6&*6&6&*06&6777 7,7:7E& 7e37i37ny7y47}47 74<74.774y74q7&774747 7&&7 a848 4885-85!8" B8-5q815a8F 8Q58U58ZZ8e58i58n86>8668&'8&8&&886a86_886k86i86y86u8&&9&'9*&95E9\ 9h9 z9<9 999&: 6:6::7w:#7[:(:38:77:E8:I8}:N :Y9:]9:b&:9=:9/:$:9z:9t:&@:&t:&:>:9:9;&;&;&`;+&;8&;E&H;R&;u&;&l;&;h;; ;,;;<3 <>& <^: X<>B<d<?-<?!<t<?i<?]<<?<?=& =&==1?=5?=:=L?=P?=U& D=c&=q=@-=@!==@`=@\=&p==@}=@q==@=@=& =>@> @>>A> @>%&>4Z>FA!>JA>Oo>]Ad>aA`>j&>t>Ay>Au>A>A>&>&>A>A>E>A>A>& >>B>A? ?B6?B0?& 0?(&?9&?U?`&?Bo?BO?C?B?C?C?E"?E? ?E?E? j?FJ?F@? ?F?F? @F@F@@)F@-F@<GS@@GO@G@ZGh@^G^@mG@qG@v@G@G@@G@G@G@G@&@@H@H@@H1@H#@&AAAHAHA&&dA7&AD&AX$AkIAoIA~IXAIPA4AIAIwAIAIAIAIAIA&A&A&ABIBIB!JB%JB*B8J5B<J-BABPJYBTJUBcJnBgJjBl&8B}&B&BBJBJBJBJBBJBJBBJBJCK C KC`C%K.C)K$C8K^C<KXCAkCOKzCSKvCX{CgKCkKCzKC~KC:CKCKCKCKCECLCLCUCLCLCL=CL7CD L`DLVD LD$LD)D7LD;LD@DOLDSLDbLDfLDn DMDLDMDMDDMEDM?D%DMdDM^DMDM}DDMDMEME MEEME#ME(E7NE;MEJN$ENNEV^EiNCEmN=E|NaEN[EiENENEyENENENENE&E&ENENE&F NFNF& hF'&F\Fb& FO FOFOFOF& FYFOFOFYFOFOF& F&PF&0G& G& G & 4G-& dG>&GPG[&$GrZG}PGPG GPJGP>GGPGPxGPGPGPGPGGPGPH&%H-&%H>&HK&H]Hg&"PH~ZHQ?HQ)H HQHQHHRHQHRbHRRH HRHRHHRHRHHSHRII SISIS:I!S4I.SVI2SPI7DIGIXSxI\SrIa&"IISISI&"IISISISISISISI&#I&#J T JT J&#JE&#JOJ^TJbTJkT'JoT#JxTsJ|TqJ&#hJ&J&#J&$J&8J&$LJ&K&$K$&HK1&KA&$KV&HKl&$K}&HKwK,K KKtLKL& L8& LBLNTLRT{LWLeTLiTLrU[LvUOLLULUL L& LVLUL& L& LVLVLxLV&MVM ]M% 4M4MCMR SMr$MM wM:MMMMN N MN8 NI MNbNo MN NNN&@NVvNVbOVOVOW"OWOWbO WVO)WO-WO6OCWOGWOPWOTWO^& OhOxX<O|X4OXgOX_OXOXOXOXOOOY OYOY=OY5O&HO&tO&P&0P&P-&PD&Pc&P~YPYcPZPYP&PNPZPZPNPZPZPPZPZPQ[CQ [;Q&Q&(Q1Q>[fQB[`QK&TQUQe[Qi[~Qr[Qv[Q[Q[Q&@Q&Q&Q Q[Q[Q[Q[Q\>Q\,Q&QR\R \R\R\RR$\R(\R1&RJ\RN\RW\R[\R`& Rm&HRz&\R&R&R&R &R&<R&|S&|S,&SF&S`&tSu&S&S&S&S&S&S&S&`S&XS&T]T]T$]jT(]\T6&T@"TP]TT]TY"Tb]Tf]Tk&T|&T&0T&T-T]T]T]T]T-T^T^T&4TBT^T^U^*U ^(UBU^4U"^2U+^>U/^<U:&U\&Uy^KU}^GUMU^cU^[U&(U&U&!@U^U^U^U^UV^V^V&!V._V2_ V;&!VE&!V\_$V`_"Vi_0Vm_,VvV_HV_@V&/V_nV_hV_V_V_V_V_V_V&0V&0VV VkWm&m& m&SHSHTHT8m&T^m&[P[P[P[P[m&\m&&_&   \ x@h`0  !@!"P@$p&' *@**<+ P+@h+,0,- -p--0.H.``.x//00001 1@ 1` T4 6 90 ;` H0.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rodata.cst4.rodata.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @J @ "&J,J12J2EN0P@@ON8J@pTR aR8nS@i@0 S@W@H'o_@}`P@0@~0p JE@~0hW0~* ~L @~8 oTh P d0blake2.bd.o/ 0 0 0 644 42200 ` ELF@@p|txx!Aa!Aa!@cH}B|((@@@ 9kcH=@Q= tTaJRa)h4 (08,&yJy)eJe)+>aJa)l}Rx}kJxAl<|`&Txd`B99$} 9A(`898`|4,} 4,9 9Jx8|$,|$,*9&xB<[?Oa?`addekdc_de+>eJAe)~8|bx`;ak+`c6H@`alaJka)!y (_0?8P@8!N |(>@AT9?X|3x}#KxxH`8 |cH`9 ?P|8!N 9?X;@|3x}#KxxH`8 |cH`9 ?P|K```|<${{>$;9APa$xxxH`P8!!|N ``8cX|cH`=P8!JP!|N ||#y|x!qA(>@xp|+xAP;X8 ||H`P8xxH9 9`U*8U'9)}_P*}J<6}]Ay( |(@Apx8!|N ```<A9!p~9@98`>AAxapH`88|}x t:?- " ?"% ((+0.82@6H9P=XA`ChFpIxLPT[`rthwyD{N}X]t? H(,0g8.id H@HHtPlXl`hpxxHt E FC G8 Hp@ D D   IS\bs}/ &0 22!th len @ .P(X:(:u8:_  8@O    % # 9($ 0%%>8dHttt! t   9*_8 5 5end 5 5ptr 5 5  5,( 5,0 7 8 t 9  : t8 <L <Lend <L <Lptr <L <L  <,( <,0 > ? tmem @ max A 8 C Cend C Cptr C C  C,( C,0Q : : ,: ( , R: : <3 R !d 0t 1 S  2 p tAt   Z ,= H.+ ;&.3e XO XHWt (t key7t buf)t ofs4t len?t4 SSTTUUVVWWt c)t key8t buf)t ofs4t len?t"ctx} . t S  STVT A *ST1&"U1& BSSTUt ctx(t3t DH len . t 8t PS  nTU ;S T UDt@3 ctx)t buf4t ofs?t lenJtAT U1&T"UV1&t)t key8t DH ctx res tt  S JS T8U# wST1& ;S T U$ 4 ctx(t# L< s*.2<8c i zT0 STV1 ;S T U T05 SSTS#XV1 ;S T Uu s+) len6.  n . S"TU STUV0S"#X ASTUV0 kSTUV0 STUV0STU|| s|)}.~. key~6 < i H [SU {T0U SU T0U ;S T U$OTr sO-P+P8.QH v0S v1S v2S v3S v4S v5S v6S$ v7S( v8T v9T v10T v11T v12T v13T# v14T( v15T-"mU r}  ie H67ii H8jkm/ kbn  m l k nA  ll %n m l k lK *nv m or q* pU o q  r  p  o<%rg q p o*r pF 9q :%#&x#(:#/H%&src7''I~1B : ; 9 I8  !I :! ; 9!I!8  :! ; 9!I!81RBUX!Y W!I 1 4:!; 9 IB H} :!; 9 IB : ; 9 I$ > :!; 9 IB< : ; 9! : ; 9 I8 4:!; 9 IB&I!I/ IH}.?: ; 9 'I<.?:!; 9!'I@z4:!; 9 I:!;9 I'I4:!; 9 I .?:!; 9!'@z U!'"4:!; 9 I#H}$.:!; 9 '@z%.:!; 9!'I !&:!; 9 I'.?<n:!;!(% )$ > * +GI,&-  : ; 9 . : ; 9 I 8/: ; 9 I 04: ; 9 I?<1.?: ; 9 '<2.?: ;9 'I<3.?: ;9 '<4H}5H}6 74: ; 9 I8 U91RBUX Y W :: ; 9 I gSSTTUUVVWWSoSTmVTUlUVnVWkWoS1&SnSSSq#0ToTTol0SoT1&SUnSnSSSTTUUVVSlSSlTTq#8k0SmSoSoS S SSoSSoSSSoTnTTnTTnUmUUUUm0YyYSmSSmSTioTiTUllUlUnn S o S oSoSo T m T mTmTm U n U nnUn VV 0 1 2 3 4 5 6 7 8S d S ST T TU UV V V|cTfh T cenh n efm m g f$bY Y b,a PPP P a`XXX X `mZZ Z m,_SS S _ j gj j j g) gʧ;ii i gʧ;  z B#! ! ! &0- z  ! !-  ! !--  -  -  ) -!- Y-\  J<I . <<$   $   @   -4 +  -J#$#! #""   " !"   "!!" . ""$  ##z   " .#!z &z 2)#. < ?!/z # <# #" - .< ! !!! <X "" .. "" ..w  f! !!  !  !!  !  !!  !!   !! !   !!  !!  !!<. -iJ = /u!# ) ' !' g' u'y ) 'v '> ' /' '<' ' ' ' ' "&. .!  YYL.  !YYv  . <. / !4  /Y   .<gY " / K!! K!.zYq fof = p ! <. ]/K!J"  YZ /! *! .*X< wX   ?/ YO<   =///!..0K"0,! M .. 0! J u.  XX" / "=/!/!../"="/-!.! J )  X X"!1..  / K=! /J .   memprof_young_triggerhlencaml_blake2_updatebsize_32size_tc_stack_linkdependent_sizeuint64_trequested_global_major_sliceyoung_limit__uint8_tmajor_slice_epochgc_policymlsize_tbacktrace_posswept_wordscaml_local_roots_ptrcustom_operationscaml_ephe_ref_table__builtin_memsetlong long unsigned intunique_idmemprofcaml_failed_assert__int64_tlimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffsigmanextintptr_tlong long intsigned charcaml_blake2_createmark_stackhashlenrequested_major_slicecomparecaml_BLAKE2Compresslong intmajor_work_done_between_slicescaml_blake2_stringallocated_words_suspendedcaml_stat_alloccaml_minor_tablesidentifierextra_heap_resources_minorU8TO64LEdoublecurrent_stackbacktrace_slotslice_targetcustomcaml_blake2_operationscaml_heap_statecaml__roots_keybacktrace_last_exntablesintern_stateexn_handlerrequested_minor_gcallocated_wordsvaluechar_osmajor_refinside_stw_handlerlocal_rootsblockunsigned intstack_cachecaml_blake2_finalizebacktrace_activeGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intoo_next_id_localserializeslice_budgetcaml_ephe_infocaml__dummy_ctxcaml_stateminor_heap_wszintnatdatadependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatcaml__framestack_infosweeping_donecaml_custom_eltint64_tis_last_blockmemcpybsize_64__builtin_memcpycaml_stat_freec_stackcompare_extyoung_ptrcaml_blake2_finalmarking_donebasetrap_sp_offyoung_startasize_tcaml_BLAKE2Finalatomic_uintnatextern_statetrap_barrier_offcaml_BLAKE2Updateephe_infoextra_paramsfinal_infouintptr_texternal_raisedeserializeextra_params_area__uint64_tcaml_alloc_custom_memnitemscaml_BLAKE2Init__int128 unsignedyoung_endlockedthreshold_Boolmemprof_domain_sunsigned charcaml_blake2_bytesrequested_external_interruptshort intallocated_words_directgc_regs_bucketsdls_rootcaml_ephe_ref_eltcaml__roots_ctxcaml_BLAKE2_ivkeylenstat_minor_wordscaml_custom_table/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beROTR64compare_unorderedntablescaml_stat_blockfinalizestat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infostat_blocks_markedcaml_alloc_stringbuffercaml_string_lengthtrap_barrier_blockoffsetruntime/blake2.ccaml__temp_resultcaml_domain_state__int128hashamountfixed_lengthyoung_triggercaml_gc_policymemsetephe_refreservecustom_fixed_lengthparser_traceuint8_tminor_tablesshared_heapsizebacktrace_buffercaml__dummy_keyBLAKE2_sigmaBLAKE2_contextaction_pendingstat_promoted_wordsnumbytescaml__roots_blockcaml_extern_statecaml_ref_tableepheGCC: (Debian 13.2.0-18) 13.2.0zRxA TTB R % RA p4CpA~DBAPCD} CA A ABA~PAACAA~PAE AGA~EALC ADFA~VBcBG HAC FJAT4LB ABCA~CA[AADADA~OHAAA~0C AIA~c HAA @FpA~CCA0C AHA~Y GAA 0C ACCFA~VHAH T43 @ @  Wf0v}H`Lx@$6H[blake2.ccaml_BLAKE2Compresscaml_blake2_finalizeBLAKE2_sigmacaml_blake2_operationscaml_stat_freecaml_BLAKE2Initmemcpymemsetcaml_failed_assertcaml_BLAKE2Updatecaml_BLAKE2Finalcaml_blake2_createcaml_statecaml_stat_alloccaml_alloc_custom_memcaml_string_lengthcaml_blake2_updatecaml_blake2_finalcaml_alloc_stringcaml_blake2_stringcaml_blake2_bytes 2 0p   4 H v2~200  4 |    8   B2 F2( J0 N0( X p  2 2 0 0  Z X C 8 N 2 R 0 T d! | 2 28 0 08   .Z :X @C $  2 28 0 08  <! X l t$  % &3&` 30&83H&P3`& h3x& 3& 3& 3& 3& 3&P& + `&*/7=DHW %cDjq x] HZ("!-a;w@zL]i uU\   "- *8 PCN7Ydozl nY  ,c8DP ;\h ]8K4Ms= [*6 BBNIZf r~B>  *37lJT 2c9ot ~ m}    g9 'E.Req~(  D PDjmg i   fD m%g2 i? R^NDmg i  J  2' X d & m" y &  U   n      <J ^ g& ~   & " < 8 R N h d & l & / 9 =z L P _ c r v    "   < 6 & D & \ & p +& | C& d% m& X R  | r              & % / 3 9& Q& o& &8 &  &   6 2 L Hb ^& 4=& T ^~btquzI &   & @!& \6 &K& lX& x& &8&&`+'&xi& O= !%* 48=& Z2^*d& {& & `&(&& x& & &,&BG&f^jRo/y}!&$&8& @&B&l&&:&L< 6 #"3M7;=&\&|&<&P&&&0&/"&+ 59>HLZ^lNpD~|rG=uk  " Q& G5 9 H L [ _ n r    & * &&0" = ; K G &p-! a% _4&l>8L mP kY z] vg&pqC  &pN  &dY  &d     &p%o3 7 F&dPz^ b q&p{  &p  &d  &,     %&d/= 1A /P&pZh =l ;{&p I G&| U S c _&d y w&d   /&\9G K Z&dr v   &d   &d  &\  & *& * 3 7 A&dK5Y ] l&dv@  &\K  &<V % # 3 /&da  I G &\*l8 U< SK&dUwa ae _   && Z&`t`8     L .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rodata.rela.data.rel.local.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @_H& , 6 1@eH;2XJhW(@R@g(0 lhg@gX4 x,@/ k<-0@0<]>"@00L 0W WX@8Z0 ]m(callback.bd.o/ 0 0 0 644 60672 ` ELF@@|<})9y)$|1*(|Q*_(J|I*?()i,;A4si@\888`H`?(9@|hx)IxH``88|eH`xi|~x,)@_(*})*?()),)@sA8!0xa|N (,*|JixE|9*@|K```H`,A(HK `sA?(;x)8!0a|N <A9A(9!p 888 >ApxH, A9 H````U'(4}'J}*JH, @?NcOW HP?";9#xH`,AH,@?BZ}Zj*9)*{Ha { }9J(,?@HH`,?A88cxH`,@(xH`Hh``cxH`|{x8cH` 8|x8cH`{$(x}9JI((_H`Zj#xZ9JZH`,@8!8`!Aa|N ```#x?BH`ZK``; K|``<current_stack) == NULLval & 1try_lockunlock(i= :  >int[ (T        )H ,`?T   W` Z: l m@A   :$:   3_ 5#_ 6#_7 77(  H | H |  H "  #  $dB( C )Ep)F)G `T!:' H2C O.  X*NT(R*2*9 ;D{({ > ?| D E {:?E" AFAA"A%A ((+0.82@6H9AP=AXA%`C/hFpIxLPT[`rtowyv{}{     F H( 30 8FidH@ HH {P X ` h p x          H      A {8+sp0 A1 A3 :H; . < (id= 0Fpuspw xE%FOG8H p*@vv   4{c @jmpA \BvC+&G22 b$'jOkHl {855end55ptr55 53(530A78 {9 : {8< [< [end< [< [ptr< [< [ <3(<30> ? {mem@ maxA 8C C endC C ptrC C C3(C30 `   :A -: = 9 >H N N+* `` p:?7   S8! H8"$I|0  h!J!H9| $K p 5:+F $7. \Lbuf/ 5 B   {! {" {# a9|SACC     POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxEQyNEQz{|}~BEQc:#VS MpNvalq {:r:sxTO:: ,x ,y $C H!P3OH$ HJ%\\ %JsA+-.Z 3$.O%YA{ HOOQ[{{${{{I3{RG[Sg$Hz3% eOH^? H uTH&f= -G i HU< nvVT &|"& & && &&&S 3SJS!&e&p &&&S S N& 6O nv 37 &e&p &&&SST &|& &&& &s&&S 3SJS!&e&p &&&S S{ 0{&val={Wv,4HO-h|H7 nv"STS . nvSS(aSUaSX{ / &| & &&& &&&S 3SJS &e&p &&&S SzS T U v{|.{1O-h}|i{D i({ i5H iAA k "uSSTTUUc{` c({ c7{ cC{ d({ !f !!!!!`"uSST3U`!f ^{\ ^({ ^7{ ^C{ !` ""!"p"uSST2Up!` Y{T Y'{&argY6{ "6[ y"O"D"Zp"uSST1Up![ S{resS+{Jx K { K{ K${ K0{ !M !!!!!P"uSTT3UP/!w M!Dt E { E{ E${ !G ""!"`"uSTT2U`/!w G!>p ? {&arg?{ "6A "O"D"Z`"uSTT1U`/!w A!8l!w 9 { 9H 9"AY!w ; !S!"uSTTUUV0!.0.{0{!+{&{2{>{1arg!{!:0{"&+{:{F{1arg"&{"6:0{"e*{9{1arg"e{"u:Zb{x%2+{28H2DA"d'dv#d4'dH#e{@#e4~'eH3resf {"g3reqj #3ir H#'{4&0{ $^;&A&L[&W&X4'=$<'zS T U .STU14%%$&;& \&"$&#]&H'&zS T U 3zS T UFI%<S$%_T0V $ &cz%S T Ud[^XH%S T #U3V0_C&0C:D-{<"H`7{&e7C"9<"= {5&|m4\5&m?\H&m5\-rH5&.(Oerr4H1'val1!{,{' p,!6"6<'~"D"O"Zp"uSST1Up6!D'!"""p"uSST2Up6!H(a!!!!!`"uSST3U`a( I~1B : ; 9 I8 H} !II : ; 9 I 8 :!; 9!I!8 : ; 9 I 1RB UX YW  :!;9 IB $ >  : ; 9  : ; 9 I8  U:!; 9 II!I/ .?:!;9 'I@z4141B<H}: ;9 I.?: ; 9 'I< U4:!;9 IB.: ;9 'I H}( 4:!;9 IB!1RB UX!YW "4:!; 9 I#4:!; 9 I$.?: ;9 'I<%.?: ;9!'<&:!;9 IB'4:!; 9!IB(&I) :! ; 9 I*:! ;9 I+: ; 9 I ,4:!;9 I-4: ;9 I.: ;9 I/1RB X!YW! 0.?:!; 9!'I !14:!; 9! I2:!;!9 IB34:!; 9 IB41RB UX!Y W 5.:!;9!' !6.1@z7 !!: ; 9!8 :!; 9 I89>! !I: ; 9!: :!;9 I8 ;1< =% >$ > ? @GIA : ; 9 B : ; 9 C&D5IE  : ; 9 F : ; 9 I 8G4: ; 9 I?<H'I> I: ; 9 J4: ;9 I?<KI L : ; 9 I 8 M : ;9 N : ;9 I8 O!IP.?: ;9 '<Q.?: ; 9 '<R.?: ; 9 '<S.?: ; 9 '<T.?: ;9 '@zU VH}W4: ;9 IX Y1RB X YW Z.?: ; 9 'I@z[ 1U\ 1U]1RB UX Y W ^.?: ; 9 '@z_.: ; 9 ' `.: ; 9 'I a.?<n: ; .SnSn03%3%3%#03%#oo     SSSS    SS  SnSnonXxXn YY  ST      SSSS   T SSq#0TTq#8mmm00X0X001000oSkSo1XxXX YY      SSSS    SS  SSTTUUSSSTZTUYUVVVVUYUTZTSSS SS TZT UYU UYU TZT SSS S S T Y T T Y T S S S T S T U Y U V V W W W W V V U Y U T S T S T S T U Y U V V V V U Y U T S T S T S T U Y U U Y U T S T S T Y T U T U V V SPSSq#0PTnTnTnTTnTnPUkUkYkUUkUkllll0000SnSnSSnnS # $ & # $ &S # $ & # $ & # $ &0nSSkkSkkmmmmmmSSTYTSSTZTUYU S ST Z TU Y U V V,                o runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typescallback.cmlvalues.hplatform.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hcallback.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hcodefrag.hinstruct.hpthread.hstring.halloc.hinterp.hdomain.h !e/4=//=!. !&z !4'4z '4!x //"'  4+!+#.=./<. . $X(  . $ (  !)!(!-.)-"(! B.-> )"- /- 0% /1/~Y/ !/ !%/#(" [ #/% >   =. X. i. .!$<(  J  .2 W<' /~ ~ /  J. .~.f   J.~t 1 1! ! @ 2! ! ! A 3! ! ! ! K  /u   /  . Jj~< ~  ~.!    /  . J\~< ~  ~.! !    /  . J~< ~  ~.! ! !    /  . J t~.   ~.!   5!yJ  .~    ~.! !    .!tJ f.~    ~.! ! !   .!nJ X =h  .!iJ /=//=/. /YtzJ <&f,(."   /fp Y1f.g v  =K0 J/K<K /-! /! #!  !!.!=T..e  =fJ  X 6..<.i6pU +<U  +.U  +. U +./1f.gQU J&J,(."   /f& =Y0 J/8!!V.* T p  fs4!! J< .uf .J&z . . .BU . <.x'pd <d  .d  . d </1f.g`=  !> .*5&!YT.0X !.<W  .<.GETFIELD2GETFIELD3GETPUBMETcaml__roots_contc_stack_linksize_tallocated_words_resumedmark_stack__kindrestore_stack_parentdependent_sizePUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3caml_callback2_exnint32_tbacktrace_slotephe_infoCLOSUREREC__pthread_list_tmemprofencodedBRANCHIFBRANCHIFNOThandle_exnORINTpthread_mutex_unlock__next__dataBLTINTLSLINTcaml_callback_rescaml_callback_exn__prevfoundXORINTshared_heapcaml_heap_statePUSHATOM__pthread_internal_listcaml_register_named_valuecaml_stat_allocdomain_state__ownerMAKEBLOCK2MAKEBLOCK3LSRINTrequested_major_slicecaml_ref_tableGETGLOBALcontcaml_raise_stack_overflowCONSTINTepheslice_targetVal_ptris_exceptioncaml_custom_tableMAKEFLOATBLOCKcaml_ephe_infostat_promoted_wordscheck_errlong intlocal_rootsAPPTERM1APPTERM2APPTERM3trap_barrier_offlimitstat_forced_major_collectionsuintnatRAISERETURNcaml_plat_mutexcaml_intern_statestat_blocks_markedopcode_tparent_stackBRANCHPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_sPUSHOFFSETCLOSURE__nuserscompare_unorderedcaml_minor_tablesntablessigned charGETBYTESCHARtrap_sp_offDIGEST_LATERaction__pthread_mutex_sunsigned charGETVECTITEM__spins__int128 unsignedPUSHGETGLOBALFIELDbacktrace_last_exncaml_custom_eltcaml_alloc_2caml_statefinal_infocaml_named_valueREPERFORMTERMPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4PUSHACC5PUSHACC6PUSHACC7_Boolcaml_lockdepthvalueMODINThandle_valuecaml_gc_policycharcaml_ephe_ref_tableMAKEBLOCKPUSHENVACCPUSHACCADDINTcaml__roots_closureextra_paramsOFFSETCLOSURE0OFFSETCLOSURE3C_CALL3alloc_and_clear_stack_parentmajor_work_done_between_slicescaml_try_realloc_stackcaml_plat_lock_non_blocking_actualASSIGNextern_statenamelenSETFLOATFIELD__jmp_buf_tagGTINTyoung_startcaml_result_privateAPPTERMstrcmpcaml__roots_vnamecaml_init_callbacksPUSHGETGLOBALcaml_plat_unlocksweeping_donevnametablesreservePUSHpthread_mutex_trylocknamed_valuecaml_exception_contextPTHREAD_MUTEX_ERRORCHECK__lockcaml_raiseCONST0CONST1CONST2CONST3caml_bytecode_interpreterBULTINTATOM0oo_next_id_localminor_heap_wszclosureRESUMETERMdigest_statuslong unsigned intPUSH_RETADDRBNEQcaml_named_actiondependent_allocatedMAKEBLOCK1slice_budgetexn_bucketAPPLY1APPLY2APPLY3arg1arg2arg3longjmp_bufferhash_value_nameATOM__mask_was_saveduintptr_t__sizeGETSTRINGCHARyoung_endcaml_iterate_named_valuesexternal_raiseargsc_stacksigjmp_bufcaml_callbackN_exnBLEINTgc_regsRESUMEFIRST_UNIMPLEMENTED_OPGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecode_ttrap_barrier_blockCLOSURESETVECTITEMextra_heap_resourcesENVACC1stack_handlerdoublestackhandlercaml_register_code_fragmentparentencoded_value_or_raiseOFFSETREFcaml_extern_stateLTINTSTOPswept_wordsthresholdcaml__temp_resultunsigned intcaml__roots_blockDIGEST_IGNOREDIGEST_NOWpthread_mutex_tintptr_tAPPLYgc_regs_bucketsISINTGETGLOBALFIELDcaml__dummy_contRAISE_NOTRACErequested_external_interruptResult_encodedUGEINTBOOLNOTcaml_register_generational_global_rootBUGEINTcurrent_ramp_up_allocated_words_diffoffset__saved_maskblockGRAB__jmpbufACC0ACC1ACC2ACC3ACC4ACC5ACC6ACC7caml__frameOFFSETINT__count__jmp_bufcaml_plat_lock_non_blockingnitemsRESTARTallocated_wordsnamed_value_tablePUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4nextcallback_codeyoung_limitlong doublePUSHATOM0SETFIELD0SETFIELD1SETFIELD2SETFIELD3caml_plat_try_lockSUBINTRERAISEunique_idOFFSETCLOSUREM3allocated_words_directaction_pendingbacktrace_posPTHREAD_MUTEX_RECURSIVE_NPsizebacktrace_bufferlong long unsigned intcustomcaml_callbackN_res__listcaml_callbackcaml_stat_blockULTINT__builtin_memcpyhandle_effectcaml__dummy_closureSETFIELDcaml_resultallocated_words_suspendedGETMETHODephe_refinside_stw_handlerGEINTANDINTcaml_modify_generational_global_rootSWITCHSETBYTESCHARcaml_failed_assertPOPTRAPGETFIELDSETGLOBALchar_osPUSHCONSTINT__int128__aligncaml_callback2caml_callback3backtrace_activeDIVINTstat_major_wordsmemprof_young_triggercaml_callbackNPtr_valrequested_minor_gcyoung_triggergc_policynamed_value_lockPTHREAD_MUTEX_ERRORCHECK_NPnamePTHREAD_MUTEX_NORMALPTHREAD_MUTEX_ADAPTIVE_NPcurrent_stackatomic_uintnatshort intPUSHTRAPrequested_global_major_sliceinstructionsEVENTASRINTcache_bucketVECTLENGTHBREAKBGTINT__elisionextra_params_areatag_tENVACC2ENVACC3ENVACC4PTHREAD_MUTEX_DEFAULT__valexn_handlerCHECK_SIGNALSstrlen__int64_textra_heap_resources_minorPUSHOFFSETCLOSUREM3caml_callback3_rescaml_callback3_exnmemcpyyoung_ptrcaml_local_roots_ptrC_CALL1C_CALL2asize_tC_CALL4C_CALL5dls_rootmlsize_tstack_infocaml_callback2_resruntime/callback.cstat_minor_wordsC_CALLNlockedDIGEST_PROVIDEDENVACCshort unsigned intmagicexception_ptrbasemajor_refMULINTNEGINTintern_statePUSHOFFSETCLOSURE0BGEINTPUSHOFFSETCLOSURE3/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatPERFORMLEINTcaml_update_young_limit_after_c_callcaml__dummy_vnamecaml_domain_statestack_cachenargcaml_plat_fatal_errorminor_tablescaml_ephe_ref_elt__sigset_tdataGETDYNMETprevOFFSETCLOSUREPTHREAD_MUTEX_RECURSIVEmajor_slice_epochGETFLOATFIELDGETFIELD0GETFIELD1GCC: (Debian 13.2.0-18) 13.2.0zRxA HIpA~CBA@8xC ADFA~z HAA ^ GAA |<EA~DBADFA~EBAHFA~FBA$lC AFA~JDA$pC AEA~LDA$,tC AEA~MDA$TxC AEA~NDA |TEA~G BAA \FA~H BAA `FA~I BAA DCpA~E BAA 8C AJA~q JAD 4DC AIA~J GAC 0|HC AIA~m GAA  (+(h   =HQmx0<-HD@`HSxlfpxtxT\` D8#*OVfmPhHcallback.ccallback_codenamed_value_locknamed_value_tablecaml_init_callbackscaml_register_code_fragmentcaml_callbackN_exncaml_statecaml_alloc_2caml_update_young_limit_after_c_callcaml_bytecode_interpretercaml_try_realloc_stackcaml_failed_assertcaml_raise_stack_overflowcaml_callback_exncaml_callback2_exncaml_callback3_exncaml_callbackN_rescaml_callback_rescaml_callback2_rescaml_callback3_rescaml_callbackcaml_raisecaml_callback2caml_callback3caml_callbackNcaml_register_named_valuepthread_mutex_trylockcaml_lockdepthstrcmpcaml_modify_generational_global_rootstrlencaml_stat_allocmemcpycaml_register_generational_global_rootpthread_mutex_unlockcaml_plat_lock_non_blocking_actualcaml_plat_fatal_errorcaml_named_valuecaml_iterate_named_values2 200$ ^ZjXtCj2r0    *20.2H600:0H< R2V2`^0b0`d r2v2~00 202000   4   H  @  %  8% x %  % ZX$C20* +Z+X+C D, \- t. / 0 1 +C 2 6+Z 83 B+X b2 f2 n0 r0 t 2 0 4 2 0 4 2 0 * +Z +X +C , +C 2 2 0 4 +C 2 F+Z H3 V+X X+C z2 ~0 4 2 0 * +Z +X +C V+Z ^+X `+C p2 3 2 0 4 2 0 4 &3&P 30&83H&P3`&`h3x&3& 3&3&3&3&3&P3 &(38&@3P& X3h& p3   &*/<=DhWcj q x \[5AL  \Tv%38ERXeq~ 2 'f_ f6" 4BGLSdp|   {+9>G Uqc q  [  oZdC   z'5=CQ_)m{\0UEn =?f!@-9 EKQ]iuz1tXuA   )5*G`m z{/ B +[5 B OT\ `i|  ] X(5BP[]w R J   4R A N a n    R   -   . T : q |  K     $  %        Q  6 C ' b o |2 -  5               S \ e n w    $ 0 6 < B H Na T Z ` f l r x ~     1 & / 8   g    J 7 F  f    j f     O  F  & , 2 8( >3 D J] Pg V \ b hO n t z  O     h    &   p e  ~ ,   U  B &"(.4:@ FLR1X^mdjp=v|m> oc  ( S ~f  iG   u#8) // m5[; A}GEM d p&y   &(&C4Kb xt:9%-Ji\yd{  &    { @ 4& - 1 6& @L& U-f j s& |Q  Q  & p / + B >& && & '& T0< g@ cI& xRc g p t y& && x4&      &    $- *1 "<& EV OZ Mc& l} d ` u s& & & k  &     (& 1B F O  S X& i&t& & P&  / -& " B @ L J& && '2&IT cX ]h l }q~   @        ? A ?& L#& d8JAL MP I_ `c \h& |& & & &   q o&l   z % ) 4&=N R [&d)u y ~) , (&4 ? ; R N& &&& @& U) w- s6& ?`P T ] a f& w&& & |&& 6 &u$ ( -8 < A L P Y&bs w |&&M&Pu     8 2  W Q  " t p$&\-> B K O X \ e i n{&|&|  &>&u      # 5' /0&9J TN NW s[ md h mz&&  &@&u    &$5 9 B F KX&~&  & <z&u &    E ?  b$ ^) "4 x8 tA&J[ _ h l u y   &D&D&D   & u    *  #.  3 >  @B  <K&Te  Vi  Rr  nv  h    &&&    t& u     '  +  4&, = N  R  [   _  d q&L &L &L  .  ,  & u  <  6 !  [!  U!  !  x!  t!$&!-&!J  !N  !T&!x Z!!!u! ! ! "!!u" " "7"Eu"P "v "&P"u"  "  ""  "  " "  8"  """ "  "  "";#  #  # t##) #2  #6  #E  #I  #N#c  J#g  <#l #}  #  ## #  #  #&###  #  #,#  #  #&#7$  $  $ &D$&H$+&0$=&$c&L$lB${  $  $a$  $  $&$q$  0$  ,$&$&$&0$&l%&`%&%%&%=&$%`&%m&%&%&%&%R%&%&,%&%&&m& &t&$&1]&B&M&Yt&ft&} D&&&&''%&'@  C'D  ?'M  ['Q  U'^&'&'  x'  t'  '  '  '  '&8'&`(  (  (  (  (# ('  (0  (4 (A&(b(fQ& f&({&(&(&&&&&I&Y&n&~&&&V&|&&&&&&&#&6&S&&&&&&Y&i&~&&&& &~&<P` 0XP H  .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @~ (&(,0601@0;2Og(mJ@0Tx[8)n>2i@x M/0~@ 0 M_O @P0]q0r s @hu( z codefrag.bd.o/ 0 0 0 644 23456 ` ELFU`@@|?;x!H`8 H`8!|N |a|3x|}x|+x8`P|#x!aH`(|xA(A=B9J} P(9 }Q-@??8(;H`xxxH`x8~ H`8!a|N `[;C# Kh```|Px8c;H`K@``||x?;x!H`8~ H`,@8!|N 8`H`9>@9^@| P@L,C|}@H|*8@ |`I@L,|&T@,,A8!|N ``,H@K`||dx|x|)@AX>|)@@,8!x|N ```8!;x|N <code_start <= pclockunlock #.$int]%ww H~35#6# 7(J]A]A  ]" V# V$&(C uEFuG iwH' HJ ZH m' O(A) Nw h*!]+A eP ! " r # r $] %: & )!(.H $ %n &n ' (s( -nkey .  /  0  1 p 2s  3x(ns,H :pcf!e ".  $  &  (d q<<! SS U ee @ ]C]-]] < ]e. e] E ]=e Q ]Xe K ]xej< +ppp. Z 7 eW!a W  0#/   *S(ASAS* W 0 SBSSS l11enn]!tmpln<cfdqvSs5 cfC C !  . S S | !  S SSv` Lv:] w pS # TSUph pch;rcfi2keyj h j`  S TUhV`S T UoS cfS6T! bW b cW c = S = S S@3N  4cfN;/]( 3/'rend/4r04:10cf2  SP x S( X STU X S USTU*P |  gSS " m4<" m;<56(err4]I~I : ; 9 I8  !I$ > H}4:!; 9 IB( 4:!; 9 I H} : ; 9 I .?: ; 9 'I< 1B : ; 9 .?: ; 9 '<4:!; 9 IB.?:!; 9 'I@z:!; 9 IBGI:!; 9 IB&I :!; 9 II.?:!; 9!'@z  U:!;9 I!I/  : ; 9 I8!.?:!;9! 'I<  1RB UX!Y W!!1RB UX!YW!".:!;9!' !#% $$ > % & : ; 9 '&(> I: ; 9 ): ;9 I*4: ;9 I?<+> I: ; 9 ,!I-.?: ;9 '<..?: ;9 '</1RB X Y W 04: ; 9 I 1 U24: ; 9 I3.: ; 9 ' 4: ; 9 I5.: ;9 ' 6: ;9 I o n o o o m S m S m S o Z o o o o y1 Y ( z( Y n S SSnS nkS k kl lS S  l(S#( lS S  STSSToSoSonSnSoSoSoSZSPxSxmSmPTlTlPUnnU2PVkVkSoSo,             8j runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/includecodefrag.cplatform.hthread-shared-types.hstddef.hstruct_mutex.hpthreadtypes.hstdint.hconfig.hmisc.hcodefrag.hlf_skiplist.hmemory.hstring.hpthread.hmd5.hstdatomic.h )/;//=<<<=2!"<!.J"!/YZJ .s/:f:M:91AJ .Jv./? 0J!.XJ1JG  ?k?@?$ ?2J0!=@J X !J)C C0 C0</ $ V"Gh Gr< G}< G}<p.. }  }. <} "%(!!T.}... .v<$?  K} /}< ..<.=}t=/=-!X. J    J    <    .  . X.  !<N191/> X g# "  =<>z J=!.short int__sizememory_order_releasecaml_plat_lock_blockingsize_tuintptr_t__prev__aligncode_start__atomic_compare_exchange_tmpcaml_digest_of_code_fragmentcaml_md5_blockfragnumcode_fragments_by_numlong long unsigned intcaml_failed_assert__nextnextpthread_mutex_lockcheck_errsigned charcaml_plat_mutex__atomic_store_tmplong intsearch_leveltop_levelcaml_stat_alloccaml_lockdepthlong long intdouble__pthread_list_tDIGEST_IGNOREgarbage_next__pthread_mutex_sactioncode_fragment_garbageopt_digestcaml__nextmemory_order_seq_cstchar_osunsigned int__int128caml_init_codefraglong unsigned int__kind__dataGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesdata__elisionshort unsigned intuintnatdigest__atomic_load_ptrcaml_register_code_fragmentcaml_stat_freememory_order_relaxedforward__owner__countasize_ttailcaml_find_code_fragment_by_pcDIGEST_PROVIDEDlong doubledigest_statusmemory_order_acquirecaml_code_fragment_cleanup_from_stw_singlecaml_plat_unlockruntime/codefrag.ccaml_remove_code_fragmentlf_skipcellDIGEST_NOW__pthread_internal_listcaml_plat_mutex_initdigest_kindmemory_order_acq_rel__int128 unsignedcaml_find_code_fragment_by_digest_Boolunsigned charcurrcaml_plat_mutex_freecf_cell__atomic_store_ptrcaml_lf_skiplist_find_belowcaml_lf_skiplist_remove__atomic_compare_exchange_ptrcode_fragments_counterhead/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bememory_order_consume__lockcaml_stat_blockcaml_lf_skiplist_insertmutexcharcaml_lf_skiplist_find__atomic_load_tmplf_skiplistmemcmpmemcpypthread_mutex_tcode_fragmentcaml__marked__spinsstat_blockgarbage_headcaml_find_code_fragment_by_num__nuserscaml_lf_skiplist_initcode_fragments_by_pccaml_lf_skiplist_free_garbagecaml_plat_fatal_errorDIGEST_LATER__liststartpthread_mutex_unlockcaml_free_code_fragmentcode_endGCC: (Debian 13.2.0-18) 13.2.0zRxA $PB AEA~FCA4@(C ACGA~b GAB 4xC AFA~J DAA Y DAC 4D AEA~N EAD A FAA $`FA~G BAA ACA0C AHA~X HAA 8DEJ AABA~] ADAD BAAAD,B AEA~MARADDA # 8 N@   [Pn(0H<Xk``x ,Wucodefrag.ccode_fragments_countercode_fragments_by_pccode_fragments_by_numgarbage_headcaml_init_codefragcaml_lf_skiplist_initcaml_register_code_fragmentcaml_stat_alloccaml_plat_mutex_initcaml_lf_skiplist_insertcaml_md5_blockcaml_remove_code_fragmentcaml_lf_skiplist_removecaml_find_code_fragment_by_pccaml_lf_skiplist_find_belowcaml_failed_assertcaml_find_code_fragment_by_numcaml_lf_skiplist_findcaml_digest_of_code_fragmentpthread_mutex_lockcaml_lockdepthpthread_mutex_unlockcaml_plat_fatal_errorcaml_find_code_fragment_by_digestcaml_code_fragment_cleanup_from_stw_singlecaml_lf_skiplist_free_garbagecaml_plat_mutex_freecaml_stat_free 20 (  2020   ` 20   20 "2&2.0204 Z2 ^0 l! # $Z$X$C$C(% p 2808& 2000& 2@2@"2&@X" 20) ) 2@@@P* \+ h+ 2@@@&3&P 30&83H&P3`&Ph3x&3&3&3  ~I&*1=D5K^R$YlSz_>O* p#0 =Tw_ jVE*v -"0.;MxSY_fs^2Y\v-:iGTaB1&@/& & "&+(BgTDkbdX>tYAys &#   #&89D&@NzX *\ (b&@w 4 2&L&L > <&X&d&pE&@@+&C&]g&~2 P Fa  z     v  &09   z  "&P< @ M Q V&\w&  2 8 0& Y U&6 l  h   { & $&0 /& H& QA _  c  l&0 uV     & &8 &0 &x  &P      "&t 3& M W& w 1 { # o i  & & &< & & \ & 4  8  == G  K  P& e9 q&@ {z     &@ i   & & &  K )&P @ J  N  ]  a  f p 6 t , y e ]   & & & & &h 4K 9& P&$ h&0 }8 &  &0&0&8&8 &y&&PDP|PH.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@3&,H61@8;2?O J@:0[Uni@S` 0~@Sh0 ~<@S00"0* *@S,P  0pTcompare.bd.o/ 0 0 0 644 40424 ` ELFh@@|<|x88`!H`|#@AH`9 ?H```}&|Aa|+x|~x|#x!.%!;Ap9!pA(WxAp!x; AsAs@4?, A0, @H? 0,8A8?j<,)A9@xxI8x})XN!A(8?||xj?,)A),)A ,;A,@,ap|7@AP79Iy)$|*08*@*W@:;9,@H`,A="j>,)A9A898I8;Aj9AxAp }'Py)!H`?,)ADvA,I@AIK,```>y){|)@@,)Ay)$/})x}>HPP9)y)9)})H,`AAA$A `A(9JB@h }T`@```ap;|:A H`8!px!Aa|} } N ``@s@sA>, At, @> 0,8A?j<,)A9@xxI8x})XN!A(8?||xj?,)@8<U*>W>| @@A( A(A( A(A U)>W>HP```apK``{{|8@@P,8A(8A0!x|7H@@p{ 9@9): W7``K``K``9) U*>( At=BJy)}*J})R})N TDtDd$D``( U)>;@apX|:AH`9 !p})tt|)AHPK>_  |8@@,8Ap?j<,)A9@xxI8x})XN!A(?||xj?,)@8 K```ɟ`AAHA,;AA4 `@K```AxH`|xxxH`x}@||x@|exxxH`,A(@AhapPK9< q)AxW>9 HPKhapX|:AH`9 !pKiH`||apvW;K 8`H`|}yA8DxH`;KPCxHapX|:AH`9 !pxH`ap|:AH`pK ```|8!H,#A 8`A8`8!p|N 8`K`|8!H,#A8!p8`|N 8!p8`|N |8!H,#@8!p8`|N 8!p8`|N |8!H= 9@a)yJ@y)8!pe)|cRa)|cH|c|xc8cN |8!H9 8!py)@|cJ|cxc|xc8cN `|8!H,#A8!p8`|N 8!p8`|N |8!H8!p|cvxc8c|N Stack overflow in structural comparison runtime/compare.cCaml_state_opt != NULLcompare: abstract valuecompare: functional valuecompare: continuation value: :  ;int[ #T      ,`<= :: > W`Z: l m? O.@u_  X&NT#r&2&9;A<>?u :?B " K f K K "K %K  (U( +0 .8 2_@ 6dH 9KP =KX A` Ch Fp Ix L P T [ ` r t w y { }     f H( 08Cid H@HHPX`hpx!+HdnKPZU E Fj G 8 H pi@   3 &@djmpAeBC0i' &D 22sb$jkHl   #@eO p    # ($ 0%%83pe(Hu(3('*`:?4- $! H$"E>:'F-4.eFbuf/>K8 5 5end 5 5ptr 5 5  5 ( 5 0K 7  8  9  : 8 < s < send < s < sptr < s < s  < ( < 0 >  ? mem @ max A 8 C  C end C  C ptr C  C   C ( C 0 x  :K C:  v1v2!%-# CG" # $$ $%  C : CHS  '5[ 6i If7 !HOJ ' < ' + \.a ' r 61H H OO5d O@ H .Kp 7e O H~z< | v1z( v2z2res| SSTTU0tP v1t' v2t1resv SSTTU0nL t v1n% v2n/resp SSTTU0h` v1h$ v2h.resj SSTTU0bPl v1b$ v2b.resd SSTTU0\P v1\! v2\+res^ SSTTU0QLd v1Q# v2Q-resS SSTTU1;stk4;v1$v2.)6Hsp t1 t2  HL9= resH !resH J  res Hdd1d2sz1sz2id1d2  *res H*sz1%*sz2&- G GHH 8cstkc7;spd< f g K h . k k MX DG+v1X!+v2X+NX3HOstkZ |Pres[ ,d^     u-Q@@.ST S T U/97  A  S T .ST !S T U  }/dHit0l }1,l }!1x!"7 } A  .ST S T U9l% }1"l& }!!RG,& d X-o{ !gT \S STU  S"7  A /J@&OY/!T&2> ~S S ST"7  A  S  $S  S %%!% ~2,"@I V J-2amy0%~2 S S T Um0n[ ,7o A SN p _ S S T U H rT7_ A = stk=,;sp=M ?  @  A U4X7+stk4D;077 A  )S4T  8+Nstk+6;l)G+val8    ftH)tEVI~ : ; 9 I8 41B !I : ; 9 I 8  :! ; 9!I!8I: ; 9 I 1B $ >  H} 4: ; 9 I :!;9 IB4:!; 9 I : ; 9! : ; 9 I8 H}H}<: ; 9 I4:!;9 I   1U.?:!;9!'I@z4:!;9! IB!I/ ( I.?: ; 9 'I<.: ; 9 'I  1! 1U"1RBUX!YW #&I$ : ; 9 I8%41&:! ;9 I': ; 9 I ('I): ; 9 I*4:!;9 I+:!; 9 IB,1RBUX!Y W - U.H}/ 101RBX!Y W 1 12413'4 !!: ; 9!5.?:!; 9!'<6.?:!; 9 'I<7.?:! ;9 '<8.:!; 9! ' !91RBX!YW :% ;$ > < = : ; 9 >&?GI@> I: ; 9 A5IB  : ; 9 C : ; 9 I 8D4: ; 9 I?<EI F : ; 9 I 8 G : ; 9 H.?: ; 9 '<I.?: ; 9 '<JK.?: ;9 'I<L : ;9 M.: ; 9 'I@zN: ; 9 IBO4: ; 9 IP4: ; 9 IBQ 1R1RBUX YW S1RBX Y W T1RBUX Y W U.: ; 9 '@zV.?<n: ; SSTTSSSTTSSSSTTS ss SSTTS sSSTTSSSSTTSSSSTTSS `S `T `UkUklSkk T S gjj g g   ggg Z Z ZZX X X X  X  X XXXX   `lhh l hhhhjYlxYxl0  ,,jlhh Y l hhh lll x h x l g `gjjZ   Sm~Sm j   , S h S lSjgggjjjWw3%YjljSXo(Do, x|x|             runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includecompare.cmlvalues.hfail.hstddef.htypes.hstdint-intn.h__sigset_t.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.hcustom.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hsignals.hstring.hstdatomic.h 4/!-// t  //. !t4fL 4tL  1!0  S !$$ /  /  1 ] 0 /J+.!+- !g  !<. +< / . 0  # !!  #! !! ' ) ~< .1! !<.~<  ~J" . ~  ~  %  ~ !  " # / / ! !.! x,"  ! J +L  2  !+K 3 !  /B z.&  ! ! " /.(w  / ! !X ~  L//1 ,! .  / ] 0 /J+.!+- !g  !<. fJ ! ! !   . / / /0#  'J ~' < +    !+  "  /  0  /  /! ! !)$ !   =  !<$'; C. T !- ~  . ~//. O! ! ! .'   ." "   3  2 <'.!'- ! g ! <t A ! !  /  !  ! 1 /f j  !< ! /- !.. 0  /  !  ~$    =#.'. ~ . ~//. xJ ~  //.  ftX$~.  x.t. `!    A .  A . t.~!.~!'! !/L0! ! t.t. NL  ~ J~=/J . g. //.<  ~  //!/!0   !# E `!/! / !< !i!/! / !< !i!/! Y .!  ! ![!/! ! /  ! !i!/! / !< !i!/! - !caml_lessthanatomic_uintnatexn_handlermemory_order_releasecaml_raise_out_of_memorystrcmp__jmp_bufbsize_32size_tnextc_stack_linkdependent_sizetag_tcaml_stat_resize_noexcyoung_limitmajor_slice_epochgc_policymlsize_tcompare_resize_stackbacktrace_posswept_wordsdomain_statecustom_operationsheader_tlong long unsigned intstack_cacheunique_idmemprofcaml_failed_assert__int64_tsigjmp_buflimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffcaml_get_value_or_raiseintptr_tcaml_notequallong long intsigned char__jmp_buf_tagmark_stackroot_v1root_v2requested_major_sliceroots_lengthint64_tcompare_free_stacklong intmajor_work_done_between_slicesallocated_words_directallocated_words_suspendedcaml_do_pending_actions_resmemcpycaml_minor_tablesidentifierextra_heap_resources_minordoublepoll_timeris_exceptiontotalcurrent_stackbacktrace_slotslice_targetcaml_raisecustomoo_next_id_localbacktrace_last_exncaml_lessequalcompare_stacknext_itemtablesintern_staterequested_minor_gcallocated_wordsmemory_order_seq_cstvaluechar_osmajor_refinside_stw_handlerlocal_rootsblockunsigned intcaml_gc_message__int128backtrace_active__valGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intserializeslice_budgetcaml_ephe_info__sigset_tcaml_stateminor_heap_wszintnatdatadependent_allocatedshort unsigned intstat_major_wordscaml_heap_stateallocated_words_resumeduintnatmemprof_young_triggerlastsweeping_donecaml_custom_eltHd_val__atomic_load_ptr__builtin_memcpycaml_stat_freeinit_stackc_stackmemory_order_relaxedcaml_stat_alloc_noexcyoung_ptrmarking_donebasetrap_sp_offyoung_startasize_t__mask_was_savedstack_inforoots_startextern_staterequested_global_major_slicememory_order_acquiretrap_barrier_offoid1oid2comparecaml_ephe_ref_tableephe_infoexn_bucketextra_paramsfinal_infouintptr_texternal_raisedeserializeextra_params_areamemory_order_acq_relcaml_invalid_argument__int128 unsignedyoung_endlockedthreshold_Boolmemprof_domain_sunsigned chardo_compare_valmemory_order_consumeshort intgc_regs_bucketsdls_rootcaml_ephe_ref_eltcaml_greaterequalcompare_stack_overflownitemsruntime/compare.cstat_minor_wordscaml_custom_table/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_comparenewstackcompare_unorderedntablescaml_stat_blockfinalizestat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infostat_blocks_markedcaml_resultcaml_string_lengthcaml_equalmemcmptrap_barrier_blockoffsetfixed_length__jmpbufcaml_domain_statecaml_check_pending_actionshash__atomic_load_tmpcaml__roots_blockcaml_greaterthansp_offset__saved_maskyoung_triggercaml_gc_policyephe_refreservecustom_fixed_lengthcompare_extparser_tracelen1len2requested_external_interruptcaml_result_is_exceptioncompare_valminor_tablesshared_heapsizecompare_itemnewsizebacktrace_bufferrun_pending_actionscaml_result_privatebsize_64stackaction_pendingstat_promoted_wordsresultcaml_extern_statecaml_ref_tableephelongjmp_bufferGCC: (Debian 13.2.0-18) 13.2.0zRxA XC AEA~d8 DF A DGFA~ LABFC J]JI D nS^MBILDpA~G BAA $PDpA~D CAA ACA$PDpA~D CAA ACA`DpA~GGA0LDpA~CFA$PPDpA~D CAA ACAx<DpA~BEA X" D   .>Mfq &10L>HPI`PWx`eLtP<compare.ccompare_stack_overflowcompare_valcaml_gc_messagecaml_stat_freecaml_raise_out_of_memorycaml_statecaml_check_pending_actionscaml_do_pending_actions_rescaml_failed_assertcaml_invalid_argumentcaml_string_lengthmemcmpcaml_stat_resize_noexcstrcmpcaml_stat_alloc_noexcmemcpycaml_raisecaml_comparecaml_equalcaml_notequalcaml_lessthancaml_lessequalcaml_greaterthancaml_greaterequal 20  4 D ZXCBZJXLC ZXCCP @ ZXCZXC*20.2H20060H8 B2F@ 2x0x ZXCRZZX\C   L ^2b0d x 2`0` 202H000H 202H000H .2022H:00>0H@  202H000H 202H000H   8 L ` t!      `      `   &3&` 30& 83H& P3`& Ph3x& 3& 3& P3& 3&\    L&*/q=RDW cj!qx/>  !;AGaM)SY9bigsT =N5 'N5 /C{Q_ Qm{U % I>)# 1?My[iw  dD  } +a7CO;[gsn7  ) `  =fv 'k3#?Q [}jv\ LI x  { - V {' 1JyWjot  P .h ]h B#0  $ 1d>K qX ^;  "?L k w_  U  X   2_ L Y f U yL   :  _    U  #< ( D h u    K     >  " = ] s ~W &  z  \ s  & ,  0  ? & C " R : V 8 [& }  & P F B \ X r n & d  & $  (  7  ;  J  N  S&  u &       &  & P 0 ,/ F3 BB \F XK& dm ow&  o k    &  &   ' + : > C& eu]9' 3 xT\! -A b tn+zz  &`    u   & "(&2 A 9E 5N LR H[ a_ ]h xl rq z ~       &x)  P    &<&#&H0&0EeR V _ c l& |v& | $ "& &@&H&0&P&H&H&0"& 4&M .Q ,Z 8^ 6g&q&& B @ N L& X V d b& n l'0 {4 w= A M&lWg k p&    &&&H&0    ' + 4 8 A&K&l&   "  & , * 8 6 D @&X W U c _$- v1 r: > G K P&h& (& @& P&7  &&   ! +&D H Q  U ^ b g&&&&DB & $&T&&x&l&%&6&`EMd]{&8w 4 . P Jw h f t p&X&&H &05&|?&|`& Xjy } & h& p& p  & |&&H&0&&8$0 4 9&HHp |  &  &(&(  &<&( &*&L8O` tm\c   tu &&<`   P 4 T P| .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @YP& , 12 E @@aO J@cY T@c1 e*6s/60@h068 @0E| 0R, RL@S Wcustom.bd.o/ 0 0 0 644 35448 ` ELF@@|!|;x}&Aa|3x|{x?|+x|#xA;9 >{9Ap8!!8(#!x9!!p^!A=")|)@@tH`Dx|ixx!iH`aH`>8!!Aa|} N `H`.=ac;,)Aj<,)A`?_|)P@A@8pH`?9I_I@a>8!!Aa|} N ```< ? mem@ maxA  8C C endC C ptrC C  C(C0 | :7 G:(| r    ; , ,!  { ops|$ }# : ' 2    H 3OO Z + I, j..H_ | |  /  (  $  ) , 8 < e .O .Hv-T =0 fnC}ops l' +  + ! >  ) 3"> .C  N"Z .[  f 3S@ 3S@ &EO l' +  +  T- opsB ?T ) 3"> [ C N"Z [ f 3S@ S T U S T U@ sA7ops> /l# # BZ** 0  q opsqI bszr0 mems1vu  v .!u `11  + S T Uc=STUV0 IST3%U3%V2g opsgE bszh, memi- maxj- l  m !m#1  + S T UcC=SSTTUUVVWVD=SSTTUUE`80d8dF> ops>A bsz?( mem@)&A)&B) D E EFF~ FHG\ J8 Jy ]!sO| H jS S T U  CST   S T UE ST S T UO# n2 0 n 0   S T U/^ItblA |vLmem2max@/elt I~ : ; 9 I8  !I : ; 9 I 8  :! ; 9!I!8I: ; 9 I$ >  41B 4:!; 9 IB :!; 9 IB (  : ; 9!H} : ; 9 I8 <4:!; 9 IH}1B4: ; 9 I?<4:!; 9 I.?: ; 9 'I<H}!I/ .?:!; 9 'I@z: ; 9 I&II.?: ; 9 '<4:!; 9 IB U U!1RB UX!Y W " 1#:! ;9 I$: ; 9 I %'I&:!; 9 IB'GI(>! !I: ; 9 )'* !!: ; 9!+ :!; 9 I8,4:!; 9!I?-.?:!; 9 '@z.41/4: ; 9 I0 1 1U2% 3$ > 4 5 : ; 9 65I7  : ; 9 8 : ; 9 I 89I : : ; 9 I 8 ;4G: ; 9 <.?: ;9 '<=H}>1?1RB X Y W @.: ; 9 ' A: ; 9 IB CH}DH}E.: ; 9 'I F.: ; 9 'I@zG H41I.: ; 9 ' QSnSSnSSoSYYoSSYYS S m S m S S o o o o o S o S S o o S  S Y  Y  S S m S S m T l T T l U o U U o S n S T 3% U#3%  WSSSoSSSoTTTnTTTnUUUmUUUmVVVVVPVVVVVPVVW Z`S`kSkSSk`T`dodpypTToT`U`mUmUUm`V`jVjVVj`W`hWhWWhS T#3%#S T#3%# T#3%# T#3%#liii00   YYqqjjmmll Z,                runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typescustom.cminor_gc.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblmemory.hfail.halloc.hcustom.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.hmemprof.hstring.hshared_heap.h >00 .%!* " %Z!..0" !!/>  < . mJ.  !!>.'. 2    /! > /! !  G    < . gt   J X JJp r<t7. u .u< .  . =2" .202,020,tXHC2@     @Cp 2200  B2F2N0R0T f20j2Hr00v0Hx ZXC 2@2200 t ZXC2@ 220 0 ZZbXhC2@  220"0$ p" 2@2022`00` 22x0"0x$ R2V@$ &2*@" 20" 2@2@F2J@T! Z2^@`! f2j@l! v2 z@ ! &3& 30&083H&@P3`&@h3x&@3&3&@3&&&'&(& )&   !&*/x=VDW cj.q x 7< V$cy"JZ39 N?EIKQ3Z _kN| ?H WHN! */=%K =Y egu `  lE# +9GLUncVq #    |#/;[GS_krw , L  2nB +a=|GV>bdo N|l   8   g 6CVV &` m~ ko 48P0 h  - 1  `eR v$ CP o y{=  c v   8 = 6 P ]  j c }S   =      c  ' , T Zk ` fb l |-&   ,&  +&  m    = &  & ^ 4. J k     V a  E 6  4 :&@ Q&X ^&d k&p x&  &   O I  g e   &  q  o & # 2 } 6 y A& K T  X  a  e  n& &   & &   & &  c&@- 7 ; @M Q V_k&u    &&@ *  &l&l U Q i g | z # ,&|E I R V `&y }   &x&&`&&,&x&  p4 DO \ gt~&@     4 * a [ } w&@f  ( , 2&,C&P&a&& &0      i Y  ! + / 4 > *B $K&T<c[p Et C} X V&&&&x& !, > EI&j nn `}      5 '  x jw  #* 3 ) `~  ^ Z!&6@ uD oI S W ] f p t ~&X&        # &&x&&H&0&&&D&Q&(^&s&&& &\&& &1  : 8 ) M- K3&@&Q&^&tp&&&,&L,&|+&+&+&A-& &&&@x0@@@@@.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@L` &,12E @@UO P(J@WpxY xT@W( e!0Gx%wUs@ ,0@0,-@006 0C C@EP J^debugger.bd.o/ 0 0 0 644 80472 ` ELF3X@@?|}x!qj?,)AI(*,>Ax;H`````);),)@|=Ax@;|=AL>,>@|<, ]@$;KKxi8U!qH`~{ H`xH`|~yA?,?Adx?;H```,?A<x>|) @A>|) @@xH`,?@x8!|N `<( GAxc}>}>J})N  @0@P<@0 j=,)A (;<),)A 8```)8),)@x H`| Px"H`<|)@@}H`|zyAlH`=|HPx H````H`KH`|zxH`|yxCH`|zyA ;8pxWDxH`,@|ʪxDxH`Cx8H`KP```H`H`|zxH`,@H`H`9 =B*HKjH`8|zx,9A CxH,#A #09;jH`9|zx,)A dZIK```H`H||xH`<x}$HPKT88xH`(#@ xHKH`H`=\})t9)I{Z$]|*@At ,8A X;ZzH`|yy@l<`x H`<`x H`K`H`88p9#y)$}=H*!pH`H`KTH`="iK<``88H`(#@!x H`H`K```H`=BJ88pxi$J})P*!pH`K`88H`(#@h!H`9|zx, A{Z$8H`}:*88p!pH`KTH`]88pxi$KX```88pH`(#@!pyH`|zyAxH`9|HPx H`H`KH`|zxH`|yxCH`|zyA;8pxWDxH`,@|ʪxDxH`Cx8H`K```[j?:,)AT)(#x88p))!pH`H`K``8`H`K8`H``H`|yxH`|zx#H`|yyA9;8px~~xH`,A8!p~xx}9.H`K``@d?8eH`<H`<@T?8bK``,>A<@?8xH`<H`K```,>@?8sK``,>@D?8uK``?8DH`x8H`<H`K<8H`8H`K```{D H`H`Kd8),)A8H`````)8),)@x xH`]x| Px"H`H`:|HPx H`Kxz$8|̮pH`88pH`K```xK``8K<- ? D EP8 aq:?I"     " % (7( +0 .!8 2p@ 6uH 9P =X A` Ch F-p I-x L- P- T- [- `! r- t w- y {  } ! !   ! - - - -  H( 0 #8JidH@ HH P (X (` -h -p !x ! ! 4 > - - - ! - H ! !  x   U8+7sp0 1 3:H; . < -(id= 0ppu7spw xp<7EF G v8H pz@ ! ! /9@xjmpALBC3C}0&q!220*e:?9  :! H:"q hn /P! " # $H% & )(z :!H!H!- . eBicgsw0fSUbLEGAHFMCKm ebxsuDLU85 <5 <end5 <5 <ptr5 <5 < 5(507 v8 9 : 8< < end< < ptr< < <(<0 A> ? mem@ maxA 8C C endC C ptrC C C(C0  :  :  ! "H : ' /key( -) -* / >K:1 % 1 & 1 ' '  LM A   & Y: F  F:xYV:un~  ~Y:kN0 57H8H9H:H ; q< = >(& O%:0!F9.LPbuf/%2""ACC     "POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx"EQy"NEQz{|}~"BEQ #+>#.fd#/H#0end#1 #2 max#3 #4(#5P#5X#6 -`#7Hh#8 p#9 x  ! " #7!j l H m  n H p H q r t v Qi #l!! !) H  H#O  L H@@-- $!\D8#fxO! %SH;&} H<O= <P #j #iz H /(  R H;@- LQH#chH 6 H@--#a=#d #SH #QH )~ H H  q )f H2HHH * HROO.2eoOoH2   *+z. +H.R,% # OH#  HTT.. *=DH. *dO.#*.{O#*OH;OS#& HOS  O -Uo2J,*3 .E'3`T43d*:($ (1 i !pos !val 7$7HcfU)@Vd(QT1 \TU8+[H'+l+x-]-z-n-;S RS T U -{---s`--hDSTU  ST EST4$, *:{( *K*U *bS/ b// TU8/// \TU8/ //TU86w6$W60616;///\/  // TU8/ k// \TU8X/Y/Z//  // TU8-] q-z-n-; @S RS T U -!6---s!--h STU  ST EST/!// \STU8-]$"-z-n-;!S RS T U -$"---h"STU "ST RS T U |+[# +l+x+[r#F+l+xQ#sT 1% #T #T #T0#T04*b.%T %,T Q%T0x&S0&4S0QR&S T U QQ'TD'8TU1'\T0'sT0'TR'S T U R(?S T U R(rS T U DR(S T U R(S T U R) S T U }R)>S T U {R)qS T U R)S T U R)S T U R* S T U  RS T U **b n.!+7[7+[4n7!7i !+[*+l+xR++S T U  RS T U *!+$675n !3,(&Hcfpc )p,-elt   SQ,ETU,]T;,uS RS T U \ 8|-]4pc1DH -ph--S #TSUp RS T U *D-$H pos,!5cf,w- pcw(D+yH+z -,q- pcq$D$q18,g. pcg%D+i -]S /(S/4valS;U2zV XW!C@Y"x.SzT0.ST\.ST U4R/)S T U XR/\S T U d RS T U ^,N/$N$ valN0*F/$F%5resH ^4G% _a % % 60|-- ST3)0-- ST161H%4G% .d1SD1,STUk S 62  Pret" H)P2$ 4L{err%O1S TU T{U 4] 2T4y4n2STUVP6L2St2S2S  S TU`4 3E44 dS*3aS2T03S #3S3S{3ST:4R4+S T U B S VY4]>:7 48(O8=O7 48.Oalen .b cx 6dbufz6w5T U05T5\S5T 5S5TwU  S TY6>:7+6Geval8f?6G?-g0( I~I : ; 9 I8 H}H} !I1B : ; 9 I 8 : ; 9 I :!; 9!I!8 H} .?: ; 9 'I< : ; 9 1RBUX!YW  : ; 9 I8 $ > I U41B!I/ 4:!;9 IB4:!; 9 I.?: ; 9 '<4:!;9 IB :! ;9 I8 <414:!;9 I>! !I: ; 9!1RBX!YW  :!;9 I!4: ; 9 I?<"( #.?: ;9 'I<$:!;9 I%4:!; 9 IB&&I': ;9 I(:!;9 IB) *.:!;9 'I +4:!;9 I,.:!;9! ' !-4:!; 9!I .7I/ :! ; 9 I0: ; 9 I 14G:!; 9 2.?: ;9 '<3.?:!;9 '@z4:!;9 IB54:!;9 I6 U7.: ; 9 'I 8:!; 9 I9 !!: ; 9!: :!; 9 I8;.?: ;9 '<<.?:!'; 9!'<=.?:!;9!'I<>!I/?4:!; 9! I@% A$ > B CGID : ; 9 E : ; 9 F&G> I: ; 9 H5II  : ; 9 J : ; 9 I 8K!IL(M(N : ;9 OI P : ; 9 I 8 Q.?: ; 9 '<R.?: ; 9 'I<ST1RBUX YW U : ;9 V4: ;9 IW 1X1UX YW Y1Z1[.: ;9 'I@z\.?: ;9 'I@z].: ;9 '@z^.?: ; 9 '@z_4: ; 9 IB`1RBUX Y W a4: ; 9 Ib.: ; 9 ' c.: ; 9 '@zd4: ; 9 Ie: ; 9 If g.?<n: ; .So.S..S./o/3STn(T()n)*T*,n,.T..T./n/2T23n33Tmmm(,m,.j..m//m22j23mj ys"3$"j..jSjSjSjSSS S y}!"S""S""j##S,,j..S..S11S11j11S11j33jSi$$S$%i&&S&'j/0j00i12i!!Y"#i#$i..i01illSl(,l,.h..l//l22h23lhj$$j&&iSj S#$S$$j))S)*o,,S,.i//S//o01S11j22il..l0T..0Si12ijSj11S12jjjj33jS33S  Y S!! !!Y!!yx!!T""Y"" "" ##Y## ## $$S$%i00i$$j$$S$%j00S00j%%%%j%%j&&Y%&S&&i&&S&'j/0j&&i&&S&&i//S/0i''g//g''S//S((l//l((0()T//0,-h22h,-0--T220,S,mSmSmSSm0ZZZtoooo00HZZ0H0Hto0SoSoSnSnTToZoooSTSSSSnSnS nTmTmT mlyl l S oooo S S n l nnnl S o    SnSn SSSSV nn oo o ooo S SSS,0r0t         ..1233   !!33""""""####$$%%00$%%%%%$%%%%%&&&&''/0&'''''//((()//,,,-223333334444c runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/sys/usr/include/powerpc64-linux-gnu/bits/typesdebugger.cmlvalues.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htypes.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hplatform.hcodefrag.hdebugger.hskiplist.hunistd.hsocket_type.hsockaddr.hsocket.hun.hnetdb.hsetjmp.hinstruct.hio.hfix_code.hwait.hstdlib.hdomain.hintext.hsocket.hstring.hsys.herrno.hosdeps.halloc.hstdatomic.h /=<.!r!!.. v!!!! 2   /    /..d " ,", %2B@D& l% v2z@|$ % 2@& 2@' ( 2H0H) 2@0@:ZBXDC* ZXC2@+ ZXC 2 0 , 2262>0B0D b2f2n0r0t 2200 2x0x20. / / 22"0&@(0 41 D2 V2Z@h3 t4 5 6 `7 208 2@209 20206  : 2@"2&0*2.02Z4 :XB2DCJ02200 2"0$) .2204) >2B0D) N2XZ0X\) l; z2 0 ) ' ( 20= 2 2 0 0  B2 F0 V2 j@ x? @ % @ 2 @ 2 0 A 22 62 >0 B0 D b2 f0 ~Z X C 2 @ "2 *@ ,? 6@ <% F2L J0L N@ P% Z2 f@ l% v@ % @ % @ % 2 @ & 2 @ 2 0 D C x% % E % % & F F $@ L= hG xH I J K L L 20 CF  C F TF \ hF M  0F E % 0% DF h, t& F 20M % & F  2 @ , <M TF x? , F M E  % (% 4& DF TF d@ = G H C,  & $N 4O DF TF d@ = A 2@F 2H@H2@*22@4? >@B2LF0LH% V2Z@% 2@% E 2@% @% 2"@:2>2F0J0L j2r@t? ~2L0L@% 2@2@2@? @+  2L0L@% (% 8% X% d& % % % % $? 8, j2n2v0z0| 2L0L2@% 2200 2200 2200 220"0$ 62:2B0F0H Z2^2f0j0l z2~200 2200 2200 2200  2200 *2.260:0< J2N2V0Z0\ j2n2v0z0| 2200 P 2@L 2@L 2020&3& 30& 83H&P3`&h3x& @3& `3&3& & B& (W 4&*/=HD \h'ov}.%n  =~  ".0?T rY   ~j 92 ! &=HSo <f5+   /(9 EbVJ}  F ,% %q3AO *] kxy me{5, !~/ =I U -amy  M;` #J/q;G ST_ kwHm ^76 d =1Jc<{'    %f +0 : D^5k~ u  Q)    #D ) 0 = j J W d q4 ~     l    >  X   > i A  !: ' - 3 9 ? E K Q W ] V c i q o un {W      g Q  v  F w 6   -  " /" B O` \ i wk  -   "   e ' A- [ h u"      J     " GT& XS& iR& r  ( `     8     G -j J,9Wdq-L *Z{V  &N3 R ag msy"' 8 A J S \ e n w  L/!' - 3 9?E(K1QW ] 'cei \ou{R?;zV% B^it hr#|)/$5;cASGMuSY_,exkqw_}ZN x   +    4 %+ 1qB HNTZ1`flkxi~  qr'd : T  "<Vcp<} r  CU &+&4 @&I U&^ j&s &&&5& I!KF]ymQ  ! 8<:Ri; )/D T43Su*9% E7e|6x  E+FM&h&r\{&&& `  daIOvF"6&$6:v?YJNS^ b grvL0}&&,&@& De e!,& 6uFJSW\uein&,&&&&H-+97&H C A &TE&pa&&&&&&OKb^&&&6s:qH&g&hq&p&&&&"&>BK&`dmq|& &(&0&0&D&&;?HLQ&p&&&&` + % C A  S $K )&l A&t R& _& v&  r p ~ | &     &!&!&!;&!E !U!Y!b!f!k&!&`!!!!!!!!!&l!& !&"&"&")'"9"="B'"K"O "]&"&"&"&"&"&\"<""""<#7#1#&x#L#*S#.O#3L#<h#@b#G& 4#T& D#t& X#& t#& #& #& #& #& #& $& $& $ & $-& $:& $G& $T&$a&$n&${&$&$&$&($&\$&`$&p$&$&$&$& %&8%-&L%:&|%G&%T&%a&%n&%{&\%&%&%&%&%&0%&<%&L%&\%&&&,&&<&5&L&B&\&O&&\&<&i&P&v&&&&&&&&&&&T&&&&&&|&&'&'&'9&'F&0']&@'t&`'&l'&'&'&'& '&'&'&(&( &("&(/&(@&,(U&(b&(s&P(&(&(&(&(&(&(&(&) &)!&).&)?&$)T&)a&)r&D)&)&)&d)&)&)&)&)&* &*&*)&*; *V *cj*o&********&0* *0*,* *C*=*&+&0+&+,&d+=&+J&+\+m++& @+d+_+W+++++& +,,x,,,& ,.& ,F& ,^& ,v& L,&,&,,&,,, , ,,e,&-&-.& -?&-L&-^ -o-t- -e-U---e..& .'.2$.6.F^.JR.Oy._e.n.} ...&.&.&(. &.&L/ &/&/*&|/?&/L&/]&/n&/{&/ /////&/ \000000( 0,01r0; :0? 60D0M0X0c&0}&000&0Z00 M0 I00 v0 n0&1 &1-&,1>&1I51R1bA1| 1 1&d11 1 1&t1&1& 1&2&2$&2.E2> 2B 2K 2O 2U&h2&2&2&L2&2&d2&X2&3 3 3 3 3' 3+ 30&3F&3b&03w&3&<3&L3&p3&|3&3&83&4&4&4,&<4=&4^4o \4z4\4494 4&4&5&5&5+&58&,5E&<5]&L5j&t5&5&5&5&5&5&5&H6 62R6<6M*6Q2z&&&& && T& d&&r&l < @l `.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @0 @ *&p,xP12xE(@@8OJ@̸HTa6X\@c mS]nY 2{@0c0@1h0d-ve@10xU0 (@1 32pdomain.bd.o/ 0 0 0 644 261632 ` ELF@@@N 9 #N ``|?!qxc$H`{$|#@=")8xH`|dyA="|A\?| H@L,()A(| 9 8H?H`8H`8!|N `<P@8!N |xH`|=ATxH=")=M})j9JjI9J8cIH`,|dx@@8`H`9 x?H`=-9))| 9@IKA`>|)(@=-0x9)>H`,@8p8!|N |dx| 9@8!8`I|N |dxKx|)@@A|*@@A|} @L,_B=")J})R)| H@L,,)@?,)A49 ?xH`8!|N `?,)@_=")|)| H@L,|*H@AK``<|)(@=-0?9);x)H`>,)@T^,*@H,<@;{$H`=")x||~x|)@A@A>x, @>| H@L,,)@d,?A:~óxH`,@H}[j; *9)*|} 9)} @L,=M=-9J9)|9 ?| >?@_,*@CxxH`?,)A>| H@L,,)@=";@ _h_p__0____ X`H`,#`AxH`u8>)8,)AxH`,A#xH,A9 ;?P#x9H`H`,#HAL__xH`,#(A,=")9@9 |*@@@} Cx;>9?H9 <x@808PX?GH`| (7x,)@?9 9?BZ9@??,_A7|*H@A|,A(J|*H@A|@@}]P<qHy)$9)}'JA |>@@AH;|AyJb}IH$``I ;|>P@A;B@I |>P@@=BJ|PA}Hy$|@*A*9J="IHx{ji8H`>i8H`9 ?8`H`9 ?`xxH`}[j~óx*9)*H`,@P=-9@9)I|} 9)} @L,??,AP7|*H@A@,A |*H@A|@}_P=qGy)$9)}(J@pyJb}IHI ;|>P@A;B@dI |>P@@<G9J|PGA}JyJ$|P*Q*HK`` |>8@A;|@xH|```8}H`K88`H`|yAK\<| H@L,|*H@?@,)9@_@;8`H`8`H`8`H`?,)A0<988888`H,A8!x|H?,)@?_|>| H@L,|*H@?A<,)@D?,)@8?,)@,8!x|H```9 ?H`K```x?|^| P@L,?|=| H@L,|*H@A|=| H@L,|}@} @L,|=| H@L,|*H@A| H@L,,)At?Cx9)?H`,@>| H@L,()@l!A|| 9 8!8`=aN ``xH`,@d?9)?>| H@L,()A?xKH```8x#xH`K<``p:~óxH`,A,x@>=-9)~ji78c9)7H7~óx9)7H`,@pxK\=-9)))| H@L,,)@pDx8}HH`K\``x8}H`K```pKpx|dx| H@L,,)@$>|)A 8~H?x;| A{jx;9);H`,@0,@9 =B<$xx<:z})ZN!A(9 <H8`#H`a8`8!xca!A|N `=-9)i8cH8`K``<?;|?H@@8```988xx8`H>|)@A=-9),?A?|)(@=-0B>!A?-?Ba>?b!a;9;Zxj;{>:u :5H:::RHD``=cx9)=H`,@,@\H`H`H`7, AxH`xH`>p,)A>x,)A~8H`>p,)A>x,)@8~ijx~xH`cxH`,|x@=Yx9)=*| H@L,,)@ x=BJ5x,*AT)}H@A|A\}JzUF} Cx|08@Al;|@0,A 9(|08@AH;|@ yJb}IH$``I ;|0P@A;B@I |0P@@x9F| ZxA}Gx$|8*~9*:||H9):|A$}J})yJ$y)$|P*|H*|Q*|I*HH~cxH`,@=~#x9)=H`=~cx9)=H`,@H`;|dx8`H`K```8`H`H`=")), @,<A>9 ;Ap4;a!x!p^Tc~hc!!xaH`|dx8`H`>=-9)]a,?AA9!89p_a!xjH`a;q)AcxH`!iH`8`=)HxH`xH`8}H`xH`x!AaH`8!8`|N 9 ?K`minor_heap_reservation_end <= caml_minor_heaps_end!caml_bt_is_self()unlockCaml_state_opt != NULLtrying to free old minor heap arena: %zuk wordsdomain_state->young_ptr == domain_state->young_endyoung_start: %p, young_end: %p, minor_heap_reservation_start: %p, minor_heap_reservation_end: %p, minor_heap_wsz: %zu words( domain_state->young_start == NULL && domain_state->young_end == NULL) || ( domain_state->young_start == (value*)domain_self->minor_heap_reservation_start && domain_state->young_end <= (value*)domain_self->minor_heap_reservation_end)0 <= idx && idx <= caml_params->max_domainsstw_domains.active_domains <= stw_domains.parked_domainshas_interrupt_word!has_interrupt_wordlock!backup_thread_running(di)failed to create domain backup threadclearing stw leader0 <= domain_iddomain_id < caml_params->max_domainsnum_participating == stw_request.num_domainsb(uintnat)dom_st->young_ptr >= (uintnat)dom_st->memprof_young_trigger(uintnat)dom_st->young_ptr >= (uintnat)dom_st->young_triggerdomain_state->minor_heap_wsz == 0wsize <= caml_minor_heap_max_wsztrying to allocate minor heap arena: %zuk wordsstw_resize_minor_heaps_reservation: caml_empty_minor_heap_no_major_slice_from_stwstw_resize_minor_heaps_reservation: free_minor_heap_arenastw_resize_minor_heaps_reservation: unreserveunreserve_minor_heaps_reservation!dom->interruptor.running || ( dom->state != NULL && dom->state->young_start == NULL && dom->state->young_end == NULL )Bsize_wsize(caml_minor_heap_max_wsz) * caml_params->max_domains == sizestw_resize_minor_heaps_reservation: reservestw_resize_minor_heaps_reservation: allocate_minor_heap_arenaFatal error: No memory for minor heap arenadomain_self == 0!s->running!interruptor_has_pending(s)domain_state->memprof == NULLfind_stw_domaindomain init completeFailed to allocate all_domainsFailed to allocate stw_request.participatingFailed to allocate stw_domains.domainsFailed to create main domaindomain_self->state->unique_id == 0d->young_trigger == d->young_start + (d->young_end - d->young_start) / 2atomic_load (&caml_major_slice_epoch) <= atomic_load (&caml_minor_collections_count)s->runningmsg <= BT_TERMINATEtry_lockrequesting STW, sync=%dcausing STWdomains_participating == stw_domains.active_domainsdomains_participating > 0!interruptor_has_pending(&d->interruptor)Changing heap_max_wsz from %lu to %lu.domain creation not allowed during shutdownocamldebug does not support spawning multiple domainsfailed to create domain thread: pthread_createp.status == Dom_failedfailed to allocate domaincaml_domain_alone() || bt_runningDomain terminatingcaml_gc_phase != Phase_sweep_mainmarking_and_sweeping_done(domain_state)Failed to create domain: signal stackDomain starting (unique_id = %lu)!Is_block(*state)Failed to create domain"gWh#A#hint#######*k,.Hi?#9  W. ZA l@ m@ :kH1      !"#$%&'()*+,-./0123456789:;<<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ AA ' T )T/1d0A *=9dA  k kN 1 (1 u# !35#6# 7(|HkHk  H" y# y$0^`abcdk ek$f(/k0AAj88'1:'1; ./70A7>97N(Cu1E1Fu1G ./0A'HHN0K1M|1N1OO/0A/PO*/.0A?A  /A 0A9 Z e G! HG" :k0  O5:k #XYB/ "@  'k[6 BN9 4 B2B9;l e>?k q / e 0A?m"     " %  (u(+0.82@6H9 P= XA`ChFpIxLPT[`rt Xwy>{}  e  H( 08nidH@HH eP!X!`hpx-7Hq{   e8+u!sp0  1  3:H; 5 < (!id= 0 puu!spw x z uEFRG8Hp C @>>   t 0#$ e* e/H7 ;[ Cp: ;< =(> H?SP@SXA `B h  KC #C (C 2@q!jmpAVB>C  ? e!mem@ v!maxA v8CC!endCC!ptrCC C (C 0 c&S "&T "&U "&V "&[&] ##:/ 0A&"H:k#?#H:k#J      !"#$%&'()*+,-./01#}o //0AO$FZ.Vpbuf// <  e! e" e#u [!fun e!val eH !old ! "  -S.S/H0X /gqAhs@'P,, B[H%%% *%"*%% %& %(* %* (%+ 0%, 8%- @%/ H%0 P%1 X%2 `%3 h%4 p%6 x%7 %8 %9 %: 9 A&%=(@ %9;&Q g sA89  : xgs0H`Hd h p @r!idH!tid   gs G G 6'  AX7  V  o( 0H8@QP\QHQ  7]Ho [6 6g 6s 6+ 6 6s 6 6  sB tb,H,H,b "- Qg0 Q6 <" <. " ukLPN+,O e,P eP(m,n,o,q,r,s < < <* Q (% <W 2'.H' u H 5 p2 H353 dyJVq\Q^ n2 H7o$  (V$u7))#7*7*)$ = <%7 , 3?H7 +xYV *k7W v+h$TN $KN$ HHH2 H ', H$H)3 *?$ ?.'- HNN Seh'&* e{ e,  e'&( e e'. e  e+o'&&HE'/)  e e$Y   e$#K 6H'I+n' H j FH2 H M H ' H     ? C? ] 'Zh! ^b! 0r !,a!>)*!P)'!b7 .$P!} 1 !H'u!I$J! ' -H!I)"I`0l " v" VQH7+kj"GQ'zh"b  u"tVr"Q2"H$"_" `S "HQ0Z "2#$#32 #J2C H#a_#w H2 H#$# `w#V## ##$#I#$#H$$e$  *H  e$ 4 en " d~$ST0U j$TU$STST  e %m ( eJ"   { e&_8old {6 e8new {A e" }HP ~ e %SP &T&/SP$S T U ~ u e' u* e" wH` &S`$&S T U xS` n e'8t n* e" pH`  'yT'S`$'S T U q 'TS` g eH(8t g/ e i( ja  E D) G i I Hdom J)= N  M )[%J)sS 8)S8)SJS ( 7+H" ; `*" 9+H R 9JA <*JmJ`JSJ{S1TUV0W0X0  @+  *+E8#aS  #J j h  3  , 5 C H Q)+ ) )= ,. j  /, *,E8#aS  #Jh,S\,S0nSbmh7Xm! osp( qH (z-$/;0 = .L *.7E8#wS  .~ % /<*/'E8#JS7X /q7j7X/7j z22 \ 1w.  "0- #1>- -$1 S T U  $S T U  D1Y"S  ^10#=J b2#0#=J  2 *2E8#aS #wS 3C>*3.E8#JS  3 *3E8#aS  #J#3S  ? k ? k %4BS4ZS !P$4STU  z#4S 6 4S7-4S0 %$5,S T U 5DS5\S 6 5S7!5S!j5S!j5S S S   !b   !P  !> !,    h $6STU  !6S!j6S!j7S S S   !b*g 7xg: bH 78( d 8: ]H(8(]18(_ 8:*YH8FdY43N 9x wRP8w^"t8S"bS=Q=) *9_E8#aS #wS(?: A B 9 G GB:UD:;  G$S T U D(8; :< *;Ew8 #aS  #J(-= / 0 )<* 4 4 0x  J  b>  $S T U (@%?~ ? sE@%#@SC#@SCE@%(Dd@   DA>DE.E@EE&.E4A E9EF.ET(AkEYEfEsEEE.EAEE HG$S T U I  B]JJJJ{ST UVWX DCDE.EBEE&.E4BE9EF.ET(CPEYEfEsEEE.EC|EE HG$S T U  s#CS6YCS #D S6EF@EF@ k$DgS T U $S T U 3 DFSF TFHUFQVEdG  KE4  KET  KE       ($F@F?S-d(THG1   d)F   )G & & Gg%G|GS$HS T U $S T U (lIRJdn tH uIR uy%0D]I)^dk%=BO (dxI fI%$S T U fLXHJ,Y VZ [ J<\J< J,LLHJ{M VN O J< HQ_H V  J< o iH  H HK"  )K    L  L:  L  H$L}S U $LS T U $S TU MdM[MsS$S T U  NJ *N4E8#aS TS 2N *NE8#aS #JSO OQ 5O\h iu%" PM *P8E8#aS #JS Pv #PS T#PS##PS TPSTTQST T#Q+S#QQCS" ST kHtQ$S T U lL QL,x@ T@0 1CR)C TGSTTT.TTS4TT=)* :  7 S: %=6=#S  ETD#S #T\S!#TtS!#S! T 5 6k 6k )k )k U    yHSUJb:N NW8HbNZ(U1( CZV-ZZ ZCWXZ^ZQZkZxZ= S VreZC Z^ZQZkZxZS #`$WS T U $S T U (LZC$HbN NZ(Xl1( C ZXZZ ZCYZ^ZQZkZxZ= S YgreZC Z^ZQZkZxZS #` ZZZS #`$S T U  Z0N;H  k k k Z0NzN*HZb6Nn=H  ed[M+ e"H` S`  eh[( e"H` S`  e<bb( e8 e bb >"~ Hep +eth errH (\ +H \  e s]Nt&tt !]9Sx!S ] *]E8#aS #wS  ^A~ % ^*^E8#JS _Z *_EE8#aS #wS _ *_E8#aS #JS`Ms$`s!j`S!j`SSS `S@ aST0U V a.T aFS" adST w j jH$aS T U !aS "aS  ObT0!b2S $S T U  >{g8v'p!!g " % fQ J eresL emutPE hmMdhhh;h;h~h.hchcS $0) 1'TcS0$S T U  hNe(hhh+h8;hE~hRh_ {dS e$dS T U $S T U  saes!jehS!jeSSS jH#eS  6 eS6 fST1f%STU1,f<S0S 3f *fE8#aS  #w ;g_ *gQE8#aS  #J C wl j #gS#gS gS"S  + hm  eres 0 e  bb  >    H  * eh( bb >+res e  H  eff| 3 jH8di3iX   =i ji#iSGjS$S T U 3 m8di2errH" ~" }j   kf *kQE8#aS #JSa l > *kE8#aS #wS lb>l8lSlS0TU m+ST0U V mJT mlS2TU0 w$S T U Uv s8vv'dixmsgy sz()nT    )n  )n  )o    o@    o *oE8#aS #wS pW~   p*pE8#wS  qa> *qSE8#aS  #J q>= rE *r/E8#aS S  rn , r*rE8#JSs~ $sSTU " sST" STa sa<X t4X<Y) eY9 e(E$tE H$tS T U F$S T U G(|wR 5u<"+H R)uu" R)vi) Hdom*)"5uS "buS"5uS"bS"Gv5ST "GvRST8"GvoST8 wlvST0 "-$vS T U @"vS "wS "w6S "S Swl 3 ^ # .d   s(  H4444444444)x ' 'y    )yV eIR e y *yE8#aS #wS@1z& 8z S{ *{E8#aS #wSr{~ ^{p ~- XU }jw3   "|-$ -$STU  #}- -$}fS T U  $STU  D}"S V~0#=J  ~ *~E8#aS #JS I *4E8#aS #JS } XM jw3  "-$ -$STU  #- -$STU  % On0#=J  " " ST" ST!ST ! !!S~.S!FS !!kS!S#S !jS z !b !P !> !,!S#-S"GKS1T $~S T U r$S T U $S T U 8$S T U 7$JS T U l!}S1*~  ([)JA-JmJ`JSJ{S1TUV0W0X0 @9N@N$S T U #S $S T U $S T U #S U3f7)'H7Q  H NT H  ft YD%$S T U #S "(T$S T U #qS+#S #S  #S+U2U>ZZST@@$#sS "ST0UV#S  zUJS#S ~S$JS T U "S >   +i H+dom)3b % c d e iz Hdom{) } $S T U  #3"ST1#S $ S T U g"S  ZH<~Z. zV~SSU* Hu*. +)* ?uend@uJpBu @.(N@(N$S T U #S$S T U $S TU  \0 zn{#3S3$ @VN@(N$S T U #S$NS T U $S T U #S "T"SF@S$S T U 2$LS T U +$S TU - 3 0@  & & @N @aN$S T U #S $S T U $S T U #S  #$S T U \ L ++bs H-( ;F%OP}\  *}E8#aS #wS   * E8#aS #JS %0.=BO%]^k#S0~ B(U H8s0( H % ju%~ QhQO: #S"TS T#S" @%QS$8S T U T$S T U \$S T U * di8    c|Hww< y yqzsq7( sK] s%IR s% t t[ dom[.+idx\HS domS2+idxUHL domL.+idxMH*B+domF6 X6"H6,H 8 9*0 Hdom0- 1H+end2H*+ Hdom+- ,H+end-H*! H! Hend!+Hdom!>+i$ H3 <  i H  $S T U $S T U  f-  -$S T U  - -$S T U  $S T U  ;idx $HWjXs>(--WXs>(--MHXs=(- - m4Q*Hm5Q+rH*m;QS( err4H*MHM8N4N P P  AA<==?*9H9B414= 6 6*+NQ+HWY>#--MHYE#- - (Mm-o -o MtH YtE@La@>L+hB  BL B  L<H~<<h5T,ZTT T m *XE8#aS #wSDTTU # *E8#aS #JS#<S#S 54~ 5\Dn{ #35wRTqw^"t[S"bS5U2@U>ZZS #`TS@@$5 E5JA,JSJ`JmVJ{S1TSUTVUW0X05I,JJJVJ{S0TSUTVUW0X05=TeQ Wpc j5==) *E8#aS #wS2I~( 1BH}H}41B : ; 9 I8 I 1RBUX YW  H} 4:!;9 IB  !I 4: ;9 I1RBX YW : ; 9 I U:!;9 IB: ;9 I : ; 9 I 8 41 :!; 9!I!8.?: ; 9 '<4:!;9 IB.: ;9 '  1 : ; 9  U: ;9 I1RBUX YW 1RBX YW   .?:!;9 'I@z! : ; 9 I8 "4:!;9 I#$ > $.?: ;9 '<% 1U&4: ; 9 I?<'.?: ; 9 'I<(.?:!;9 '@z) *.: ;9 'I +4: ;9 I, : ;9 I8 -4: ; 9 I. 1/I0!I/ 1 : ; 9 I2.?: ;9 'I<3.:!;9 '@z4 :!;9!5.1@z64:!; 9 I7.?: ; 9 '<8:!;9 IB9&I:>! !I: ; 9 ;41<4G:!;=1RBUX!YW >1?7I@GIA : ; 9 B: ;9 IC<D 1UEH}F:!;9 IG : ; 9 I8H.?: ;9 'I<I.?: ; 9 'I<J K L.?: ;9 'I M.: ; 9 'I !N : ; 9! O: ; 9 I P : ;9 Q4G:!;9 R4:!;9!I S.?:!;9 ' !TH}U.:!;9 'I@zVH}W.: ; 9!' !X:!; 9 IY: ; 9 IZ !!: ; 9![4: ;9!!I?<\']'I^.?: ; 9 '<_.?: ;!9 '<`a1RBX!YW!b.?:!;9!'@|c.?:!;9 'I !d41!e4:!;9 If.:!;9! 'g% h$ > i j : ; 9 k'l5Im  : ; 9 n : ; 9 I 8oI p : ; 9 I 8 q!Ir : ; 9 s4G: ; t : ;9 u> I: ;9 v.?: ;9 '<w1x.: ;9 '@|y.?: ;9 'I@zz.: ;9 'I {.: ;9 'I@||.: ;9 ' }41 ~.?: ;9 ' .: ; 9 ' .1@z.?<n: ; 9SSЭ ЭܭSܭYSzSȮYЬجSجSجܬSЪSīoī̫S̫oSȬoЪTn̫T̫nTȬnsY̫߫YS̪S˧S˧oSoSSS#S#S1Ԧ10ХnХإإnYnԦ0oooYY0o sãSģ̣SSģ̣  SSTTUUVV#y3sSSST  ؊S؊oSoSn̕ȗnؗnؗ̕0o010̕0oؗ1̋ ˋYˋYЎ S ЎzЎzYؗ S ԍnn`ؗ`̐o̐Z `ؗ`0ؗ0 _ؗ _ _`ؗ` _ؗ _ _0ؗ00 ؗ _ _ؗ _ _0oo00̐Z̐o̐`Đ̐UܐY ܐZ WVcS ̑ԑS̑ԑ sSSĘS Ę  SSs $ & "oooSSS  ԈX܈XXԈy3.܈y3.y3.x0XxԈY܈YYĈԈZ܈ZZSˇ sˇṠS ߆Xy3.߆y3.#x1 #Y߆Y߆ZY #YȄy3'SЂ#SyЁY##YˀYWX Z[ [\ ]] ^^ ^^ YYYZ[YXYZXXZ]^ZXXY]^YXXYXYXYZXXYXYYYYZZ0ZZ [\ ^^ \\Z]]Z\\Z^^Z\\Y^^Y\\Y\\]]\\Z]]Z\\Y\\]]\\Y]]YVVSVVS,,S,-o--S-.o..S..o,-n-.n,- $ & "-. $ & ",-o--S-.o,-n-.n..Y,- $ & "#,- $ & "#--Y--o--o-- +,Y++Z+,Z++y+,y++Z+,Z++y+,y++Z++Z++y+,y++Z**Y**Y**Y**Y** ** iiSiiTikgkoSoogopSpqgqrSrrgrrSrrgiiTiojooTorjiiUioiooUoriiiVioeooVoreiiWiodooWordiiXiocooXorcll0llnlllmnmm0mmmmmmmmopmqq0qrnrr0iolorlkk1)pp1)pp1jjYjo or rr jkYppYqqYko op qr rr kk ko op qr rr kk y $ &kkYkk0pp0ll0lmfqq0qrfrr0mmnopnmmmmmmYopYjj oo rr jjSooSrrSrrfjjSrrSrrfjj rr mn rr nnSrrSnn rr pp pp pp  pp1pp pp0pp rr ppSrrSpp rr SmSmSmS m S mSmS m 0   YY        %%S%%n%%S%&n&&S&'n''S'(n%%o%%S%&o&&o&' #h''o%% %%n%%o&&n&'n&&T&'T&&T&& && &&Y&'n&'T""S"#o##S#$o$$S$$o$$S$$S$$o""T"# #h$$ #h"#T$$T"" ""o"" #h##o##S$$o##T$$T##T## ## ##Y$$o$$T##T!!S!"S S !SwwS}}S}}q#0wwT}}T}}q#8wx#~~#~~#w|h|||}h}}}hx}0}0yySy|i||x|}i}}x}~i~~i~ix} } xxZ~~Z~~Z||s||S|}s}}SxyZxyXxySyyxyzn~~nyyS~~Syy ~~ z{#z{#zzY{{YzznzzSzz zzn}~nzzS}}Szz }~ {{n}}n{{S}}S{{ }} ||o||||YoǙSǙěoěПSПoSoǙSǙěoěПSПoSoğmПmmșSlПlġlġȡSȡlnĝSSܞȟo؜ĝhh#ĝiП000SSSSZZ#̞nnП00̞kkm# SSS  s SSS ġ SoSo2oYSl~SlS1nnSS  SS  YYlYYbcScemeeSeimccScemeeSeimcdYddYeeYeeYffYffYggYghYccsceeeS#eiccsceneeeeS#einccYddnggnddYggYefnghnffYghYdeneeeeYeeeeS#ee3eeleeSee cd#cd#ddYffYddjddSdd ddShhSdd hh fgfhhfhhhiffgShhShhSffShhSff hi ggfggggSgg gg#gg#ggYSoSSo SQRSRUkUUSUVkQQTQUiUUTUViRS0STmTTTTmTTYSTo>>S>DiDLSLMiMNSNNiNNSNOiOPSPPiPQSQQi>>T>CjCLTLMjMNTNNjNNTNOjOPTPPjPQTQQj>A0AHnILnLM0MNnNN0NPnQQnQQ0AGoIJoMMSMMoOOoOPoPPoQQoAHILMNNPQQ??S?IhINhNNSNQh?@1@@2@A LM @@Y?N NQ ?@Y@@YBHIJMMOOOPQQBGoIJoMMoOOoOPoQQo?? QQ ??SQQS?? QQ AAnAAAAAAYNNYBBfPPfBBSPPSBB PP CCCCCCYMMYEEYEF FHnOOnOPnHHmFHnOOnOPnFGmGGOOmOPmFHjOOjOPjFHnOOnOPnFHjOOjOPjFGmGGOOmOPm FGmOPmOPmGGjOOjPPjPPjGGmHHmHHmHHZHHVHHnHI PQ HISPPSHI PQ JJfQQfJJSQQSJJ QQ JLnLLnMNnNNnLLoJLnLLnMNnNNnJKoLLoLLMNoNNoJLmLLmMNmNNmJLnLLnMNnNNnJLmLLmMNmNNmJKoLLoLLMNoNNoJKoMMoMMoKKmMNmNNmNNmKKoKLoLLoLLZLL LLoLLnLLWssSstotwStt0ttott tuouvovwo88S8:n:=S==n=>S89T9<j<<T<>j89U9:o:=U==o=>U89V9:m:=V==m=>V9<i<=i=>i9:  $@L$)==  $@L$)9909:S:<h<=h==0=>h:<1<=1=>1:<j<=j=>j:;j<=j=>j;;o=>o::0:;n<=n:;o<=o;<h;<@@$<<T<<@@$STSToop 3$0nnYYXX88S88o88S88S//S/0l00S03l46l66S68l/3o46o77o77n78o12V12U12V// 55 00l00 +(00S +(00S33 66   o 0  SnSnSsmmSS  mmSS  nYnYY ^_S__o_bSbbSbbo_anaaSabn^_S^_s^_Y__o___a0ab0_`oabo__ __ __ __YaaY1Zy0.0oooy0.y0.y0.       0) y0)0)0)  SS    00  SS  ##YSs +(S +(So((S((T((S((s@@$((t@@$((T((S@@$ssSssTssSssTssYssTssUssVssUssSssTssSssTssYssTssUssVssUSoo܅oS܅SąS ܅ ,Wh 9              """###$$$$##########$$&&&&&&''&&&&&&&&((((******+++,++++++++++++++++++++++++,,,-/045770000234466:<<=>>:;<=>>:;<=>>:;<=:;<=????QQ??QQ????@@BBBBPPBBPPEEEEFFFFFFFFFHOOOPFFFFFFFHOOOPFFFGOPGGOOPPOOPPGHOOHHHIPQHIPQJJQQJJQQJLMNNNJLLLMNNNJLLLMNNNJKMMKKMNNNKLLLLLLLQQQQQQRRSTTTXY]^YYZZ[]^^^^^^^_^^^^_______aabcccceehheehhddhhddhheeeeffffffffffgggghhffffhhfffffgggggiiijjjrrjjjjrrjjrrkkkkkkkklmqrmmopmnrrnnrrpppppppppprrpprrpppqqqtuuvvwxxxxxxxyyyyyyz~~yy~~zzzzz{zzzzz{zzzzz{zz}~zz}~{{{{}}{{}}||||ЅЅԇ̇ԇЌĎЎĎЎĎЎĎЎؗؗؗؗؗ̐АԐܐĔȔĚȚ̚ԚġġԜԜ؜ĝĝН؝̞ĝН؝̞ĢȢ̣ģ̣̤Фܤ̥Хإ@ runtimeruntime/caml/usr/include/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/typesdomain.cplatform.hpthread.hdomain.hmisc.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hcpu-set.hatomic_wide_counter.hthread-shared-types.hstruct_mutex.hpthreadtypes.h__sigset_t.hstruct___jmp_buf_tag.hconfname.hsigset_t.hstdatomic.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hweak.hfinalise.hfail.hsetjmp.hmajor_gc.haddress_class.hdebugger.hruntime_events.hsetjmp.hstartup_aux.hsync.hunistd.hbacktrace_prim.hshared_heap.hintext.hsignals.hsigthread.hsignal.halloc.hcallback.hmemprof.hbacktrace.h   !1CufC 3CAC3<.1C1C! 1=1"" !# $y.#2Y ,   x "%"'!%# 2u2  <Jqt bwB <fy <y. Jx< !/!!.  .kJ} <. ./q$.q $  q /!V.* T  p<$ !$! 3f q  < fKu  .=/u -2 Y os  t. =v J   $   =x Dx (x  J.<. . N /!!!!'!L,"<%j f.pt<qft;p J%htYv XE% x%! *%0 %",. . )< .Qfu) " )!! !).!# !22  <.#T # !22   )h2d)"/#@2J st. zuXxz. z   Jz   6>z!/T..v zp<.< y J 5y  <2!=[ /;! KM[=< oJt y .<. ww..w. =>U=s p.. s. s  U s < + rJ.f3)%6<.w. . w.p..f/!/Kw!/T.X< w..<.Bt~ t#~J~<.~  p..`  X`/7!/T..rD% <.D. ;<  <.<.x"0/></-/ =><+5+=!<= .!!!!!!X.g-/ <=J/-#!! !-!!K / ! ! -0 -/K /! !;0 -/#-=/cv  _! !] " 1 j<  !tf !v J t6  ..* f</ e.  h< <. s. <x .J -K/Wv R -./4< G<b  ^ <  !tt !v J t6   ."< [J  . h .f .J  R. , T...w!  </!: !!W // ! ! !<t..  !W/t. t<  $- /$  . 4s  <s% %sX .    . . 3Js%  j2  L 02 < r )  r  / 1s. =< t<=& ttX.Z5u5%=5%/5%= 0HJ >x Dx 6x  J X. =< ."0?1!;<6+K!   0( "  "t ( v (   (   (  .0 (  ( ( "(  ( ' "x  !:%3z."#B .-"/0%</ >x Dx. J  X!Jt<qt t<v<qt t<ivX;Cv%UtX%7.X>fE%<J !XY! !.  FJFF/FY0j<3 "=" .JVKZ ZL"J < I.o , 0<I' 2n  "  .-./! 0< !-!/ <   Q...zO.1J fJ.)tWXv<7<-t0" @}ptJ  <}X J/ TJ5.> KJ/ .  <|0.0.  ?=-!!1=z J . <| p<. | <l!!!"@1 $=K@z J0& #& #%!0" $!!!!&r !," /!$  .! @<2.2/!0/!$""="'~)4)zX"$ )~  " m  "!"!!"(!+!)!6!!""""$)~  0#!""'!$!#!.0"Az .!z $. !"z  !$# z [ n i .. h. .> !, .!X! !, " // `./+.!! = .{ K{!/T.f<ff="0KK0=>>{!=T..Lw z c// n i... h. .>!:! !, " /'i< ! g!+  !! !U< !, .f JK>(.t {J h...f {JY t5 {.t3J zJ.t h.. IY  .J.X.J.tf!/%=!1.!!#I""#I""## .%v zJ, ","" "%/== "!(0==/%n %n f.=</ >/< UZ%etf-<s. tY0<0! 1 @t2Stt1XJ .<1 # < X$!1'=!=?=~0'&!I _  _ X$$4 <<!IlJ/fv Jtt1XJ .<1 XyJtdXt %t[ tsX~  ~.J5~ .Y  /~. .t   ./u X 3 ."."""l<".1"A <v< 2<.tntXv..f4&"!0 JzJJ Xt.z  J! 5y~  J   .zp<.< J   1z!/T.. JX,..+". o<zp<.< J   0z!XY #w w<  z  =k..f J 6 J 6 J 6J 6 / z  z!/T.<.A~  f+ 0J <JJ  z.XJ<. f>0N2$Xt.0 .X u./N(#!!!!" $#   4/2*./-!$+ $/ !+H$/.Y"/!%" !s J /#</*..u!=T.. 3$"$d"i$4"> gJ . J<u. < Jt ht< t . <v! /T.. u. <u  Ju . L r5JKe<g. u.f.<.  t0 <  J0 < 8wJ8=8/ 8W/1tw@~%</ >x Dx (x  J .<~<qtt%~<t= XvX=-//. u O.3.M ."$ *!/"0}. # }!!/< uN1=!xp< . x .x < v.  v . x!/T../xp<.<=w~ X 3zJx< Jr!/T..  /021==B O <<4= H <<5\rr< p   }  < q~ J/p_ .$ q  O s i   h. ."J.!, L.!, .!X! !, " /6 Z & ! X!+.!! %V * / T!+!!!!! ) $rp<. r . /r!/T..k.  t>1.KP<=7>====//3?1>#0=!= t  /0q  /AKq  q. q ! T..4"J.~XY<<>====//3 3J. oJt btt  XL>#/3 <./</.# #yy p..y  y .y  y .!/, $y  =y y !!T. .</. r."<? !Kf <.! /.  /-= .&z & / <..   k A?! /M  @ 4.! C ~==<~ J0X O.+JM>X .itX.]J y.t  y.fX!/;/"  .=|t1Kq .q    q /!T../ pf.t"#+"1  " %6yX, 1 m  p Jm  2%/=>=#2p  2p." JK.stJ b   p*!-/p  /}Y)/!)..K?J)Ht) <=?JwK /! .-!0 s !<0/!./ $, 6X 7K $6X y.t  .![z4z.4...J/ N $ ." J/  !p JJ  !_SC_THREAD_SPORADIC_SERVERhas_interrupt_word__align__value64domain_parking_failure_SC_2_SW_DEVcaml__dummy_term_sync_SC_TIMERScaml__roots_term_synccaml_empty_minor_heaps_once__pthread_mutex_s_SC_SHELL_SC_MEMORY_PROTECTIONthresholdcaml_major_collection_slice_SC_SCHAR_MAXextra_paramsnum_domainsdom2_SC_THREAD_SAFE_FUNCTIONS_SC_UCHAR_MAX__saved_maskstw_requests_suspended_SC_C_LANG_SUPPORTEV_DOMAIN_RESIZE_HEAP_RESERVATIONPTHREAD_MUTEX_NORMALcaml_domain_is_in_stwEV_MAJOR_FINISH_MARKINGblock_Booltables_SC_BC_SCALE_MAXcaml_check_errorruntime_warnings_SC_TTY_NAME_MAXcaml_domain_statecaml_gc_loglockedcheck_domain_limityoung_start__bitscaml_global_barrier_and_check_final__cpu_maskEV_MAJOR_SLICE_SC_SELECTcaml_plat_barrier_arrive_SC_SAVED_IDScall_timing_hook_SC_BC_STRING_MAXEV_RING_RESUMEactivate_parked_domainephe_infocaml_domain_initialize_default_SC_TRACE_INHERITgc_policydomain_state_init_failureinstall_backup_thread_SC_SEMAPHOREScaml_num_domains_running_SC_EQUIV_CLASS_MAXstatememory_order_releaseinterrupt_wordbacktrace_activecaml_plat_barrier_waitlocal_rootsEV_MAJOR_GC_STWmemory_order_acquire_SC_DEVICE_SPECIFICmajor_slice_epoch_SC_THREAD_THREADS_MAXstack_handlernext_SC_LEVEL3_CACHE_SIZEEV_MAJORcaml_local_roots_ptr_SC_THREAD_PROCESS_SHARED_SC_JOB_CONTROLDom_startingcaml_get_init_stack_wsizepthread_canceldomain_startup_paramscaml_domain_terminatemyselfbarrier_statuschar_oscaml_custom_eltcaml_minor_tablesEV_DOMAIN_TERMINATE_SC_NL_NMAXcaml_stat_alloc_SC_POLLpthread_tcaml_plat_futex_word_SC_V6_ILP32_OFF32domain_state_SC_BASEcaml_plat_futex_value__atomic_store_tmp_SC_LONG_BIT__jmpbufmemory_order_acq_rel_SC_CLOCK_SELECTIONmaskEV_MINOR_EPHE_CLEANcaml__continue_723EV_MAJOR_FINISH_SWEEPINGyoung_limitpthread_createcheck_stw_domains_SC_V7_LPBIG_OFFBIGmemory_order_relaxedPhase_mark_finalcaml_domain_is_multicore_SC_AIO_LISTIO_MAXcaml_paramsEV_RING_STOP_SC_MINSIGSTKSZcaml_mem_committriggerextra_heap_resources_minorEV_MINOR_FINALIZEDmemprof_young_trigger__builtin_memset_SC_FILE_SYSTEMswap_stw_domains_SC_TRACE_SYS_MAXdependent_sizefutex_SC_SCHAR_MIN_SC_LINE_MAX__ownerall_domains_SC_TZNAME_MAX__mask_was_savedcaml_incoming_interrupts_queuedEV_MINOR_FINALIZERS_OLDIFYallocated_words_suspended_SC_2_VERSION_SC_2_PBS_CHECKPOINT__sigset_tcaml_plat_condcaml_try_run_on_all_domainsnext_domain_unique_idcaml_domain_spawncaml_plat_signal__lockminor_tablesstop_parked_domainfinished_SC_LEVEL4_CACHE_ASSOCfind_parked_domain__pthread_list_t_SC_NL_LANGMAXdomains_still_runningcaml_result_is_exceptioninterruptor_set_pendingnum_domains_still_processingcaml_heap_state_SC_LEVEL1_ICACHE_ASSOCglobal_barrier_beginEV_COMPACT_FORWARDcaml_teardown_major_gccaml_lockdepthPTHREAD_MUTEX_DEFAULTcaml_alloc_stack_cachetodoEV_MAJOR_MEMPROF_ROOTScaml_mem_mapinit_custom_major_ratiocaml_noalloc_end__atomic_exchange_ptrEV_MINOR_REMEMBERED_SET_PROMOTE_SC_2_C_BINDEV_DOMAIN_CONDITION_WAITmake_finished_SC_PRIORITY_SCHEDULING_SC_SS_REPL_MAXEV_MAJOR_GC_PHASE_CHANGEfree_minor_heap_arenatrap_sp_offstat_forced_major_collectionsshould_syncinit_custom_minor_ratio_SC_VERSIONcds_file_SC_FSYNCruntime/domain.cwsizeEV_STW_HANDLERcaml__dummy_callbackstws_waitedcaml_finalise_heapupdated_last_SC_FILE_ATTRIBUTESproc_self_exeEV_RING_PAUSE_SC_NZEROcaml_free_shared_heap_SC_2_C_DEVall_domains_condEV_MINOR_FINALIZERS_ADMIN__jmp_buf_tagmarking_donedomain_thread_funcbarrieroo_next_id_local_SC_SYMLOOP_MAXgc_regs_bucketsunsigned charmemory_order_consumeruntime_events_log_wsize_SC_MQ_OPEN_MAXcaml_ephe_ref_tablepthread_mutex_tEV_INTERRUPT_REMOTEcaml_reset_young_limitcaml_assert_shared_heap_is_emptypthread_mutex_lockrequested_external_interrupt_SC_SEM_NSEMS_MAX_SC_USHRT_MAXcaml_domain_countfinalisablecaml_result_privatealloc_minor_tables_failure_SC_STREAM_MAX_SC_ASYNCHRONOUS_IO_SC_READER_WRITER_LOCKS_SC_CPUTIMEcpu_set_tinit_custom_minor_max_bsz_SC_2_PBS_LOCATE_SC_DEVICE_IOenter_spin_callback_SC_RE_DUP_MAXcaml__spins_1590participating_count_SC_SIGNALScaml_ev_lifecycle_SC_V7_ILP32_OFFBIGstatuscreate_stack_cache_failureEV_MAJOR_FINISH_CYCLEexn_bucketinside_stw_handlerparked_domainslock_SC_PASS_MAX__kindcaml_plat_cond_free__g1_startcaml_free_domains_SC_V7_LP64_OFF64interruptor_has_pending_SC_NPROCESSORS_CONFtrace_levelcaml_domain_terminatingexn_handlerEV_MINOR_LOCAL_ROOTS_SC_XOPEN_XCU_VERSION__atomic_load_ptrcaml_handle_incoming_interruptsdomain_init_completestw_terminate_domainEV_MAJOR_MARK_OPPORTUNISTIC__g1_orig_sizeallocated_words_directstack_SC_MEMLOCKcaml_modify_generational_global_rootcaml_free_backtrace_bufferstop_active_domaincaml_domain_stop_hookstw_resize_minor_heaps_reservation_SC_SEM_VALUE_MAXcaml_alloc_point_hereold_value__thread1_SC_XOPEN_XPG2_SC_XOPEN_XPG3_SC_XOPEN_XPG4signal_stacktrap_barrier_block_SC_REALTIME_SIGNALSEV_EXPLICIT_GC_MAJORcompare_unordereddomains_participatinginit_domain_ml_valuesfinal_infoEV_MAJOR_EPHE_SWEEPinit_minor_heap_wszEV_MINORminor_heap_reservation_startcaml_memprof_new_domain_SC_THREAD_PRIO_PROTECTnitemsverify_heapstw_wait_for_runningcaml_free_stackEV_FORK_PARENTcaml_plat_binary_latchterminate_backup_threadEV_MINOR_GLOBAL_ROOTSexternal_raisecleanup_on_exitallocate_minor_heap_arenacaml_bt_is_in_blocking_section__sizeEV_EMPTY_MINORaction_pendingpthread_selflatchev_lifecycledomain_self_SC_PII_INTERNET_DGRAM_SC_SINGLE_PROCESSPTHREAD_MUTEX_ERRORCHECK_NPcaml_minor_heaps_startEV_COMPACT_SC_RAW_SOCKETScaml_finish_major_cycle__g_refsEV_STW_API_BARRIERsize_tsync_result__countstat_blocks_marked_SC_MULTI_PROCESScaml_alloc_1pthread_getaffinity_np_SC_BC_BASE_MAXdls_rootEV_MINOR_MEMPROF_ROOTSbackup_thread_running_SC_RTSIG_MAXunused_SC_NETWORKING_SC_GETGR_R_SIZE_MAXcaml_global_barrier_num_participatingmemprof_domain_s_SC_THREAD_ATTR_STACKADDR_SC_LEVEL2_CACHE_ASSOC_SC_IOV_MAX_SC_TRACE_EVENT_NAME_MAXcaml_plat_waitinterrupt_domain_localcaml_plat_mutex_reinit_SC_PII_INTERNETcaml_stat_freeleader_setuppthread_exitev_runtime_phasecaml_plat_mutex_freesection_tablerunning_SC_2_UPEEV_RING_STARTparticipatingcaml_enter_global_barriercaml_final_infomajor_ref_SC_DELAYTIMER_MAXcaml_plat_latch_wait_SC_XBS5_ILP32_OFFBIGfirstcaml_minor_heaps_end__int128 unsignedcaml__b_723unique_idEV_FINALISE_UPDATE_FIRSTntablesrequested_global_major_sliceall_domains_lock_SC_SYSTEM_DATABASEcaml_plat_barrier_is_releasedcaml_ephe_ref_eltcaml_domain_dls_getatomic_intnat_SC_T_IOV_MAXdomain_canceledyoung_endcaml_plat_cond_initcaml_ml_domain_cpu_relaxcaml_orphan_finalisersfresh_domain_unique_idcaml_ml_mutex_lock__pthread_internal_listspinscaml_failwith__prev_SC_XOPEN_STREAMSfind_stw_domaincaml_noalloc_begincaml_finish_sweepingcaml_global_barrier_release_as_finalcaml_plat_latch_release__int64_tcaml_bt_enter_ocamlvalueinitial_minor_heap_wsizecaml_ev_endsweeping_donenewdomcache_bucketcaml_bt_is_selfcaml_domain_terminated_hookresult_SC_LEVEL1_DCACHE_LINESIZEcaml_resultPhase_sweep_epheinit_memprof_failureliverequested_major_slicebacktrace_enableddom_internalcaml_init_domainsmemprofrequested_wsz_SC_2_FORT_RUN__atomic_exchange_valcaml_major_slice_epoch__val_SC_ADVISORY_INFO__atomic_exchange_tmpPTHREAD_MUTEX_FAST_NPcaml__roots_blockrequests_suspended_condcaml_mutex_unlockpthread_cond_t_SC_TIMER_MAX_SC_THREADScaml__dummy_res_SC_SYSTEM_DATABASE_R_SC_USER_GROUPS_Rcaml_atfork_defaultstw_api_barrierinterrupt_domaintodo_tailcaml_process_external_interruptcaml_interrupt_all_signal_safe_SC_UINT_MAX/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bedomain_createcaml_update_young_limit_after_c_callcaml_state_SC_TRACE_NAME_MAXcustommagicmemsetcaml_plat_try_lockcaml_plat_futexcaml_mem_round_up_pagescaml_free_minor_tablesstw_leader_SC_CHILD_MAXcaml_callback_rescaml_finish_markingminor_heap_reservation_endasize_tnew_minor_wsz__nextcaml_intern_statecaml_plat_mutex_initexe_nameunit_SC_V6_LP64_OFF64domain_resize_heaps_reservation_from_stw_single_SC_NGROUPS_MAXc_stack_SC_THREAD_ROBUST_PRIO_INHERITadvance_global_major_slice_epochminor_heaps_reservation_bsizeEV_COMPACT_RELEASE_SC_THREAD_DESTRUCTOR_ITERATIONSpthread_equal__int128_SC_SSIZE_MAXbacktrace_pos_SC_PII_OSI_CLTScaml__temp_resultallocated_words_resumed__elisionallocated_wordscaml_memprof_delete_domainhandle_incoming_otherwise_relaxcurrent_stackshort unsigned intsigned char__g_sizestart_SC_STREAMScaml_remove_generational_global_rootcurrentidx2EV_EXPLICIT_GC_FULL_MAJOR_SC_PAGESIZEsigjmp_buf_SC_THREAD_PRIORITY_SCHEDULINGinit_max_stack_wsz_SC_CHARCLASS_NAME_MAXEV_EXPLICIT_GC_MINORcaml_domain_dls_compare_and_setcaml_failed_assert__atomic_load_tmpextra_heap_resourcescaml_modifyminor_heap_max_bszcondcaml_domain_dls_setbackup_thread_msgcaml_minor_collections_countcaml_empty_minor_heap_no_major_slice_from_stwdom1dependent_allocatedsigset_tcaml_extern_stateyoung_ptrfind_active_domainmemory_order_seq_cstintern_statesensefree_domain_ml_values_SC_DEVICE_SPECIFIC_RPhase_sweep_maincaml_mem_unmapcallbackminor_heap_wsz_SC_PIPEterminatingcaml_reset_domain_lockcaml__noallocdomainsglobal_barrier_flip_SC_PHYS_PAGEScyclerunning_finalisation_functioncaml__roots_resstw_request_SC_ATEXIT_MAXcaml_exception_context_SC_SHRT_MAXEV_MINOR_LOCAL_ROOTS_PROMOTE_SC_FIFOcaml_poll_gc_workcaml_minor_heap_max_wsz_SC_USER_GROUPScaml_reallocate_minor_heap_arenalong intuintnat_SC_TRACEpthread_mutex_unlock_SC_XBS5_ILP32_OFF32caml_bt_exit_ocamlcaml_domain_alonelimit_SC_2_PBS_MESSAGEcaml_domain_is_terminatingcaml_record_backtracesEV_EXPLICIT_GC_SETephe_SC_XOPEN_REALTIME_THREADSEV_MINOR_CLEARcpusetEV_MINOR_LEAVE_BARRIER_SC_SPIN_LOCKScaml_init_domain_selfcaml_orphan_shared_heap_SC_SPORADIC_SERVERcaml_ref_tablelastintptr_t_SC_PRIORITIZED_IOuint32_tcheck_errinterruptor__pid_t_SC_GETPW_R_SIZE_MAXextern_state_SC_XOPEN_VERSIONuintptr_t_SC_2_C_VERSIONis_exceptionsection_table_sizelong doubledomain_minor_heap_reservationreserve_SC_LEVEL4_CACHE_LINESIZEPTHREAD_MUTEX_RECURSIVEcaml_atfork_hook_SC_NL_TEXTMAXunreserve_minor_heaps_reservation_from_stw_singlelong unsigned intcaml_plat_fatal_error_SC_LOGIN_NAME_MAX_SC_XBS5_LP64_OFF64_SC_SPAWNcheck_minor_heapcaml_ml_domain_id_SC_PII_OSI_Mevent_trace_SC_2_PBScaml_mem_decommitinit_percent_free_SC_XBS5_LPBIG_OFFBIGcaml__max_spins_1504_SC_WORD_BITbacktrace_slotEV_EXPLICIT_GC_COMPACTcaml_plat_unlockchar_SC_2_PBS_ACCOUNTING__sched_cpucountcaml_orphan_ephemerons_SC_BARRIERStodopfinal_todo_SC_AIO_MAXmax_domains_SC_2_CHAR_TERMsync__spins_SC_LEVEL1_ICACHE_LINESIZEtablecaml_plat_mutex__nusers_SC_XOPEN_SHM_SC_XOPEN_ENH_I18N_SC_THREAD_KEYS_MAXDom_failedcaml_stat_calloc_noexcreserve_minor_heaps_reservation_from_stw_singleEV_MAJOR_MARK_ROOTShandle_effectstw_global_major_sliceinit_major_gc_failure_SC_ULONG_MAX_SC_TYPED_MEMORY_OBJECTS_SC_TIMEOUTScaml_plat_assert_all_locks_unlockedcpu_relaxfinal_SC_XOPEN_UNIX_SC_SIGSTKSZslice_targetcaml_ml_domain_index_SC_LEVEL2_CACHE_LINESIZEcaml_init_signal_stack__highself_SC_THREAD_STACK_MINsigfillsetcaml_try_run_on_all_domains_with_spin_workcaml_domain_external_interrupt_hookcaml_handle_gc_interruptshared_heapc_stack_linkEV_FINALISE_UPDATE_LAST_SC_NL_MSGMAX__lowglobal_barrier_wait_SC_SHRT_MIN_SC_THREAD_ROBUST_PRIO_PROTECT_SC_LEVEL2_CACHE_SIZEdomain_condDom_startedsizedom_st_SC_XOPEN_CRYPT_SC_BC_DIM_MAX_SC_LEVEL1_DCACHE_SIZEunrooted_callback_SC_LEVEL1_DCACHE_ASSOCcaml_fatal_errorterm_sync_SC_AIO_PRIO_DELTA_MAXcaml_release_domain_lockEV_STW_LEADERcaml_plat_barrier_releasecaml_acquire_domain_lock_SC_XOPEN_REALTIMEint64_tstw_domainscaml__alone_723caml_ml_condition_broadcast_SC_INT_MAXmlsize_tcaml_send_interruptintnatEV_MAJOR_MEMPROF_CLEAN_SC_TRACE_LOGdomaindoublemajor_work_done_between_slicescaml_plat_latch_is_releasedcaml__spins_1504handle_exncaml_memprof_set_triggeram_last__g_signals_SC_OPEN_MAXis_alonelongjmp_bufferDomain_state_num_fieldscaml_adopt_all_orphan_heaps_SC_UIO_MAXIOVPhase_sweep_and_mark_main__uint32_tbackup_threadcaml__max_spins_1577datacaml_alloc_minor_tables__wrefscaml_init_signal_handlingcaml_debugger_in_useitemhandledinterruptor_set_handledidx1caml_domain_initialize_hookbacktrace_buffer_SC_CHAR_MAXhandle_valueEV_COMPACT_EVACUATEold_mask_SC_PII_XTIbasesysconf_SC_PII_OSI_COTScurrent_sensecaml_recommended_domain_countcaml__max_spins_1590_SC_PII_SOCKET_SC_V6_LPBIG_OFFBIG_SC_MQ_PRIO_MAXcursordecrement_stw_domains_still_processingcaml_alloc_main_stackcaml_stop_all_domainspthread_mutex_trylockenter_spin_data_SC_TRACE_EVENT_FILTERpark_next_stopped_domain_SC_THREAD_CPUTIMEtrap_barrier_offtargetpthread_sigmaskbacktrace_last_exn_SC_C_LANG_SUPPORT_Rlong long unsigned intparentoffset__value32_SC_NL_ARGMAXhandle_incomingPTHREAD_MUTEX_RECURSIVE_NPdomain_terminatingstack_wsize__atomic_store_ptr_SC_PII_SC_MAPPED_FILEScaml_ephe_info_SC_LEVEL4_CACHE_SIZEbt_running__listcaml_gc_policy_SC_2_FORT_DEVcaml__framedomain_ml_valuesgetpidhandler_SC_2_LOCALEDEFcaml_init_major_gc_SC_LEVEL1_ICACHE_SIZEslice_budgetcaml_free_signal_stackcurrent_ramp_up_allocated_words_diffaction_SC_TRACE_USER_EVENT_MAXsync_mutex_SC_CHAR_BITml_valuesPTHREAD_MUTEX_ERRORCHECKcaml_plat_barrier_sense_has_flippedcaml_plat_broadcastupdated_firstcaml_register_generational_global_rootpthread_attr_tcaml_domain_external_interrupt_hook_defaultprevarrivedGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tables__thread2caml_set_action_pendingmust_sweep_epheminor_wsz_data_SC_INT_MINatomic_uintnatcaml_update_minor_heap_max_SC_PII_INTERNET_STREAMcaml__spins_1577allocate_minor_heap_arena_failure__wseq_SC_THREAD_ATTR_STACKSIZEPTHREAD_MUTEX_TIMED_NP_SC_SIGQUEUE_MAXEV_MAJOR_MARK_SC_FD_MGMT_SC_SYNCHRONIZED_IO_SC_V7_ILP32_OFF32domain_lockextra_params_areacaml_stat_block_SC_EXPR_NEST_MAX_SC_LEVEL3_CACHE_LINESIZElong long intcaml_init_shared_heapcaml_timing_hookprev_has_interrupt_word_SC_MESSAGE_PASSINGEV_MINOR_REMEMBERED_SET__pthread_cond_scaml_free_intern_state_SC_REGEX_VERSIONbackup_thread_funcmark_stackalloc_main_stack_failure_SC_FILE_LOCKINGpthread_joinheaps_base_SC_AVPHYS_PAGESephe_ref_SC_MB_LEN_MAXcaml_plat_barrier_reset_SC_PII_OSI_SC_ARG_MAXcaml_plat_barrier_flipdomains_exitingEV_FORK_CHILD_SC_MEMLOCK_RANGEcaml_gc_phase_SC_SHARED_MEMORY_OBJECTS_SC_CHAR_MINEV_MINOR_MEMPROF_CLEANEV_MAJOR_GC_CYCLE_DOMAINSEV_DOMAIN_SPAWNdomain_idEV_EXPLICIT_GC_MAJOR_SLICE_SC_XOPEN_LEGACY_SC_2_PBS_TRACKyoung__data_SC_THREAD_PRIO_INHERITparser_tracetodo_head_SC_LEVEL3_CACHE_ASSOCstack_cache_SC_NPROCESSORS_ONLNEV_EXPLICIT_GC_STATcaml_plat_latch_set_SC_HOST_NAME_MAXinterrupt_pendingcaml_ev_begin_SC_COLL_WEIGHTS_MAX_SC_MONOTONIC_CLOCKcaml_plat_barrierPTHREAD_MUTEX_ADAPTIVE_NPcaml_custom_tablecaml__roots_callback_SC_CLK_TCKcaml_interrupt_selfstack_infocaml_plat_barrier_wait_sensetag_tstw_handlerstat_promoted_wordsinit_shared_heap_failure_SC_NL_SETMAXunsigned intcaml_free_gc_regs_bucketsEV_MAJOR_EPHE_MARKcaml_plat_lock_blockinggc_regsrequested_minor_gcexception_ptrstat_major_words_SC_V6_ILP32_OFFBIGcaml_free_extern_stateshort intnum_participating__jmp_buf_SC_IPV6swept_wordsstat_minor_wordsgc_phase_tactive_domains_SC_REGEXPpthread_detachmarking_and_sweeping_donecaml_try_run_on_all_domains_async__atomic_wide_countercaml_domain_stop_defaultyoung_triggerEV_MAJOR_SWEEPcaml_norm_minor_heap_sizedomain_statusglobal_barrier_is_nthGCC: (Debian 13.2.0-18) 13.2.0zRxA ,0@B AGA~u FAD (tE ACA~V DAB ,DG BA A AAAA~@C AFA~TXDDACA~A^DAH0BI AD A ABCA~pABACA AFA~EADA~`t<<G ACA~UBiAACAAA~\0B AEFA~@ FAA FA~V GAA < ,BCK BB A AABBA~^ AACAA `4,tC ADA~^ GAA DDpA~FCA TFA~HCA8$CP ED A AFA~FAE AGA~FCAG $hDA~LFA HdDA~KFATlLCBd AB A ABA~DBACA ABA~DBACA AFA~DALCCS CD V CC A ACA~DAE AFA~DAB AFA~DA@GpA~CBA4HtPpA~CDAhxPpA~DFA(TC ACA~d DAB 0G ACA~ GAC $<B ACA~BDAx$C ADJA~FZACAIIAAFAA~FUAC AB LJBA C ACDA~RAC AJ A ANAAAAGAA A~VW| A D K MMH [ H AAH A _C CC A CC CC A B AAAl|E AEA~]ACACfAAAAO DAD J ABAAB B ABAAB B ABAAB BABAA$@ EA~Png EAA W EAD IcLAO4PBI AACA~xAAABAA~ | CBM AABACBAFA~jAAAAAAACDCA~] H UAY AB A EC A G A CJA~PB BIAAAABAKAB A~AAAI b AAABA eDB,,,C ABIA~o EAB <GA~YCACeLi` AAAAADAB IAAAAADABA~KAJBABAAABCCBABAABB$ CpA~L BAC LBA, ApL ADA~HAA B A AFA~EA 4 $TFA~EEAA HX \FA~M GAA  ^pA~CBA KpA~K BAA 4 ApQ B A AAA~HAAApA ABA~JA (  hH A FA~F`BB A CACCA A CACjGAAFB A~FaAAAAAAAAAAAALGAAFA A~F[AAAAA A A A AAAAA @C ADA~FzABAsAAACAFAAA~LAFAAA~`CABABCBAAABDBAA( E ADA~e DAA L DADE AAABAFA~d AABAAABC DAAD lHEpA~FCA, B ACA~P DAC RDA( DA~M DAC ODA8 C AEA~P FAB I FAA $ (8FA~_ CAD IEA )@0pH `x0<0x CW ,w~ H(   Xx(0 "0:(P0 `l$3IWcx  !584UPihDT$hdL,Im@(@tXxpT/GWp<'=Pw%@Wn|$0   5 ` |`  , ,   < 2 B P ] l  84 PT hX    3 F( ^ y h        % < S o       # H Z g z    @ XD pH5I]}  8 5 K g| domain.ccaml_domain_initialize_defaultstw_global_major_slicereserve_minor_heaps_reservation_from_stw_singleterminate_backup_threadstw_terminate_domainstw_api_barrierfree_minor_heap_arenacaml_domain_external_interrupt_hook_defaultcaml_domain_stop_defaultcheck_stw_domainsinstall_backup_threadbackup_thread_funccaml_atfork_defaultdecrement_stw_domains_still_processingstw_resize_minor_heaps_reservationdomain_createhandle_incomingdomain_thread_funcstw_requestall_domains_lockstw_leaderall_domains_condstw_requests_suspendedrequests_suspended_condnext_domain_unique_iddomains_exitingcaml_paramscaml_mem_round_up_pagescaml_mem_mapcaml_gc_logcaml_failed_assertcaml_fatal_errorpthread_selfcaml_plat_broadcastcaml_plat_signalcaml_lockdepthpthread_mutex_unlockpthread_exitpthread_cancelcaml_plat_fatal_errorcaml_ev_begincaml_ev_endcaml_plat_latch_waitcaml_plat_latch_releasecaml_statecaml_mem_decommitpthread_mutex_locksigfillsetpthread_sigmaskpthread_createcaml_check_errorpthread_detachcaml_plat_mutex_reinitcaml_plat_cond_initcaml_incoming_interrupts_queuedcaml_send_interruptcaml_norm_minor_heap_sizecaml_reset_domain_lockcaml_init_domain_selfcaml_ml_domain_idcaml_noalloc_begincaml_noalloc_endcaml_ml_domain_indexcaml_enter_global_barriercaml_plat_barrier_flipcaml_plat_barrier_wait_sensecaml_global_barrier_and_check_finalcaml_global_barrier_release_as_finalcaml_global_barrier_num_participatingcaml_domain_is_in_stwcaml_interrupt_selfcaml_interrupt_all_signal_safecaml_major_slice_epochcaml_reset_young_limitcaml_set_action_pendingcaml_mem_commitcaml_memprof_set_triggercaml_reallocate_minor_heap_arenacaml_empty_minor_heap_no_major_slice_from_stwcaml_mem_unmapcaml_get_init_stack_wsizecaml_plat_waitcaml_memprof_new_domaincaml_alloc_minor_tablescaml_init_shared_heapcaml_init_major_gccaml_register_generational_global_rootcaml_alloc_stack_cachecaml_alloc_main_stackcaml_remove_generational_global_rootcaml_teardown_major_gccaml_orphan_shared_heapcaml_free_shared_heapcaml_free_minor_tablescaml_memprof_delete_domaincaml_stat_calloc_noexccaml_record_backtracescaml_init_domainscaml_plat_mutex_initcaml_init_signal_handlingcaml_update_young_limit_after_c_callcaml_minor_collections_countcaml_poll_gc_workcaml_alloc_point_herecaml_major_collection_slicecaml_try_run_on_all_domains_with_spin_workcaml_empty_minor_heaps_oncecaml_handle_incoming_interruptspthread_mutex_trylockcaml_try_run_on_all_domainscaml_try_run_on_all_domains_asynccaml_update_minor_heap_maxcaml_debugger_in_usecaml_domain_spawncaml_stat_alloccaml_failwithpthread_joincaml_stat_freecaml_handle_gc_interruptcaml_process_external_interruptcaml_bt_is_in_blocking_sectioncaml_bt_is_selfcaml_domain_is_multicorecaml_acquire_domain_lockcaml_bt_enter_ocamlcaml_release_domain_lockcaml_bt_exit_ocamlcaml_domain_terminatingcaml_domain_is_terminatingcaml_gc_phasecaml_domain_terminatecaml_finish_sweepingcaml_finish_markingcaml_orphan_ephemeronscaml_orphan_finalisersgetpidcaml_ev_lifecyclecaml_finish_major_cyclecaml_free_intern_statecaml_free_extern_statecaml_adopt_all_orphan_heapscaml_finalise_heapcaml_assert_shared_heap_is_emptycaml_free_stackcaml_free_backtrace_buffercaml_free_gc_regs_bucketscaml_plat_assert_all_locks_unlockedcaml_init_signal_stackcaml_modify_generational_global_rootcaml_callback_rescaml_alloc_1caml_ml_mutex_lockcaml_modifycaml_ml_condition_broadcastcaml_mutex_unlockcaml_free_signal_stackcaml_stop_all_domainscaml_free_domainscaml_plat_mutex_freecaml_plat_cond_freecaml_ml_domain_cpu_relaxcaml_domain_dls_setcaml_domain_dls_getcaml_domain_dls_compare_and_setcaml_domain_countcaml_recommended_domain_countmemsetpthread_getaffinity_np__sched_cpucountsysconfcaml_atfork_hookcaml_domain_terminated_hookcaml_domain_external_interrupt_hookcaml_domain_stop_hookcaml_domain_initialize_hookcaml_minor_heaps_endcaml_minor_heaps_startcaml_minor_heap_max_wszcaml_num_domains_running:2J@X3 b@r 2v @4 222@200@5 R2V2^0b0d6 r2v2~006 @207  H F8  9 ,: R2V2^0b0d6  H F8  H;Z;X H;C F<  = 4> > HB FZ20^00`? 20@ 2(0(2X@X2H@HXA B C A *DH.DFf2Pr0Px5 DHDF H2 F05  H H FE V2Z28b0f08l6 zDHDF F2280806  H F2280086 DHDF"2&2.02046 v2xz0x~ 2 @2|0|2x0x20^2b2n0r0t6 22006 "2 &2( .0 20( 46 >2| B0| F2x J0x b2 f2X n0 r0X t6 2 2( 0 0( 6 ;Z ;X ;C < F lG H 2x 0x I 2 0 J H K 2 2 0 0 6 &20 *00 ,? :2 >0 @? j H n F L M H F F ;Z DH ;X DF ;C 2 0 ? 2 20 &0 *00 xF ;Z ;X ;C 2 @ 9 2 0 5 < 2 0 ? "20 &00 (? B H F F F ;Z ;X ;C 9 < :2>0@? N20R00T? 3  H FL M 6 2: @R2V@Z H^DHb FfDF2200006  2 @22@00@6 2@ HDH F"DF`T j Hr FU T  H FU 22X60XR2V2hZ0^0hX Y F2J2hR0V0h\6 2X0X22h00hY 22006 22h00h6 2`"0`,X R2XV@XrDHvDF2280806 DHDFDHDF228"0&0806 BDHFDFr 2v @z2~@2@~2@b  2 @"2&2.02046 B2F2N0R0T6 DHDF H2 F05 ,3 62:@N2xV0x\5 j Hn Fxc  H Fld xa ~DHDF H F5  H F:2>28F0J08L6 b Hf F2280086 22006 22P00P6 22006 22628>0B08D6 NDHRDFb2f28n0r08t6 ~DHDF22(00(6 DHDF28086 DHDF$ < r2~05 f DHDF205  Z 2@ 2@00@5 &2p*0p,5 6 2: @N2Z02@2@2@g 22X0X@5  0A X 205 $ 22006 2280086 DHDF22 006 2"@*26087 xh  H F2200F ;Z2;X;C@ i @ .2 2@ :@ Hi j2 n@ z@ 2 @ 2| 0| 2 @ 0|  !F !;C!B H!FDH!J F!NDF!j !2!0!k "l "$m "8 "Tn "\o "|p "2("@("2(# @(# n #B2x#F0x#R2|#V0|#2#@$2x$0x$>2x$B0x$D $P;C$V2p$Z0p$\5 $t< $q $ $r $s $t $u %v %;C%0< %B H%J F%n2x%r0x%v2|%z0|%2%@&2|& 0|&0|&0 &t9 &w &2&2 &0&0 &6 &2&2(&0&0(&6 '2' 2'0'0'6 '&2'*2('.0'20('@6 'N2'R2 'Z0'^0 '`6 'n2'r2'z0'~0'6 '2'2@'0'0@'6 '2'2('0'0('6 '2`'0`'7 'x '2(2((0( 0((6 (22(62((:0(>0((L6 (^2(f0(h? (v20(00(? (20(00(? (2(0(? (20) @0)2 )@ )w )2)&@)4w )>2p)F@p)Tw )^2)f@)l 0)2)0)z )M *z * M *L *R H*V F*t{ *2*2 *0*0 *6 *2*0*7 *2 *0 +7 + 2+0+$7 +.2+:0+H7 + +DH+DF, 2, @,& 2,* @,_ ,@ , ,A - 2-0-$ -La -^ 2-b @-a - - 2- @. 2. @.x_ . 2. @.2.28.0.08.6 .DH.DF.2.2 .0/0 /6 /2/2 H/0/"0 H/$6 /22/62 />0/B0 /D6 / H/ F/@ /2 /0 /DH/DF0280 @802X02p0@p02@0@@0&@X0FDH0JDF0`  0hA 0p~ 0 x0DH0DF020280000806 0DH0DF020280000806 0DH1DF1212 101"0 1$6 1B H1F F1P H1jDH1n H1vDF1z F1;Z1;X1212 1;C1010 2F 2`< 2F 3,6 3L 3j;Z3n H3r;X3v F3x;C3 H3< 3 H3 F3i 4i 46204:004<? 4J24V04X? 4f2 4j0 4l? 4 H4 F42 (40 (424045 424@5 5J;Z5N;X5P;C5 H5 F5@ 52 @50 @55 6;Z6";X6& 26* @6.2x620x6F26J@62x60x6O 6;C7< 7&2X7*2p7.@p7:@X7`  7hA 7 H7 F7 H7272 7080 86 84 x8<;C8P< 8b H8f F8p H8i 828082 80 86 8282 P8080 P86 828092 P90 P96 9*2 960 9<? 9J209N009P? 9^209f009h? 9 9 9292 9@:0 : 2:0:5 :"@:&2:*0:X :jDH:nDF: H:2: F:0:5 : H: F;2;28;&0;*08;,6 ;B2;F28;N0;R08;T6 ;^DH;bDF;2;2;0;0;6 ;DH;DF<20<@0<" 2<& @b H>f F>l >2>28>0>08>6 >DH>DF>20>00>? >2>0?? ? 2 ?0 ?( ?62?>0?@? ?J2 0?V0 0?d7 ? ?q ?q ? ?2 ?0 ? ?2?2 ?0?0 ?6 ? @ H@ F@4~ @D@ @N H@R F@\ H@dA @x~ @DH@DF@(2@(@A2A 28A0A08A6 A*DHA2DFAR HAV FA HA FA8 A2 A@ B HB FBZ HB^ FBpF B;ZBDHB;XBDFB;CB2B0B? B HB FB2 C@ C>2CB2 CJ0CN0 CX6 C;ZC HC;XC;CC FCDHCDFC< C20C00C? D HD FD22 D6@ Dx: D2D2 D0D0 D6 D2D@E HE FE> HEN FEV2 EZ0 Et5 E(2E(@E28E@8E E E;ZE2 E;XF2F HF2F2 8F2F. FF20F<;CFB0FJ 2 FN @ FZ0F^0 8Fb0 F< F F F F F Fs G6 G(F Gn 2Gr @H H HF H9 H< H H I I I 2 I @ I*2I.2 I60I:0 I<6 IV;ZIX If;XIh Ip I Iv Iq Iq I I I I Ir I I Is J Jt J u J8 JD;CJH JT J^ HJb FJh HJr HJv FJ< J J6 J Kv K q Kq K$ K0 K8 K@ KHr K2 K0 K2K2(K0K0(K6 K2`K0`K7 L2L2(L0L"0(L$6 L62L:0L<? L~20L00L? L L 2L @L L HL FM8 MF M. HM2;ZM6 FM:;XM<;CMl;CMt9 M< M HM FM M2 M0 M HM FM5 M N N (2N(@N4 NH NZDHN^DFN N NDHNDFO O0 O@ O\ Od Opq O|q O O O2 O0 O5 O P"2P&2 P.0P20 P46 PB2PF28PN0PR08PT6 P^DHPbDFPr2Pv28P~0P08P6 PDHPDFP20P00P? P2 `P0 `P7 P2P0Q ? Q220Q62`Q:0`QF@0QL8 Qx Q HQ FQ HQ;ZQ;XQ HQ;CQ FQ< Q Q20Q00Q? R 2R @RB2RZ0R R R S$ Sf HSj FS| HST SDHSDFS SU T"2T&28T.0T208T46 TBDHTFDFTP T\U TT TDHTDFTU T2T28T0U08U6 UDHUDFU U UpT UzDHUDFUU U UU V2V28V08V"0V$6 V.DHV2DFVR2 VV@ V V8 V V V 2V @W$ &3& 30&083H&P3`&h3x&3& 3&P3&`3&p3& 3& `3 & (38& @@3P& X3h&pp3&3& 3&P3&3&03&3&3(&P03@&pH3X&`3p&px3& 3&3&3&P3&P3&(3&+` 30&+83H&/`P3`&1@h3x&1`3&43&93&93&93&;3&?3 &@(38&AP@3P&AX3h&Ap3&BP3&B3&C3&D3&D3&E3&E03(&L03@&Q H3X&R`3p&S`x3&S3&T3&UP3&VP3&Vp32&`&}&& &&&&&* /5/ />&*.1/%6/FD/(R/8Y/'`/ g/!n/<^u/!|/=/0X/I/'/)/./'c/'G/'///%/9p!/O'/;-/ 23//9/b?/E/,K/Q/tW/ ]/zc/qi/'Po/7u/ {/3/S/9//8]//9//*A/.+//E/1/ /"3////7d/a//-//" /;M//7/#/)/"}// !5/ ;/ kA/4G/M/WS/4MY/3_/1he/1k/q/9dw/}//0///6//1/!/)*//o/;//'/(/E/ /*/,i//`/73/"K/:/M //?/:/$%/9#+/%1/7/'=/C/+I/-O/*U/*[/*Ya/'g/im/'s/6y/E/4/11/9/./6//)/9=/ K/ //}/%@/-J/U/1/+//3H/ /-"//)/:o// 5/!;/ /A/6G/<M/S/1Y/;_/%e/2k/q//6w/4p}/ /*v/-/-//-v/z/,,//:/7/3/ /(*/=;//7/R//9/ ///V /4// J/-W%/+/+2/G/e//-0/,]/6/3>/3/=//// // !/Y./;/*H/U/*nb/!Jo/3}/8/7,//*/!/'/0////5/I/.8/5Q/:]/Ii/./i/:/I/./R/=1 / / D 0/ ;/ I/ W/c r/7M x/3f ~/ /; / /(D /5 /  / /# / /M / /y / / /# / /6 / /84 )/ 5/ L/) Y/4 f/g w/. /< /7 / /# / / /> /! /x /_ +/ B 9/: G/ U/< c/ q/8 / / /!T /6 /  /!2 /4 /=D / / /] /Z '/ 5/! C/5 Q/1 _/2 m/ {/ /9 /e /< / /: /$f /, /: / /" / /h %/# 1/, =/4 I//R U/' a/# m/=P y/<# /< / S /a / / G /2 /a / / / //;(/<5/4EB/O/-\/{/,/M/5///94//8/ //]$/e1/ D/3Q/ 4^/4k/6x/$/2///5c/'B/ /://$// $//K)/#3/=/%)W/]d/w/O/V/////3/'/0/$=/0>/b/ /=a/9#///;/#MG/S/'3`/1tz//&8/-/("//&/37/t/U/1t/7/&8D/-Q/("d/q//;/1t//&8/-/("/(\/1/+/,7/%C/O/]/ d/i/7/0/s// =/4//9/:)///&/:/"//"/) //>/+7/ 9"/7u(/./4/:/9@/F/:CL/DR/- X/y^/<d/j/p/:v/ |/i/ ///&///&/3/ /.[//// /8q/ /%M/ ///1K/ / /P //-0/"@=//\/i/1>v///+K/30/+/37/'/*/: /-/*6,/9/-F/0h/*t/ O///g/_/!//;v/w/5/;v/ /!/ /./;/SH/'U/ b/:o/T|/,/l/)`// ]/ }//"j/O/4/ /)8/*M0/F/4e/*0r/$/'v/&//#"/a/$~/:/;-/a/ '/'v4/0cA/#;N/7[/-h/u///a/ N/ -/ t/$]/0//2v/*/ */u/%& /&/ w&/D&/p&/(&/&/9&0%&8/=lF/T/$h/.u&xDN&&&/ z&(/>7/</-/*/4-/$]/.!,/r:/30H/fV/5d/r/:&&&&&/1y/)/9/K/>]/ o/c/+/ D/,F P/9 k/n x/= /# / /! /!/!d!-/-!?/ U!Q/'!c/ !k/!!~/&k!/24!/ !/5q!/4]!/8!/0!/5" /"!/I"./0"6/"H/*"c/!"u/"/ P"/$N"/."/#j"//#/#/)N#4/#K/%#b/(#x/#/h#/5O#/#/1#/#/;?$/"$!/1$,&Vp$C/$N+$R+ $`+4$d+&$i/&$y&V$&V$&V$&V$&W,$/%&VP%/%'+|%++x%0&VP%A/%N&%X/"%c+%g+%n/"%y&UP%+%+%+%+%/$%/" %+6%+0%&Ux%&U&&U&&U&0&V,&A&8&N&&`/&k&T&/&+X&+T&/$&&T&&T&&U &&8&&&&U('/#''&S'=+x'A+n'F/$'U&S'b&S'z&T'&T<'&8'&'&TX'&Td'/5'&S`(+(!+(&/,d(1+(5+(>&S`(H- .(U+(Y+(b&S(l&S(&S(/(&R(/(+(+(- (+5(+'(- (+}(+y(&R)- )&R)- ).+)2+);- )D+)H+)Q+)U+)\&R)t&R)&R)&S,)/2J)&Q )/)- )/3*&0*/u*!&Q`*+&Q`*H+*L+*U+*Y+*b+*f+*k&Q|*&Q*- *+*+*&Q*- *+*+ *+%*+!*&R+&0+&Q+!&QT+.&Q+;&Q+N/+U&+l//D+w+N+{+J+/0++d++`+/ ++z++v+/+++++&<+/3+++++/u+++++&,&,!&,3&,=-B,N+,R+,[&,e-W,v+,z+,+,+,&h,&0,&,&,&(,&<,/-&E0-/'B-"+2-&+(-+/I-6+l-:+f-H+-L+-Q/ -\+-`+-i&E-s&E-+-+-+&-+$-&E-&-+2-+0-&G$-- -+>-+<.&G8.-..!+S.%+Q..+_.2+].8&G0.Q&GP.[-=.l&GP.v-Z.+t.+r.-w.+.+.+.+.&Fp.&Fp.+.+.&F.&F/+/+/+/"+/(&F/A&F/K&F/h+/l+/v&F/&F/+/+/&G|/-/+/+/-/+-/+'/&G|/-0+U0+Q0 -0+l0+h0+0#+0,&G|06-0C+0G+0P+0T+0]+R0a+N0j&G|0t-0+i0+g0&G0-0+~0+t0&K0- 0+0+0&K0&(0&1&L,1&(1,&1C- 1P+ 1T+1Z&L1k&`1|&H41- .1+>1+<1+J1+H1- .1+V1+T1+b1+`1&H\1- =1+p1+l1+1+2- =2 +2+2+2+2$&H27&H2A- L2R+2V+2_&H2i- b2z+2~+2+2+2&LD2&2&H2&H2&H2&H2&H3+3+3%+3)+3/&H3H&J3R- q3c+ 3g+ 3p&J3z- 3+ .3+ *3+ E3+ A3&L3&03&J3&E|3& 3&E3&E4&F4&F4&F4+&F4C&F4[&F4h&G$4&H4&H4&H4&H4&I 4&I4&ID5& 5&5-&I`5E&Ip5]&Ix5j&I5&I5&I5&I5&I5&I5&I5&I5&I6 &I6&I6&&I63&J 6@&J6M&J(6Z&J@6g&JP6t&J\6&Jl6&J6&J6&J6&K6&K6&K 7&K,7$&K871&K@7>&KH7K&KP7Y/=7k/I7y/&P7&E7&E7&E7+ l7+ j7/`7&D7/-7+ 7+ 8&D8-8+ 8"+ 8)/38G/8N& `8i& `8s-Y8-Y8+ 8+ 8& 8& 8& 8-i8-i8+ 8+ 8& 8-y9+ 9 + 9& 9-9.+ 92+ 9;+ !9?+ 9D& 9U&9`& 9y/&9&D9/,d9+ H9+ B9/39+ j9+ d9-9/39+ 9+ 9/u9+ 9+ 9&D 9&D :+ : + :)&D :>+ :B+ :K+ :O+ :Z&D0:d&D0:&D0:&:+ :+ :&D:&D:& :&:/.B:&C; /,d;+ ;+ ;$&C;.-;;+ 1;?+ -;H&C;R-;c+ I;g+ G;r&0;|&C;&0;&C;/S;&B;/,d;+ W;+ S;/3;+ w;+ s;&C </3< + <+ </u/*>&AP>*/f>5+ q>9+ o>>&AP>O/>Z+ }>^+ {>c/">n+ >r+ >y/>&@>-h>/>+ >+ >/">+ >+ >&A$>&8>&>/,>&??&@? &@?=&@?G&@?`+ ?d+ ?m&@?+ ?+ ?+ ?+ ?&@L?&@L?&@`?&@?&@8?&@L@&@l@&@|@&/%s@-&+@M+ @Q+ @V-&@_/@l/"@w+ w@{+ s@&,@-@-@+ @+ @&,@+ @+ @&,$A+ A+ A&,HA-+ A1+ A:+ A>+ AG&,HAa+ Ae+ Ap&,pA+ A+ A&,A&/ A& A&A&-A&-B+ B+ B+ B+ B+ B+ B$&-(B;&Bb&-Bl-1B}+B+B-1B+9B+5B&-B+LB+HB&.B+_B+[B&.4C+tC+nC+C#+C,&.4CF+CJ+CU&.\Cs+Cw+C}&.|C&/LC& C&C&+C&,C&,C&,D&-PD&-D(&-D5&.DJ&8DW&Dh&/,Dy& HD&D/+YD&D//DD/D/ D/D/ iE/E/E'/"E:/EG/"EZ/ Eg/Et/E/E/"E/E/"E/E&+`E/-E&+lE&+lF+F+F&+lF0+F4+FA/FH& F_/-Fj+Fn+Fs/F~+"F+F+5F+1F&dF/ F+~F+xF/F+F+F/F&F/G/"G+G+G&xG)-G:+G>+GG-GP+GT+G]+Ga+Gl&Gv&G+ G+ G&G+G+G+!G+G&G&<G&H&H&\H)&H6&HH/HO&pHf&pH+-H++H-H/&H+9H+5H-H/H+LH+HH/"H+cH+_H&H-H+vH+rH-I+I+I-I+I+I.- I7+I;+ID+IH+IX/;I_&Iz&I-I+I+I-I+I+I+I+I&8I&8I&I/=J/4EJ/0J/JB/ ^JT/4EJa/0Jn/J|/,J&4J/*iJ+J+J/4EJ+sJ+kJ/0J+J+J/J+J+J/J+J+K/2vK +K+ K+KK#+3K(/IK3+K7+K<//KG+KK+KP/ qK[+K_+Kd-Km/Kz&K/"K+K+K&5`K/K+ K+K/"K+@K+:K-8K/3K+^K+VK/uK+L+L -CL/3L+L!+L&/uL1+L5+L;-NLD/LO+4LS+*LX&8Lm& L~&8L& PL&L&9L& PL-YL+_L+[L&6M&6M"+pM&+nM/&6MD+|MH+zMQ+MU+M\&6Mt&8 M& M&M&5 M-M+M+M-M+M+M&58M--M+N+N +N+N&9DN$& N5&5(NO&6NY-dNj+;Nn+7Nw&7N-oN+`N+\N+sN+oN&9XN&0N&7N&7N&7O&7O&8O-zO-+O1+O:&8OD&8Oa+Oe+On&8O+O+O+O+O-O+O+O+O+O&8<O-O+O+O&8XO-P+P +P+2P+.P&9pP.&0P9&8XPR&8`P\-Pi&8tPw&4P& (P&5P&5P& @P&6P&7XQ&7dQ&7pQ,&88QD&8Q`/Qk&pQ&Q&8Q&Q/<Q//DQ/Q&Q//DQ+eQ+SR&R-gR +R$+R.&R8-rRI+RM+RR-rR[+R_+Rm&R& R-}R&4R&4R+R+R&4R&4R+ R+ S&4S+S+S(+4S,+0S9&SC-ST+GSX+CSa&Sk-Sx+lS|+hS-S+S+S&S-S&S&S+S+S&T&T &T'+T++T0&TE&T]&`Tu&T/xT//DT/T/1T/6T/0qT/2 T//T/3U/uU/)U &PU3/ UK/UV&Um/=Ux+U|+U+3U+'U&U&U&U&U+jU+hU&U&V+}V+{V$+V(+V2&V<-VM+VQ+VZ+V^+Vc-V{&DV-V&4V-V+V+V+V+V&4V+V+V+V+V&pW-W+W+W+W+W$-W8&WI&WY&Wn&W{&W&W&hW&W/W&0W/=W+W+W+dW+^X/$ X +X+X&LX"&LX?&LXI&LXb+Xf+Xq&|X{-LX+X+X+X+X&X-WX+X+X+X+X-WX&X-gY&Y-rY!+Y%+Y.+Y2+Y;&YP+#YT+!Y]+6Ya+4Yl&Yv-\Y+@Y+>Y+JY+HY-\Y&$Y&Y&Y-}Y+TY+RY&Z&Z&dZ%&hZ2&ZD/-6ZR/$ Z_/=Zl/Zy//Z/)Z/$Z/$ Z/ Z/>EZ/,Z&[ /[+`[+\[/$[,&[9&[N/)[Y&P[p/[{+v[+r[/$[&h[&[/ [&;[/$][+[+[/.![+[+[/\ +\+\/4!\+\"+\'/;\7/ \B+D\F+@\s+W\w+U\|/'v\+m\+_\-\/\+\+\/"\+\+\-]\/! \+\+\&_&0_&=_&>_&>`+`+`!&>`6+`:+`C+`G+`R&?`\&?`y+`}+`&?`&?`&?`&a&>pa&>a&8a&a&?0a& a&?la& 0a&?b&?b)& b3&?bD& bQ&bh/ bt&Lb+b+b+b+b/5b+Cb+=b/Tb+kb+_b- b/-b+b+b+c+c+c+c &NTc*- 'c;+c?+cD- .cM+cQ+cZ+c^+cy+(c}+"c&Nc+Mc+Gc&Nc&Nc&P\c&8d &d &Nd*- =d;+pd?+jdH+dL+dQ- ZdZ+d^+dg+dk+d}+d+d+d+d&Od&O8d&OHd&P<d& d&d&Pe &8e&e-&Ole7- ~eH+ eL+ eQ&Oxei&Oe&Oe&Me&Me& e&Me&Ne&N<f&NPf&&O`f=&OlfV&Mf`- fq+ fu+ f~&M$f- f+ 1f+ -f+ Hf+ Df&Qf&f&M$f&Mf- f+ qf+ mg&Mg- g + g$+ g-+ g1+ g6&PgG&0gR&Mg`&Lgm&Lgz&M g&M|g&Og&Og& g&Og&Pg& `h/Mh/.!h,/h9/4!hF/hS/dh`/ hn/ h/h/h/4!h/$h/{h/! h/5h/=h/dh/h&i+ i"+ i'-7i0/3i;+ i?+ iD/uiO+ iS+ i]&ig-'it&i&i&i+!i+!i&i+!i+!i+!i+!i&(j&4j&lj*&j7&jI/jP& jq+!1ju+!'j+!]j+![j/j/1_j-Nj/3j/uj+!gj+!ej& j-j+!tj+!pk& k--k +!k$+!k-+!k1+!k6& 4kG&0kR& kk& ku& k& k-8k& k-Ck+!k+!k+!k+!k& Hk&k& l& 0l& 0l>& 0lX+!l\+!lg& Hlq& Hl+"l+"l& Hl+"l+"l& tl& l& m&xm,& mA&mK& mm& mz& m&m&m/8m&1`m+"+m+"#m+"Sm+"Km+"n+"sn+"n+"n&1n,/n7+"n;+"n@/"nK+#(nO+#&nU&28nj/nu+#4ny+#0n~/"n+#Gn+#Cn&2n/n+#Zn+#Vn/"n+#mn+#in&2pn/n+#n+#|n/"o+#o +#o-o/3o#+#o'+#o,/uo7+#o;+#oE&2oO-ro`+#od+#om&2ow-o+#o+#o+#o+#o&4`o&o&2o&1o&1o&1p&1p+#p!+#p*&1p?+$pC+$pL+$pP+$p\&2pf&2p+$.p+$,p&2$p&2$p+$8p+$6p+$Bp+$@p&2$p&2Pp-q&2hq-q"+$Wq&+$Sq/+$jq3+$fq8&4DqI&0qT&2hqf&3qp&3q&34q-q&3Hq-q+$q+$q-q+$q+$q&3dq-q+$r+$r +$r+$r&4tr%& r0&3TrJ&3rT-ra&3rs&3r}&3r+% r+%r&3r&3r+%r+%r+%)r+%'r&3r&3s&3s%&3s/&3sH+%<sL+%:sU&3sj+%Ssn+%Qsw+%ks{+%is&34s&3s&4s/$s/5s/t /5t/$]t'/.!t5/&t<& tS/:9t^+%tb+%stg&t|&0t&t&t&@t&t/nt&(t/*Mt+%t+%t/$fu+%u +%u-u/3u&&0u0/uu=&) uR/3u_&ui/uuv&)pu+& u+&u-u+&3u+&1u&)u&)u&*v&*v&)v6&)<vS&)\vp&)pv}&*Pv&*|v&*v& v&v&*v&v&+w& w&+,w-&w7&+PwH&wS/$w_/,dwm/wt&Pw/mw+&Sw+&;w/30w+&w+&w+'Ew+'3w/Iw+'w+'w+'w+'w/3w+(w+( w/ x +(<x+(8x/@x&$Px"/x(&%lx1/x7&%x@/GxF&%xO/<7xU&$x^/+pxd&$xm/7 xs&$x|/mx&$x/8x&$x/x&$Px& Px/x+(Qx+(Mx/"x+(tx+(rx-x/x+(x+(|y/"y+(y+(y&!dy./3y9+(y=+(yB/uyM+)yQ+(y[&ye-yv+)2yz+).y&y-y+)Wy+)Sy+)jy+)fy&(y&y&y& y& z+)z+)z& z+& z5& zR+)zV+)z_& zt+)zx+)z+)z+)z&!z-z+)z+)z&! z-z+)z+)z+)z+)z&(pz&{&! {&!{(&!{E+*{I+* {R&!{g+*{k+*{t+*){x+*%{&"{-{-{+*<{+*8{&#p{-{+*[{+*U{-{+*s{+*q{&#p{- |+*| +*{|- |+*|+*|&+*|*+*|3&#p|=-|J+*|N+*|W+*|[+*|d++|h++|q&#p|{-)|++=|++9|&'|&'|++N|++L|&( |&#|-9}++\} ++V}&'}-I}+++t}/++r}4&'}I&(}V&}g&(T}-T}++}++|}&'}&`}&$}&$}++}++}++}++~++~ ++~++~++~&$H~2&$d~<-_~M++~Q++~Z&$|~d-o~u++~y++~++~++~&(~&0~&$|~&%~-z~+,~+,~&%8~-+,++,'+,>+,:&(*&05&%8N&%lX-i+,gm+,_r-{+,+,&%l-+,+,-+,+,+,+,&%|-+-+-+-5+--+-\+-R &%|-(+-,+-5&&?&&X+-\+-a&&&%-+-+-&'4&'4+-+-&'H- +-+-&&'-8+-<+-E+-I+-N-W+.[+.d+.h+.o&&4~&& & P&!&!&" &",&"</&"\G&"dT&"l&#&$d&p&$&$&$&$&$&%&%&&|.&&L&&a& n&&' &&&'h& &&'&&&'-&@:&K&'_/eq//6&9/+. +.&:@&:@+.;+.9+.F+.D+.P+.N&:\2&:h<-I-R+.gV+.a_&;i&;&;4&8&&:&&;\&8& &;&'&:&: K& \/c&Pz//D+.+.}/6+.+./ +.+./+/+/ /$f+/G+/A/.+/a+/]/.+/+/-O/+/+/#-_,/7+/;+/D&N-_[+0_+/h&$r-o-o+0+0-+01+0+-+0L+0H&&&&4&p&)&:&G&Z&r&$&@&&X&&&&+0]+0[&&*+0k.+0e3&U&j&t&&&&&& &&(&-&8:&K&@\&g/ u//(|/-/+&0/9+0+0/ +0+0/# +0+0- '+0++00-@+0D+0I/(T+1X+1 ]&ln&{&&`&&&&&& &&&/%1&H/ S+1%W+1\&(i&@/&/ +1S+1E/I+1+1&/!+1+1+1+1& +1$+1/&9-$F-$O+1S+1\&f&&&8&&&&&&&8-&7-4H+1L+1Q-4Z+24^+22c&4&|-?-?+2@+2<&8&8&T&8&&&1&>&O&L`&8m&&d&x&&t&|&&P &&|/&8<&M&^&({/ 1& /I+2c+2a-/3+2v+2t/u+2+2~&--+2+2&-'-1&B&8O&b&w&& &8&&<&&&&P& &t"&8/&A/)O/I]/>o/ //& /2+2+2& -+2+2-+2+2 & -$+2(+21& ;-L+3P+3Y+3]+3b&Hs&~& & - +3<+38& -++3O+3K+3b+3^&\&0 & %&/-6@+3D+3I-6R+3V+3_&x+3|+3+3+3-A+3+3+3+3& //!/,d/3V&/`+3+3$/0/+33+3<&/`F-<W+4[+4d-Lm+4q+4z+4'~+4%&/-W+41+4/-W+4;+49+4J+4F&/-b+4_+4[&/&/%+4p)+4n2&/<&/U+4Y+4b&/w+4{+4+4+4&/&0D&0d&0p&0t&0&0&8(&9&0J&8W&i&1,z& &///"///-/3 /u/1/&C/P/"_/3l/u{//C/ /2/E$/01/">/#K/6Y/ x/!/#/!//!/'&p2/8E=+4A+4F-X+4\+4a-f/q+5u+5 z&|&&& &&&|-+58+54 & & -+5Y1+5W6& G&(T&k&u-+5o+5i& & +5+5& <&(&& |&X& /{</ \Q/3]/uk/0/3/u/'//"/)//<+/'l9/4T/5+f/ s/1//"/F/ /.i/ // /9L/ /3#/u2/D/ R/;]/{j/3v/u//q/{//"/+/&&//"/ C/ /1/>/"R/ d/q/6j&& +5+5& p--& p-+5+5 & -'+6++64+6-8+6)=& N&Y& r-+6R+6N+6w+6s& -+6+6& -+6+6+6+6& 0&0& $& =& N&_& @z& @& @+6+6& @+6+6+7+7&p+7$+7+7Y+7W &&:+7c>+7aC&\&v&+7q+7k&-+7+7&4&&1@&1T&90+74+7=+7A+7J+8N+8S&9&9+8%+8+8D+8>+8c+8]&9&A&A$&AA+8~E+8|N+8R+8X&Aj&BP+8+8&Bl-~+8+8&Bx-+8+8+8+8&B&&Bx//$ N N&`.&0@&0 N&0&0&G&h&&&0H&x&x&x&x&x"&x<&x&x&x&x&x&x&|&x& &0 N&0 `&0 v N & (& 8& $ N a N N N N 1 N F N N N N DN *DN :DN JDN ZDN jDN&DN,DNK&l&&&&X&X& &0&e&u&&& N&0&0&0&0&&&& -& B&R&z&0&0& & & &(&&9&0I&0& & & && N& ^& s& & & & & & V&q&`&`&`r&&&`&&`*&`DNDNDN&0&0g&w& N N&0&+&f&0v&0DNDN Q& c& &0 &0!&0!&0!&!&#&# N$ N$I&$q&0$&0$& $& %0&0%D N%[ N(X&(h&(&(&)9&)I&)q&)&)&*&*J&(+&+&+&0, &0,E&0,U&0-&|.W&0&1DN1DN2HDN2XDN2kDN2DN2DN3&3.&3i&03y&04w& 4& 4& 5?&x5N&x5`&x5v&|5&|5&|5&|5&6 &64&6D&6Y&6i&6&6&6&06&06 N7 N9&9&)&&&e& S&p&p0D0x dPx`p  `$ d @x p (PLp08PLplp (PPp(+`+T/`1@1` 4999 ; ? @ AP (A LA `BP B C D D E $E0 DL Q R pS` S T UP(VP<Vp.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.tbss.rodata.cst8.rela.data.rel.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @Wh @ ~&W,W@6W1@p ;2] Oj(J@pxTjZjlj g@` j&|@HCp9!@۸Q90@0Qi =\@@x02>[0ۍ ۰`@82 8dynlink.bd.o/ 0 0 0 644 64088 ` ELF@@|Aa|#x;!|x, @t8!a!Aa|} N `= , @X;H ```= ;| @4]({$x|jH*H`,#A|dxK$`` ? mem@ maxA 8C C endC C ptrC C C(C0 p:6 GA X G ]I S m7 b m 7 ~ n/ 0len1 8 9 : ; "; "A   8  =" =%& ( = *  (+  0,  8-  @/  H0  P1  X2  `3  h4  p6  x7  8  9  :   'z ==( X 8 S> =. 5 . 8 ? .B D E  .  ,  .S)H) &- EH) , H`H)Jbr&,  &;  F  HKK68 B4 H8'RH( , mm  0 m =  2'e =H'e mH +5) b H2m) f HIH) sGjH5 Z L (9!HH(&S 9"H4  +H()5  +1'a HmH U ^ =04 $*resP Hui H v Z  r S1T  S T U $H(1 S #0t1?    TT S1T8- I,    p :S T US 4ST1 S .S1T  `gd g9i i$i~ iH*retj*tbljj*strjj~ jH,o irH jsHkvt v v  r M+ps/+N+++ Iz fd{ Herr{ H | 6len} S  S r Z  LS rqT0EST.ST STU jSISTU,S WSTU joSISTUS 2S`S `S `-S  `S i H  S0   r rT1i H  S0^   r S4T0ST0   S T U iA0a|F 0WiZ HS  S S0T0U00'p"'+ (+ )(6@p9 ST S pA O"B !" """"P"""gS4TUVWSS2TUS SQ#8!#!##'#3MS2TUrkST SS:S TUS 4ST1  *ST BS ZS rS  S T S!qJ6! K GR+.K!/+? +JS+Uh!R+Z ST+dT+e T!S!ST S T SH"S R"/S%O"GT1"dST81"ST  1ST U #"' # # %u8 6 1 6 V #?"6m"L =# %res :%O21# $~ HH;str@~ H  $b$i H  S0$  1$ST8%O$ST$S%ST0% S S T U:{ *2{9 =2|;m~*~  & $p1 $q6 6;st} H H 5 )$i HWP 5'$r  X+'z/+"!+ 'HS3TU'`S S2T'S ST 'S(S3TUV ("ST}(DST0U0 jI(oST2(S(S(S (S(S) S)$S)TS3TUV )sST})S)S )S S *i$i H  *)S,Z*MSTU STH*S H*S 1*ST8j*S ST1 B+A3c +."c6 "cE 3I G+p"I2%resK Y+d%iM H1%iQ H3++Zval81# +#  b[#x,Z!#!##'#3,'S2TTU r,EST S\$I~H} : ; 9 I8 I: ; 9 I !I : ; 9 I 8  :!; 9!I!8 H} H} 4:!;9 IB .?: ; 9 'I< 4:!; 9 IB U$ > 4:!;9 IB41B : ; 9!I : ; 9 I8 :!;9 IB&I!I/ <4:!; 9 I 4: ; 9 I?<4:!;9 I( .?:!;9!'I@z4:!;9 I U!1B":!; 9 I#4: ; 9 I$4:!; 9 IB%4:!; 9 I&.?: ; 9 '<'.?:! ;9 '<().?: ;9 'I<*4:!;9!I+:! ;9 I, :! ;9 I8 -: ; 9 I .4G:!; 9!/10.?:!;9!'@z1 2:!; 9 IB3.: ; 9 'I 47I5 !!: ; 9!6 :!; 9 I87!8.?:!; 9!'<9.?: ; 9! n'I<:.?:!; 9 'I@z;4:!; 9 I<% =$ > > ? : ; 9 @&AGIB> I: ; 9 C : ;9 D5IE  : ; 9 F : ; 9 I 8GI H : ; 9 I 8 I'IJ.?: ; 9 '<K.?: ; 9 'I<L.?: ;9 '<M1RBUX YW N 1UO1RBUX YW P 1UQ1RBX YW R1UX YW S 1T 1U.: ; 9 ' V.?: ; 9 'I W X1RBUX Y W Y Z: ; 9 I[.1@z\.?<n: ; $((S(*S**S**S(*l**)*0))0))o))))S))T))S))T**P**qP''S'(Y((S&&S&'S&&T&'T&'S''o''s''S''o''S&&S&&S$%S%%U%%o%&S%%S%%n%&s&&n%&S%%S%%o&&oS##S##q#0 l  #l#$l#0#$0#0#$003%3%#3%3%#nnkk 3% $ &xxZZ S #o#$o$$S$$o S$$S!!S!!n""S""T""k#$k$$n!!j!"S""n#$n$$j!#0#$0!!S!!T""1""S""Ton##o 2##2ST##on##o 3 S0nnoSoSTkTUnUnos"oks"kkjkSjjooi0SjilSllSloj STlSons"nnTSSS0o0oo S S q#0 j  0 0 S n S l o  n S,S,pop SCTCkT kS mSgSgSg gSii iSniSZzZXZXZfZZZZ ZSf fSe e S eSi S il0nonnn nSiS0 #3% #3% #3%# #3%SssZfSf feSSVSSu0ml S n S T T S o S n S,`    """############# "#$)))*))))**** runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/sys/usr/include/powerpc64-linux-gnu/bits/types/usr/includedynlink.cmlvalues.hstddef.htypes.htypes.hstdint-intn.h__sigset_t.hstruct_timespec.hstruct_stat.hstdint-uintn.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hdynlink.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hprims.hexec.hstartup_aux.hstartup.halloc.hintext.hosdeps.hstring.hsignals.hunistd.hfcntl.hstat.hstdatomic.h   fs >"0.q.!,".p $p  = .B;.7"0!!Y-!!= !KK % & .LJ.   !  .3J =! #+ =!  =! $ !/!!= / r0K0J  . /   # Y.  . 1 Jv..= W== .  (  ! != ? 2.3< . .   K ! !< Y% "%:! J / !  .Y<J.x. .2<..  v v. <E <9=///!. /I!!$>!;#0! /K 0 ! " < ! "- ! /  ! ! ", ")"%K>.<. mt.XX @* $ 2.!  K /J 2t u t  .t  <t  .t  f. >1$!Y,I/,<$  .?-$$= /FX  _  Y !  .! /=! ==/ Y/6K=<( +(<   / $u '!/! K /"<9=/K"2.~<2f. 2 <.2 .2</ </ <  0=*E-*<"  .}<*./ g    =XKJ.  t/;/!)%)< uD=0% #;0:)%).f .-' '  W 0=/!/!. /I!-! / /-/g 0,".0 g-/  <"   ~   +~    Y/ ! < /-  ~ +~   .B0"  L-+ #9 #- $-..! 1 . <K 1- ! /  ! ! 1, "81$<. %-/ 2 . Y 2- ! /  ! ! 2, "92$XLKKM << X K !# K1.> u  / !  <  "J .> g !! /-!   .   "J <?=?$./ 1 .12.< %-/ 2 ...X ,.pX _uX . A%730K/ Y/=/ K!. *%._= / M 1/ ./!.<$. /  /= -!=!-/ .!  0< >/!JK)K,!!) ! <*A.  . vJ.Xcaml_dynlink_add_primitivest_ctimc_stack_linksize_tallocated_words_resumedmark_stackmemory_order_acquirest_blksizest_blocksdependent_sizecaml_ext_table_init__ssize_tldconfnamecaml_stat_strconcatcaml__temp_offsetint32_tbacktrace_slotephe_inforootcaml_allocmemprofpathlookup_primitivelibscaml__roots_vstdlib__gid_tst_mtimexec_trailerextra_heap_resourcesopenconfigcaml_fatal_errorcaml__dummy_listsuffixedshared_heapcaml_heap_statestatcaml_stat_allocrequested_major_slicecaml_ref_tablessize_tepheslice_targetheader_t__dev_tresultcaml_custom_tablecaml_secure_getenvstat_promoted_wordscaml_leave_blocking_sectioncontentscaml_decompose_pathlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_ext_table_addinit_percent_freecaml_intern_statemake_relative_path_absolutevstdlibstat_blocks_markedcaml__roots_reslengthtofreecaml_final_infomemprof_domain_scompare_unorderedcaml_minor_tablesntablescaml_dynlink_lookup_symbolsigned char__blksize_tdllnametrap_sp_offfilenamest_uidcaml_failwithlibrootdependent_allocatedpriminit_custom_major_ratiounsigned charinit_minor_heap_wsz__int128 unsignedbacktrace_last_exnst_rdevcaml_custom_eltcaml__temp_valcaml_statefinal_infocaml_alloc_tuplelibroot_length__syscall_slong_t_Booltablecaml_input_value_from_blockvaluecaml_gc_policycharcaml_search_dll_in_pathcaml_ephe_ref_tablecaml_paramscapacitycaml_names_of_builtin_cprimextra_params__builtin_memcpymemory_order_acq_relmajor_work_done_between_slices__mode_tcaml__dummy_unitextern_state__jmp_buf_tagyoung_startinit_custom_minor_max_bszstrcmpcaml_dlsymstat64caml_stat_stringrealnamecaml_enter_blocking_sectioncaml_alloc_smallsweeping_doneinit_custom_minor_ratiotablesreservetrace_levelcaml_exception_contextcaml_dynlink_parse_ld_confwconfigcaml_search_in_path__blkcnt64_tst_gidlib_pathoo_next_id_localminor_heap_wszcaml_builtin_cprimshared_libs_buffer1shared_libs_buffer2caml__framelong unsigned intsectionst_sizeslice_budgetexn_bucketruntime/dynlink.cnum_sectionslongjmp_buffercaml_seek_optional_section__mask_was_saveduintptr_tsuffix_oscaml_dlopenyoung_endexternal_raisec_stacksigjmp_bufcds_filecaml__dummy_vstdlibcaml_read_section_descriptorssymbcaml_dynlink_get_bytecode_sectionsgc_regs__uint32_tcaml_build_primitive_tableGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_doneopen_shared_libtrap_barrier_blockcaml_dynlink_close_libcaml__roots_listext_tablesection_table_sizecaml_ephe_infomemory_order_consumememory_order_seq_cstdoubleinit_max_stack_wszcaml_dynlink_open_libsectcaml_extern_statecaml_free_shared_libsmemory_order_releaseswept_wordscaml_stat_strduptrailthresholdreadcaml_dynlink_get_current_libscaml__temp_resultunsigned intcaml__roots_blockintptr_tgc_regs_bucketscaml_modify__pad2requested_external_interruptsuffixcurrent_ramp_up_allocated_words_diffcleanup_on_exitoffsetlist__saved_maskblock__jmpbufcaml__roots_retcaml_alloc_2exe_namesec_names__jmp_bufst_nlinkcaml_prim_name_tablenitemscaml_local_roots_ptrallocated_wordscaml_parse_ld_confnextproc_self_exeyoung_limitcaml_read_trailercaml_prim_tablelong double__ino64_thandlest_deventryruntime_events_log_wsizetimespecruntime_warningscaml__dummy_rescaml__dummy_retunique_idallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxednreadcaml_stat_blockldconfsection_descriptormax_domainsallocated_words_suspendedcaml_shared_libs_pathephe_refinside_stw_handlercaml__roots_unit__time_t__atomic_load_ptrcaml_dlclosecaml_failed_assertcaml_copy_stringcaml_runtime_standard_library_effectivechar_os__int128__off64_tc_primitivebacktrace_activestat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policysection_tablenamelocationscaml_gc_messagesymbolname__atomic_load_tmpcurrent_stackatomic_uintnatshort intrequested_global_major_slicetv_nsecreq_prims__glibc_reserved4__glibc_reserved5__glibc_reserved6extra_params_areatag_t__valexn_handlerverify_heapstrlen__int64_textra_heap_resources_minormemcpyyoung_ptrunitst_mode__uid_tasize_tdls_rootmlsize_tstack_infostat_minor_wordscaml_build_primitive_table_builtinuint32_tlockedcaml_stat_freecaml_ext_table_freestdlibshort unsigned intmagicbasemajor_refentriesshared_libsintern_statecaml_dlerrorHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatevent_tracest_inocaml_domain_statestack_cacheopen64__nlink_tminor_tablescaml_ephe_ref_elt__sigset_tclosebacktrace_enabledtv_secmajor_slice_epochst_atimGCC: (Debian 13.2.0-18) 13.2.0zRxA hC ACCFA~ JAD A A] A OAAAA GAA aR 4C AIA~H HAD $xE ADA~LEAPpC ADR A~ F MADFB 88GA~GCCABWAAAAACA$t|F ADA~NCAldC AHA~lAxRAGABA~P[IBCBACBCBA( D AFA~Y EAA 88CpA~DCA(XtDA~J DAB ADAHFpA~DDA00C AFA~VXB EAB      3FYm} %0ANa0xyHp#?Kgny`x|d".@^y8tH0*@@U0dynlink.cshared_libs_buffer1shared_libs_buffer2caml_parse_ld_confcaml_secure_getenvcaml_ext_table_initcaml_stat_allocstrlenmemcpycaml_ext_table_addcaml_ext_table_freecaml_stat_strdupcaml_stat_strconcatstat64open64readcaml_stat_freecaml_fatal_errorcaml_dynlink_parse_ld_confcaml_statecaml_copy_stringcaml_alloc_2caml_failed_assertcaml_search_dll_in_pathcaml_search_in_pathcaml_runtime_standard_library_effectivecaml_names_of_builtin_cprimcaml_builtin_cprimcaml_build_primitive_tablecaml_decompose_pathcaml_gc_messagecaml_enter_blocking_sectioncaml_dlopencaml_leave_blocking_sectionstrcmpcaml_dlsymcaml_dlerrorcaml_build_primitive_table_builtincaml_free_shared_libscaml_dlclosecaml_paramscaml_dynlink_get_bytecode_sectionscaml_alloccaml_input_value_from_blockcaml_modifycaml_read_trailercaml_read_section_descriptorscaml_seek_optional_sectioncaml_failwithcaml_dynlink_open_libcaml_alloc_smallcaml_dynlink_close_libcaml_dynlink_lookup_symbolcaml_dynlink_add_primitivecaml_dynlink_get_current_libscaml_alloc_tuplecaml_shared_libs_pathcaml_prim_name_tablecaml_prim_table*220< R2V0\ x      , x  2 20 0    ( D! X h" x" "  " @" L"    2 0 20  < P l  2P0P#  2(0(# %Z%X%Cx   " & '  " b2f2n0r0t( 20 * " 22>0N2Z0t / 2@  2@ 2@ "2&2*2.22260:0>0B0F0\ p* "  0 " 1 2 3  " "  L X p " "   2 @ 4 .2 2@ L \ h 5 22P :0P <# H T6 f2 j0 l# . 2 @ 2 @ 2 @    r2 v0 2 0 9 %Z %X %C < 2 @ 2p 2x 0p 0x = 44 > 2@0@20& ' $> .220l& ' > 20 2@" 2@" ( D? `@ j2pr0pxA   = > " 2x0xA   ,= @> L" X" d! n2@r0@20> 202200( 20B 20B 2&0(B 22>0@B n2 v0 0  1 2 3 " D 6  B 09 t5 D 2000 >%ZF%XH%Cj2 v@ I 0 20D > 2262>0B0D( &3& 30&83H&P3`& h3x& p3& 3&`3& 3&`3&3&03+&,&-&&0 :&   \%&*160DR Y `vgn vu|R 6, J &<g+>iH T`iu ]C  7  |%2(?tL YfsozRUgyl q 7 = xCZI OU ^,c o+ L ZT#$ 4 BPR^lz   .O  " 0Z>7L Z hv R  &$ 0\<Hb nzgE 78`c Z".:F R^jtv-#O    * i4CO T ^$ht rD 9 n  & 7 DD c o  7        u   * 7 D Q ^ q } 3 ;   7    3  $ , HF s    ;  Z 7   ( 4 A _ N [ V h u\   D    ^  ^    f  x +N H ^ qL& K&  & J&  &  &   S/F a/s 8xt5;SsS R3J Ak|| 2IM_ Fi&0     ; 7m w N Ll ] Ww z v&-9D H M&[&v d  &&L&&& 0   &&)3&`J 0U Y ^i m r }  4 - +&|& $&  0 9 5&8 &`1< S@ KE 0P {T sY4d h v z && &&&&&&/& <&J T& kv z    &    ! B   $& 9 hI[ :_ 0dr yv s{    &&<&    & -a6 1P T d h m x 1| # m c&    &&&(   !, 0 5&4M&H[&0r&L&h&&p&&&-&N&xX&p&&T&`&l&&&&&0$&.&H?&J\ ` e&r& 7    &,&L 9 1&t&&)4 Z8 X=H eL cQ&_&t d s o& &&&&&& "& p9& GIM& d&   & & & $&  A&{  1 # (K3 7 <&Z !^ c&&| D <& ( p f        # ' 0 4 9& Th& `& x& & &P&P   % # < 6" V& R+&dN&xl&&&&&& & & +& C& [& P s& \ & t & &   m e  Y   !! ! !& !5 !9 !>& $!W& !l !p !u& !& T!& d!& D!&P!& p!&|"&"&"0&"H& "e& "& " """" 0" "#n###( #@0#J&#aR#k #o #t ## # #6## (# &# !# ;## 3# 1## @$ <$2$$ S$# O$(q$9 h$= b$B&$O&$c&$$x d$ $ $&$&$&$&$&% &$%!&|%2&%?&%P %Z&%q%{ % %2% % %%=% % %% % %K% ,% $% Q% I% % n&& & &"4&,  &0  &5&?  8&C  0&H}&R  c&V  U&[&j4&t  &x  &} &  &  &&x& &  &  &&  4&  *&1& >&  Z&  X&&p&A'  n'  b'&'&&D'I&X'a&t'{&'&'&'&'&'&(&(#&(E&(R&0(p&L(&`(&p(&(&(&((&H) &T)%&)K&)U& )t&)&)&P)&)&)&()L)  )  )a) >*  *  *&**&*N&*j&D*&*&d*&*&*&*&4+6++#+/ +@+q+++&+  +  +  +  +  +  +  +  +&,&,(&,F&,[,_,J& &&< x p `< \`0.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @`@&,P12;E @@ @O(J@`xY(,fT@K` eExK8 (s@8 V`0@P0VX@0h0{ |@ ~8 (eextern.bd.o/ 0 0 0 644 149384 ` ELF@H@@|8` ?j!H`9 9@#9# 9 CCC|x#( >,)A08!x|N ```<8!x|N `||x!# ,)A ; |#@AH`9?  ?(?q)@4 p;0|#@A$H` xH`9?P p? x8!|N ` ,>A0H````xH`,>@9 ? KD||#x!HxH`|!HH````|!# ,)@,$# C |xI@l|#x8dH`,#A`_ 9 88!j #? 9)|"? |N ```8`;KxH<8H`#q)L !QxтTy)$9}P6x&|x p}GH*}JCx}GI*# x|)*# x})*9H C# h|*H@@8!N ``|p!x= Aaa)B? X Pc p x| |#HA H`{& |}8!(|N <8`8H`xHH```||#x|x|#x!qH`|~yA?q)A`H`|}yAH`|>@ ?  9IP|(P@At9@I? ?  9I9)|(P@? A]8! I? 9)? |N ``8xH? 9@I? ?  9I9)|(P@? @x8H? ]8! I? 9)? |N ``<7>@ bybRz:fJzR b|z`:=@?:: ```sA(>t@ 9=()@ ==9)|)@A ==@|)@@ ? q)@ x8xH`? |0H@A089),)0@ts:@p;~T>xܲ(A,<A ؁qiA \9= ( A=y)}(J})B})N PP0`> iI8,=At,:?  A|)@@@89cx H` ; }#|(H@ADxdxH`? 8p8xx})? =}})]N!A(x:|(H@:p|'H@99)yy)x~x88}):}2x?H? |0H@@@; |0@A~xH`9?  ?(?q)@4 p;0|#@A$H` xH`9?P p? x ,=Aq A\? HPx=")8 Ii}IIN!A(,#A ,#A? |cHP= xa)y) |*H@A(_= a)y) |*H@@```?9@_ q)@xi=@aJ|fxSA}*Kx8```yJ|;x8@}T~8}S:|9H``````}'Kx8y)x8,@8|{xA}HSx9 ```y}&Kx9)@|T~|"}2|1H``````}FSx8yJx8,@}):}$xA@}GSx9```x}Cx9@|T~|"|2|1H``````}FSx8yJx8,@})B}$xA}GSx9```x}Cx9@|T~|"|2|1H``````}FSx8yJx8,@})B}$xA(}GSx9```x}Cx9@|T~|"|2|1H``````}FSx8yJx8,@})B3H ```{(=@ 4= |=H@A(qk9 ? @= a)y) |=H@A x? 9 |'@@A 9 ?  8c  {$}#|(H@A `xxH`? {x~xx99)|}2}) ?HK``?  |)@@@ 89 `B? 9 |'@@A x~xx ?899) ?HK,``xH`(#|}x@ ,(#@= a)|#H@@,?9 q)@= a)y) |#H@A\? 9 |'@@A9 ?  8c  }#|(H@A xxH` 99=yy)xx88}*|})2~x ?HK,``? {$9 |'@@A 9P;~ ? ? 9)? T>xܲ(@(>q(@X ,A, ,A ,A ,@(`,<AqiA@p@ (<@ $|x{9BH(=t@9%()@$=%9)|)@A=%@|)@@ȁ? q)@8xHv(=@{Z$x;{|*H|9@@{}$^*(:Et@9%()@=%9)|)@A=%@|)@@ (?9 q)@h8xH9=;;[});{xH(=tA?  ;@|)@@@9  [x|9@AH@ |<@@9<{=$|)@@(?(:|0H@@ }9P}9)0*K````8xH?~xxx99)}})?H?(:|0H@@ D9>;0K```}>Ҁ P p9})<6y'тU%x$}(6|8*}89A x8`H0` `9)})@8y'тU(x$|h@6|8*}89Ay(&|B}@*|(@qk@ ?HP(>@(>@ = a)y) |>H@@x8xHK|``}>KxK ``?  ;@|)@@@9  K@```? 9 |'@@A0? ? 9)? K? 9 |'@@A ? ? 9)? Kp?  @|)@@;Al8xH? KX? 9 |'@@A0)? ? 9)? Kt? 9 |'@@Ap)? ? 9)? K\}4KxK``? 9 |'@@A8tȎtNt?  ? 9)? K`8|(8@Ah98 9?  ? 9)? K` ? ;E@|(H@@@89=;}) H;[;{K`8xH? K4```? 9 |'@@A@9tt Nt?  ? 9)? K`8xH? K```8xH? K` 9(|'H@A`89=;;[});{  9 K`8xH? K```? 9 |'@@A9|t|t|Ft 9?  ? 9)? K`8xH? K|` 9(|'H@A489=;});[  9 ;{K<`8xH? KT``` |}P= a)y) |#HA_= a)y) |*H@@@q9 ? @ =@s9 aJyJS_S_SAp8! *px!Aa|!AaN ? 9 |'@@A,9 ? ? 9)? Kd8xH? K$? ;W 6|)8@@9  K8xH? 9 |t|t9|Ft?  ? 9)? K<xx8{$H  }#|(H@@`xxH K8xH 89=;});[  9 K? 9 |'@@A89 ?  8c K```xxH Kh```?  ; |)@@@9  `B K `8xH? K8```8xH? K```8xH? KX```8xH K```|)@@@89cx H` ;C }#|(H@A`dxExH`  9< |)@@ @? 8p8xx=}})]N!A(!x<}(t}'t})Ft<!p<x!pK```? 9 |'@@A9DtFtGNt 9=;;[});{  9 K```8xH? K`? 9 |'@@A9 ? ? 9)? KxxH K8xH? Kh? 9 |'@@Ap9 ?  8c K8xH K~xxH|pxK? _ I q A,=@8? ,)A|;``` 9I),)}J@PR@xK? 9 |'@@A09 ? ? 9)? K|``8xH? K8xH? K,=@? 8`,)AH`````9I),)}J8P|cR@K_|*H@A=@s9 aJS_S }Gt}Ht}JFt S _}Gt}HtS}JFt  S_}Gt}HtS}JFtSK|8xH? K8xH? K8xH? K_|*H@AK8xH? K\8xH? K08xH? K? ,)A8`` 9I),)}J@P|cR@KH8 xH 9< KxDxH K8xH? KL|ex8xH K<P@@_? qJ@= Sxa){8838`K<x8H,)Ai,#A4|jH`?,)A$9@I|8!N <|KT|a=")})j!!),)A|~x|#x|+x,?AxH`,A;8` H`,# A ;pexxx8x? 9I9)_ ? H xxH`,?A8`8x|(PH`xH`,?@8!a|N ```H|xK`H`A9!p8A8988>pxxH`xHxH`xH`8!8`|N ```<A8xH> 8`, A8`8!|N H|~xK`H````|=")})j!1),)A|}x|#x,?A;8` H`,# A ;pxxx8x? 9I9)_ ? H |}H`xx||xH`,?A;;apx# fx8 ;H!|ex;C, A$}?_|:Atx|~H`xdxxH`8!CxAa|N ``HKLH`A|}x~ ^ xd}#|*H@A<xxH`> 8!})> |N xxH~ xxH`> 8!})> |N ``H`A|}x~ ^ x$}#|*H@A<xxH`> 8!})> |N xxH~ xxH`> 8!})> |N ``H`@d}cx``_9); i IB} px8!N `|xxH |KX```|pxH`|?  $!:?W" ~~~"~%~ ((+0.82@6H9~P=~XA`ChFpIxLPT[`rtwy"{,}6; M(U0E8XidM@MHPJXJ`hpx?IM~ ' '  EF *G 8H pp ' @""    ' '' 1 ' @(JA Y?[M] ^ _ b c d(g  0hPi Pm n o q r v V' D@jmpA B"C N' ;&$B22  C ;* j!:?D  ! M"FhCY JP! " # $M% & ) (  !:   ( @ YY  m  # ($ m0%% 81M m   Y1  rC   1 Z !:;F D. [buf/  +. fd/M0 end1 2 max3 4 (5 P5 X6 `7Mh8 p9 x Ay z end{ |  ^ \:1   B 85 5 end5 5 ptr5 5 5U(5U0 ~7 8 9 : 8< 6< 6end< 6< 6ptr< 6< 6 <U(<U0 > p? mem@ maxA 8C C endC C ptrC C CU(CU0 ;: ~!:9K]9*A7gv7'73(A;obj; pos;-0JKML M N O P( l A!: A !: l*!:^   TL!:(<%L <)~ ."/ O ."0 -u -b -t E M YF"z  U UGd* Y"Q@@ % J"X %[ @"H@q _ YF<. Y"+ O ."= M .<p "GM  HHf"a + U"Z A UH>-fc Y Gbs Y"^M -S Ee Y  M ),Q v/ sp h  pos  s?2F hd+ tag,  sz-2 i9ZST\++]=]]]%YhST\!\ ]l AZZ`Z ZY(]YYYYYZV ZZ\$O\(3\ \S.Z4PZ4Z(Z  #`5 lenB s?2 p % q  _p _a^ _b^ _c^ _d^ _e^ _f^ _g^ _h^\! AqS W#ST#/ len< s?\! AqS aTUW#STaTUa $/len<s?#/ len< s?\! AqS aTUW#STaTU#/ len< s?\! AqS aTUW#SaTU#82 f/JQS0T1# f.\! AqS W#ST4# i. s?\! AqS UyUUW#ST8# i. s?\!c AqS UUUW#ST4# i*M s?\!7 AqS UlUUW#ST2#% i*M s?\! AqS W#ST1#p vp3p< bufq= lenr> %t %uMv resw sx?5Lx blk" A b0 n aiTU \x!\ ]l AYOz Y\S  ) 7STUVWg OSa mTUVS ^ !:6)gP!e bufg2 ofsg= lengH vh2h; lj !eSVTWU T1&S"VU1&)N4" vN4N= bufO5 lenOA%Q %RMHS sT?\T!"Z\ ]l A)"TSVWH~"S"Ta"STUcS )I#E vI2I;c#ESSTT),\%a v,1,:%. %/MX0 ofs0 res1  blk2 2% s3?50$u n? a$gTU \3!$\ ]l AYO5%Y\$S  )%3STUVWX aSTU)%&$%4 v%A%J s'?\'!&\ ]l A&$S)'( v5>'"%M 5'"'S''2S'JS'bSS T U  "#|)& v2;% %MH blk % s?\!(\ ]l AYO (Y\(S  s(S))STUVWHH)<STH)ZST cS dM s6? v?H)*M 2-  pos M lenMV *VW WVVW WV+GVW WVVW WU+|UUU6 +UUUHU`*UlUmU6 ,:UUUHU`*UlUmU6 ,UUUHU`*UlUmU6 ,UUUHU`*UlUmU6 -WUUUHU`*UlUm>-mSW-Sc-S VSMJMMMMMeMZ .|Z4Z@Z&MGcMMN Y= /;YYYYYZV ZZR0SSR&S0DSTq0*T8T,T!U(0UUW#ST5StSTCUfU*UW#ST1&Nw7NxNt 5NNNNNSP3$ShS]TF@1TjT^TSU1UUW#ST3U<2U*UW#ST1Tx>2zTTTW#ST2TJ3 T8T,T!U(2UUW#ST5StST3SP5CShS]U<3U*UW#ST1Tx>4TTTW#ST2TF@4TjT^TSU4wUUW#ST3TJ5!T8T,T!U(5UUW#ST5StST3U1&N5[SN5sSN5SS T U  Rp7HSSR&S6STq6T8T,T!U(6UUW#ST5StSTC.RbSSR=SSVST Yh7lSTUZST\!7]*]]]%&NY;IN^~INj~Qh;R+RRR R7RCROR[U8U*UW#ST1T91UTTa9TUW#STU9U*UW#ST1T9UTTa9TUW#STU:2UUUy:_UUVs:VV~W:SS :S>; ST~U~;%S>;GST~U~W#;dST<qS TYhSTUR8<SSRUf<7U*UW#ST1*SSTqT8T,T!U(<UUW#ST5&NG?NL\X=Q]=]]]%RhY?~RRRuT>&T8T,T!U(> UUW#ST5T>TTTT UTTa>TUW#STTx?9TTTW#ST2St?\STFUVST YhSTURP@RRU@U*UW#ST1TTTTT UTTW#ST8&N5C?N:RICRRRTAT8T,T!U(AUUW#ST5TBUTTaATUW#STUBfU*UW#ST1TxBTTTW#ST2StBSTEUVST CSYhSTUTcCT8T,T!U(CUUW#ST5&NCN&N%EN*S,A SDS9T\DT8T,T!U(DUUW#ST5TxTE7TTTW#ST2TFVETjT^TSUEUUW#ST3StSTDUVs `FhVV~WFLSS VsFVV~WFSS YhGSTUYhG$STUYhGHSTUZSTSPIShS]U<GU*UTx>H'TTTW#ST2TF@HTjT^TSUHUUW#ST3TJIST8T,T!U(I9UUW#ST5SP9IShS]VST StST3U\$ JH\(3\ J3\S.Z< Z4Z0Z  Y6JYCV KdVW W.VDVW WUKUUUyKUUUyLUUUyLPUUULUUULUUULUUUM<UUUM}UUSUT  M Ns2?v;sph pos f+hd!tag" sz#/N%f& /N5d@/NGlenH/NYW/Nwgg+io,NsI?v5 i 6Q s;?E cf@YTOT8T,T!U(OUUW#ST5TP%UTTW#ST@VsPVV~WP}SS VsQ VV~WPSS VsQgV V~WQhSS [QSEQS*QSS T U Rhs:?vC$2 $2  Y % Rs@?v,$8Rs:?vC|Rs|:?v}&len}2bS,sb:?szc)tagc3+hdhPSPsPD?dQ29Sts97?n9A6-T s-3?.M val.*Uy2TUUW#T9# TFs#3?$$Mval$* Txs3?$Mval* Ts2?$Mval)Ts>?$3T$@ Q Us2?$BYlenU6s6?c=M, MUydstn)M+mUdst!n.Udst!n-Udst!n*MJVs=?K0Vs s7? msgFYWV^SScSJVs??msg1YK$V s<?WVSS ,W#s>?blk len 6W s:?D blk  VWSVT 6Y6 s:?58XI blk$ C \$X\(3\ X\ .Z<Z4Z0Z   YOs;?t Yhst:?f Ysf>?objg*hg7,QMYsQB?objQK$R2 $RE hT  Z]sD? M h old+i;Zbv( i4, Zbv , i 87Z0sB?7Z0sB?h\LsK?LspL\? U? U?3U$)[U[S4T W[S [ST@a\ SU  g7\30s9?i\ \S T US T Uj"?M"?\ks?7y\0sy9?M+]10val8+N]1N ,M]la,b7resD @\^\l\]\+]S S T U@Yh`YuYYYhf YYYuZ]j^ZvZjYoYYZ ZZ"Z.Z:ZD]6( _y]^]S]H&ZP`'ZQZ< _ZZZ> _ZZZ]AZvZj`AS4$``S?6%T8`xS`SV`S`SVS@a\!a] AqS aa{TUW#aSTaTUm I~1BH}1RBUX!YW  : ; 9 I8 H}: ;9 I41B  !I I 4:!;9 IB H} :!;9 IB : ; 9 I 8  :!; 9!I!81RBX!YW : ; 9 I U.:!;9 ' :!;9 IB4:!;9 I1 : ; 9 $ >  : ; 9 I8 4:!;9 IB4:!;9 I( 1RBUX!YW  : ; 9 I841 I!!I/ ".?: ; 9 'I<#.?:!;9 '@z$:!;9 I%4:!;9 I& 1U'<(&I).?:!;9 'I@z* 1U+ ,.: ;9 'I -.?: ; 9!'<.1RBX!YW / 0: ; 9 I1'I2 U31RBX!Y W 41RBX!Y W! 5 6.:!;9! '@z7.:!; 9! ' !8 :! ; 9 I9>! !I: ; 9 ::!;9 I;: ; 9 I <.?: ;9 'I<= 1>H}?4:!; 9 IB@.1@zA : ; 9!B4: ; 9 I?<C'D !!: ; 9!E.?:!;9 '<FG.?:!; 9!'<H.?: ; 9!'<I41J.:!;9! ' !K.:!;9! '@zL:!; 9 IBM.: ; 9 'I N4:!; 9! IO% P$ > Q RGIS : ; 9 T : ; 9 U&V5IW  : ; 9 X : ; 9 I 8Y> I: ; 9 ZI [ : ; 9 I 8 \!I/](^4G: ; 9 _.?: ;9 '<`1RBUX Y W a.?: ;9 ' b cH}d.: ;9 'I@ze 1f : ;9 g1h.: ; 9 'I@zi.?: ; 9 '@zj.: ; 9 'I k4: ; 9 Il1RBUX Y W m.?<n: ; ; rrSrvnwwnwwSwwnwxSxxSxxnstiuwixxissmttmuvmxxmxxSrs0wx0rs0wx0rwowwoxxouuYwwYuufwwfuuguvwwgxxuvfxxfuunuuxuuYwwYssossotututunttUttutuUttUttUttXttXvvovvovvovvonoSoooopSppSppopqSqqSqqSqqSnoToonppTppnpqTqqTqqTqqTopmppmoooopxppoooooYopyxppYoooooxopnopZopXopPopWopVopUop[lmSmmmmmSmnmnnSnnSnnSnnSnnSlmTmmTmmTmnTnnTnnTnnTnnTmmnmnnhhShimiiSiimijSjjSjjSjjSjjShiTiiTiiTijTjjTjjTjjTjjThiniinffSfgmggSggmggSghShhShhShhSffTfgnggTggTggnggTghThhThhThhTfgoggoqq!de!eeneeq`efnde1ee1ef1deeeefdeoeeobcSccnccScdSddSddSddSbcoccoccSccnccYccY`aSaanabSbbSbbSbbSbbSaaoaaoaa  $ &aa  $ &aaYaaY^_S_`n``S``S``S``S``S__o_`o__n__n__Y__Y\]S]^n^^S^^S^^S^^S^^S]]o]^oYZSZZnZ\S\\S\\n\\S\\S\\n\\SYZTZ[m[\T\\T\\m\\T\\T\\m\\TYZUZ\k\\U\\U\\k\\U\\U\\kYZVZ\l\\V\\V\\l\\V\\V\\lZ[S[[S[[m[[S[\m\\S\\mZ[o\\o[[o[[S[\o[[o[[yt[[nZZo\\oXYSYYSXYTYYTXYUYYXYYUXYVYYZYYVXYWYYWYYSVVSVWoWWTWXSXXoXXSXXSVWTXXTXX8XXTXXTVWUWXnXXUXXnXXUXXUXXnVWVWXmXXVXXVXXmXXVXXVXXmWWSWWUXXSXXUWWSVVSVVSVVTVVTSTSTTmTUSUUSUUmUVSVVSVVmSTTTUlUUTUUTUUlUVTVVTVVlTTSUU0UUmUUmUUSUUlUUSTUoUUSUUoUUoTToVVoUUnTToVVoRRSRRoRSSSSSSSoSSSSSSRRTSSTSS8SSTSSTRRUSSUSSSSUSSURRnPPSQQSQQq#0PPTQQTQQq#8PPUQQUQQq#@PQmQQPQ0PQoQQ1MMSMOnOOSOOSOOnOOSOOSOOnMMTMOlOOTOOTOOlOOTOOTOOlMMUMOkOOUOOUOOkOOUOOUOOkNOoOOSOOoOOoMNoOOoMNoOOoS8o88S8KoTnUKUV8c88V8KcWS77SIJ0!mEEmFFmHHmIImIJmKKm5!YHHYII5II5YX X !XHHXHHXoBBoIIoBBYBBzpBBYIIYBB0BBmII0oFFoFFYFFzpFFYFF0FFS II cIIc SYII0II0II0ZzZIIII1WxII1II1YZII0II0mZHHmHH0IJmXxXHHt"1YHH1IJ17%ZXHHZIJZUZHHUHH0t"WwWHHt"1XHH1u7%ZWHHZUZHHUHH0t"WwWHHt"1XHH1u7%ZWHHZ U  ZHHUHH0 t" W w WHHt" 1 XHH1 u7% Z WHHZ//Yo!7o8BoBCoEEoEFoFHoHIoJJo``((`,,`--`//`/0`01`12`44`55`77`AA`ABSHH`HHS0dd./d//d/0d01d12d44d55d77d89d@@dBCdEEdGHd0..n./w89w@@wBBw ooV!!V"#V##V%&V&'V((V,,V-/V//V00V11V89V99V99V::V;;V<=V==V==V@@VAAVBBVCCVEEVEEVEEVFFVGGVGGVHHVHIVJJVJJVm!!m"$m%(m()m,-m-/m00m0011m22m56m89m99m999:m<=m@@mBCmEEmGHmHIml!"l"$l%%l&&v:%&-l---/l00l11l24l45l57l8:l;<l<<l<=l=>l?@lABlBClEElEFlFFlFHlHIlJJl-.11-.11-.o11o-.Y..y..Y11Y--Y..Y--T..T'(m,,m99m99CCm'(l,,l99lCClEEl'(o,,o99oCCoEEo''U,,UCCUCC~''UCCUCC~'(8CC8'(oCCo''y99mEEm99oEEo,,iHHi),o00o11o24o45o67o;;o==o?@oAAoGGo),i00i11i24i45i67i;;i==i?@iAAiGGi))0))k))))**k*+++k++++,,j,,k2333k4555k6777k;;==???@kAAGGkGG)*m++m00m11m34m44m66m@@m)*U++U00U11U33U33U44U44~66U66~@@U@@~)*o+,o00o11o34o44o66o@@o11U66U66~11166111o66o11U11y+,m33m+,o33o00U44U44~00044000o44o33U@@U@@~342@@234o@@o34U34y*+U++1&23U44U451&67U;;U;;~==U??U??1&AAUAA~GGUGG~*+o23o45o67o;;o==o?@oAAoGGo23j==j23o==o44U451&AAUAA~450AA045oAAo67U;;U;;~671;;167o;;o66U;;U66x;;x??U??1&GGUGG~?@2GG2?@oGGo?@U?@x((569:((l56l9:l((o56o9:o((U55U99U9:~55U99U9:~5689:856o9:o::~66y::yJJlJJJJo k&&kV!!V"#V##V%&V&'V((V,,V-/V//V00V11V89V99V99V::V;;V<=V==V==V@@VAAVBBVCCVEEVEEVEEVFFVGGVGGVHHVHIVJJVJJV~U~=>~>>U>?~@A~FG~JJ~JJ~~T~=>~>>T>?~@A~FG~JJ~JJ~o=?o@AoFGoJJoJJo>>k=?k@AkFGkJJkJJkm=?m@AmFGmJJmJJmj=>j@AjGGjJJjJJjIAAIoAAol@Alk@Ako@Ao==HGGH==oGGo>>jFGj>>kFGk>>oFGo>?Y??YJJ JJo00m0022mCCm000220CC000o22oCCo00m00o22  CC  22  CC  228CC822oCCo22  22y!"m99m:;m;<mFFmJJm!!k!!m!"m99m:;m;<mFFmJJm!"o99o:;o;<oFFoJJo!"m99m!"?99?!"o99o!!m!!y""m:;m""n:;n""o:;o""l:;l""n:;n""o:;o;<mFFm;<=FF=;<oFFo"#o<=o"#;<=;"#o<=o##1<<1##n<<n##o<<o##8<<8##n<<n##o<<o$$S$%m<<m<<S<<mAASAAmEESEFmFFSFFmGGSGGmHHSHHmJJSJJm$$S$%m<<m<<S<<mAASAAmEESEFmFFSFFmGGSGGmHHSHHmJJSJJm$%o<<oAAoEFoGGoHHoJJo$$S$$mEESEFm$$:EF:$$oEFo$$m$$y$%m<<m$%n<<n$%o<<o<<lFFl<<oFFoAASAAmHHSHHmAA9HH9AAoHHo%&l==l%&A==A%&o==o&&l&&y&'Y//Y./n89n@@nBCnEEnGHn./n89n@@nBCnEEnGHn./o89o@@oBCoEEoGHo89nEEn896EE689oEEo99n99y@@nGHn@@4GH4@@oGHoBCnEEnBC5EE5BCoEEoCCnCCyHH HHoHI HIom//m//1&/0m01m12m44m55m77mo//o/0o01o12o44o55o77o//m//o/0m44m/00440/0o44o01m55m01155101o55o11m11y12m77m12277212o77o22m22yJJooooooBBo77oCDoCDYDDzpDDYCC0CDS77 77c 88S 8888888888DD DDcDDSDDDDZDDDDZDE EEZEESoSoSoTlTlTlSnnSnSnSmmmSmnn@@oonnyy@@mmoo o oo S o S T m T U n U U n y Y y YSSToSSSoSSoSSTTTTTTSSTSoSSonSnnoooo S nSn T T oo @@ S m S# nPSoSPTSS o _ S S oT T T TU UT T T TS o _ S osS o _ S oi  iS4$4$ 4$ 4$ h hS W S WS j j Y y Y hl  l  sl  l  l  hl  l  l @i0 m  m m k Y Y W W YjkSkkmkkSklmllSllSllSllSllSjkTkkTkkTklTllTllTllTllTkknkln,<, K8@PTTX            !78BBCEEEFFHHIJJ!&&///00112445578BBCEEEFFHHIJJ-...11----....'(,,99CCEE'(,,CC'(CC9999EE(,00112445579:::::;;==?@AAGGHHJJ))))),0011244567;;==?@AAGG)))*+++,0011344466@@1166+++,33004434@@333334***+233333445555666667;;;;==???@AAGG22233333==445555AA666667;;;;66;;???@GG???@((569:::::JJ((569:::::555566::::&&&&=?@AFGJJJJ=???@AFGJJJJAA@A====GG>>>>>>>>FG????//0022==AACCEEGG//000000==AAEEGG22CC222222!"99:;;<FFJJ!"""""""99:;;<FFJJ!"99"""""""":::::;"""""""""":::;;<FF"#######<="#==########<=#%<<AAEFGGHHJJ#$$%%%%%%%<<AAEFGGHHJJ$$EF$%%%%%%%<<<<GG<<<<<<FFAAHH%%%&&&==&'//.../89::::==@@BCCCEEGH./89::::==@@BCCCEEGH89::::==CCEE@@GHBCEE///00112445577JJ/////044015512771222BB!8888BBBBEEFFHHIJJKBBBBIIBBIIFFIIIJIIIIIIIIIIIIIIHHIIIIIIIIIIHHHH HH  77CD7777887788DDDDDDDDMMMMMMMMMMOOMNNNOORRRRRRSSSSSSSSSTUVTTTTVVVVVVVVVVVWXXYYYYYYYYYZ\\ZZZZ\\\\\]^^^^^_``____```abbaaaabbbbddccccdddddddeeeefddddddddefffffffffffhhhhhhhhhhjjjjjjjjjklllllllllmnnnnnoooqqoppqoooprrrrwxrrrrrssssssssssssssssssssstusstttuuvwwxxuvxx" "xD("p<60!r   !!" k l  .!..X",!<fg < ~  // !!  ~  ,  //>! Jv< $!v !,.;fY!qf=!W\@" .!# . / ! "=#! z !! !=0!"X<t  .22!. ..~ #// K2+!!%! !-!.! "+N< 2 &V =M1  +  1 /    ! K1  +  3.!/   K1  +  3.1M&+  'N 2y '&yJ   /=<(<.!(4 / u /!  )<)<  =J,  !1 !  )<)<  = }fA3Y0 /0 !/ /1N  /0$!$"!..)q< Z/tx2// 0/0./~  ~   ~ //  );  Y  ' Y '  ~!.~ /<. .,~J= /  );  Y  ' Y '  ~.  = .~ /<. .zJ~ } !J } !J } !i? # .w  z z &!!# ~ { !%*!#,!!!!!!!|  |  }   ~  }     ~  U $[ J/~ ~  "  0 . 1% /! 1X 4 ! !  !.~ ~ $+{ . !".3   .<!.~ !!%"0~    ~/  ~  ~.(  ~   /K ~ . g  =.<!!!&!!,!-"!!.  0 z /= !!   z  ,  //>!  " { . {. .! 0{ /. g/ 6|);  s  . p  | -K 4 & " !/!"t0.0 )  0  !| , |   -K 4 & " !/!"t0.0 )  "5 9!  |   -K 4 & " !/!"t0.0 )  "3 7!  |   -K 4 & " !/!"t0.0 )  "/ 3!  |   -K 4 & " !/!"t0.0 )  "/3!! J~+z  !~2= / $Y ~   //  );  <~w  t  /K!} ! ":!}  !} !!!<s~~ =   ~ t.  / }<! !}  !} !!!t<~< !~ " 2K/ 2Y    //  );  < ~  /K!}  !#!!,!}  !} !!!<} )  }  /   z  !  );  <+{   !"/ !  /==> J3   }.1   "! / $/    //  );  <!!:!!!!" 6 ![J} "! / $<!!<. !!-!!! & z.!" !~ ~  "  0 . 1% /! 1<  /' '  0t.~. ~  "  0 . 1% // 1<% "%, ""> !~ ~ !   /.  &/! 0$  /   !  0! !# !J}<!!:!!!!"    !  0! ! #!J| "+   !1  +   2+ <   w 1  +   2.=8)| ! 8  /~ 0  1 YJ< J~   ..!J S   /! != & S   /! != ~   !+  ) =. Z   /!    =  Z   /!    = J) Y   / ! 4  !  B  ) 0; =.>  /   !0   )B 0 ; =.   /%  "%}   }   )}.=X Y   / !  !4   B  ) 0; =.,j=X,<!J) S   /%  "~.!% "~  !<.,=X    / ! 4 !B     ) 0; B = ,s<!J" Z   /%  "%~ ! ~.   < .,~=X.$Xj/%{); {%   { <{)<)<{ )<)<  { )<)<  j! _ ! t|  G   //  );  = ,=.? + 1 +  /.! ,)<    !! B 4      ) 0; B < ~< ~  ~ t  .< =.,<!   % "% "~.!    <  ~   // !=J.j =X~ & ~ /. ).. =X)x<X,*<X)T=X~/  ~  ~.(  ~   /K ~   ~ !! v~ B!  4   ) 0; ~ )<)<  !!| J Y   / ! 4  !% "%, " ~  B  ) 0; -/ .LHtdf.t"xy< y. y  y. 1H. <0 z!"!!/"!! !zf 2!! $!K=#  K  !/4< . X x<.'zJf=!-/=. /="=K== J xX   J X"xx<<x. 1,./  .!< .<xX.f"xx< x..x. 1:. z!"!!/"!! !zf 2!! #&!  0 ,!//  ! ! !/  !/z .J .< x<.'f  A"xx< x. x. x. ? , .'#-!!,! w !!x 1.0.0Yt X.x.. < f!? 0" -!k"xx< x. x. x< 1V. y!"!!/"!! !zf 2!! ! . / !!!//" !L  ! ! !/  !.  .X .X w<.'. t"xx J> P   /!YJ, .!<!J!.xJ1.<X"ww J> P   /z  YJ, .!<z  J!.wJ1.<X"ww J> P   /z);  YJ, .!<z);  J!.wJ1.<X"ww J> P   /z)<)<  YJ, .!<z)<)<  J!.wJ1.<X#"ww.Jw  w.0 4    .!<O <& <   Jw..   4+.K A9 ! <  =+/<. <2k    (twf1.X.<!./!"v v XY . w  w !! !!w"! ! w !! w !!+ h !! . x !%.= ! !  !.Y' X   0x !1  +   2J  @   w 1  +   .+w   !" 3>  /  "D   D  ! /    0 ! 0 !! !   !J  v /= !!   w  , //>!  !Jt ^X  !t .v. Jextern_stack_overflowc_stack_linksize_tallocated_words_resumedmark_stack__kindmemory_order_acquiredependent_sizecaml_channel_binary_modeint32_tbacktrace_slotephe_inforuntime/extern.c__pthread_list_tmemprofsize_32caml_raise_out_of_memory__next__databitvect_test__prevCOMPRESSEDcaml_fatal_errorpos_table_entries_initshared_heapcaml_heap_state__pthread_internal_listcaml_serialize_block_float_8caml_stat_alloc__ownerrequested_major_slicecaml_ref_tablecaml_failwithcaml_output_value_to_blockuncompressed_lenephedata_len__builtin_memcpyslice_targetheader_tinit_extern_outputcaml_custom_tablesp_offsetcaml_ephe_infostat_promoted_wordscaml_output_valuelong intlocal_rootsmemmovesize_64trap_barrier_offlimitstat_forced_major_collectionsuintnatheader_lencaml_convert_flag_listextern_closure_up_to_envcaml_plat_mutexshiftcaml_intern_statestat_blocks_marked__jmpbufcaml_final_infomemprof_domain_scaml_bad_caml_stateextern_shared_reference__nuserscompare_unorderedcaml_minor_tablesntablessigned charcaml_extern_compress_outputtrap_sp_offNOT_MARKABLEDIGEST_LATERdigest__pthread_mutex_scaml_find_code_fragment_by_pcunsigned char__spins__int128 unsignedbacktrace_last_exncaml_custom_elt__atomic_load_ptrcaml_serialize_int_1caml_serialize_int_2caml_statefinal_infocaml_serialize_int_8header_Boolvaluechancaml_gc_policycharserializecodeptrcaml_ephe_ref_tableextern_stack_initcustom_operationscaml_stat_alloc_noexcNO_SHARINGcode_endextra_paramsobject_positionmemory_order_acq_relmajor_work_done_between_slicescaml_alloc_stringextern_intflagsextern_statecaml_find_code_fragment_by_digest__jmp_buf_tagyoung_startcaml_stat_calloc_noexccomparenew_byte_sizesweeping_donetablesreservefree_extern_outputcaml_output_value_to_stringcaml_exception_contextnew_present__lockcaml_output_value_to_malloccaml_umul_overflowwriteblock_float8new_entrieswritecode16caml_invalid_argumentwritebyteoo_next_id_localminor_heap_wsznextblkdigest_statuscode_fragmentlong unsigned intfinalizeextern_resize_position_tableextern_free_stacknfloatsextern_doublecaml__dummy_vchandependent_allocatedchannelslice_budgetget_extern_stateexn_bucketcaml__roots_vchancaml_serialize_float_8longjmp_buffercurrstorevlq__mask_was_saveduintptr_t__sizefile_offsetyoung_endinit_extern_stateextern_stringsize_headerexternal_raisec_stacksigjmp_bufgrow_extern_outputextern_init_position_tablegc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockcaml_serialize_int_4extra_heap_resourcesmemory_order_consumememory_order_seq_cstdoublerefcountpos_table_present_initextern_resize_stackmaskextern_code_pointerextern_out_of_memorynext_itemmutexcaml_extern_statestore16memory_order_releasesz_32bufffloatcountclose_extern_outputswept_wordsthresholdcaml__temp_resultunsigned intcaml__roots_blockDIGEST_IGNOREres_lenDIGEST_NOWpthread_mutex_tintptr_tgc_regs_bucketsrequested_external_interruptcaml_output_value_with_compatwritecode32compare_extstore64strlencurrent_ramp_up_allocated_words_diffextern_customCLOSURESstore32extern_free_position_tableoffsetcaml_free_extern_state__saved_maskblockextern_userprovided_outputcaml__frame__count__jmp_bufoff_tposition_tablenitemsallocated_wordsnextbitvect_setyoung_limitlong doublecaml_channel_unlockextern_valuenew_sizeCOMPAT_32infounique_idwritecode64allocated_words_directaction_pendingbacktrace_posextern_flag_valuessizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listextern_output_lengthfragnumcaml_stat_blockcaml_really_putblockextranewstackh_outextern_failwithallocated_words_suspendedpos_outextern_lookup_positiondeserializeephe_refinside_stw_handlerfixed_lengthmemsetcaml_serialize_block_1caml_serialize_block_2caml_serialize_block_4caml_output_value_to_bytescaml_serialize_block_8caml_channel_lockcaml_serialize_float_4caml_failed_assertextern_stackcaml_flush_if_unbufferedcaml_output_valchar_os__int128malloc__align__off64_tcaml_output_blockbacktrace_activecodecaml_obj_reachable_wordsstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policycompat_32caml_string_lengthstartenvnamewriteblockcaml_gc_messagevchanextern_rec__atomic_load_tmpcurrent_stackatomic_uintnatshort intrequested_global_major_slicenew_shiftidentextern_headerpos_table__elisionextra_params_areatag_textern_invalid_argumentrequired__valexn_handlerbsize_32extern_flagsextern_output_firstextern_output_block__int64_textra_heap_resources_minorextern_stack_limitcode_startmemcpyyoung_ptrcaml_local_roots_ptrasize_tdls_rootmlsize_tstack_infoextern_double_arraystat_minor_wordsextern_limitlockedinit_extern_stackndigitsextern_itemextern_ptrDIGEST_PROVIDEDcaml_stat_freeobj_counterpresentnewsizeshort unsigned intcaml_digest_of_code_fragmentbasemajor_refentriesintern_statesz_64Hd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatbsize_64custom_fixed_lengthcaml_domain_statestack_cachendoubleshashcaml_output_value_to_bufferminor_tablescaml_ephe_ref_elt__sigset_tdataextern_record_locationprevidentifierwritecode8major_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 0D AEA~R EAD IFA(LC ACA~\ DAB x0B ACA~$CpA~$EA~S LAD TEW AC A AAABABAAAA~n AAAAAAAAAAB 80CCCE IA A ABA~DAAJ0lF ACA~] GAA <C ACDA~d KAC V KAC \C A DT A~  NAGA @@BBI ABA~IAABAA~LAA AFA~EA,|KA~z GAD ,C AFA~e FAD $HA~O DAA , \JA~y GAB <0P4LA~h IAC PJpA~BDA4MA~B IAD TAGDK AAC A ACA~DAEAAAA AAAAA~BAA ABBA~T4AGDK AAC A ACA~DAEAAAA AAAAA~BAA ABBA~TAGDK AAC A ACA~DAEAAAA AAAAA~BAA ABBA~TAGDK AAC A ACA~DAEAAAA AAAAA~BAA ABBA~P<BJM AAA A ACA~DAEAAAA AAAA~BAA ACA~4IA~S GAA I GAD 4IA~S GAA J GAC 4IA~S GAA J GAC 48IA~S GAA J GAC hp`AGDACb AAAAB A ACA~DADA AAAAAAA~BAA ABABAA~8DpA~DBA,A AAEA~CA B AAAAAAAc N\ AAAAAABAAAAAC FA A A AAAAAAAAAgnu #600FH$[`nx     2H_fv+B|Rk 8P\0hL4goP(@)X@pWn`8,extern.cinit_extern_state.part.0free_extern_outputextern_failwithextern_out_of_memorygrow_extern_outputextern_record_locationwritecode64extern_resize_stackextern_code_pointerextern_valueextern_flag_valuescaml_stat_alloccaml_failed_assertcaml_stat_freecaml_failwithcaml_raise_out_of_memorycaml_stat_alloc_noexccaml_stat_calloc_noexcmemcpycaml_gc_messagecaml_find_code_fragment_by_pccaml_digest_of_code_fragmentcaml_find_code_fragment_by_digestcaml_invalid_argumentcaml_convert_flag_liststrlencaml_string_lengthcaml_fatal_errorcaml_free_extern_statecaml_output_valcaml_channel_binary_modecaml_really_putblockcaml_bad_caml_statecaml_output_valuecaml_channel_lockcaml_flush_if_unbufferedcaml_channel_unlockcaml_output_value_with_compatcaml_output_value_to_bytescaml_alloc_stringcaml_output_value_to_stringcaml_output_value_to_blockmemmovecaml_output_value_to_buffercaml_output_value_to_malloccaml_serialize_int_1caml_serialize_int_2caml_serialize_int_4caml_serialize_int_8caml_serialize_float_4caml_serialize_block_1caml_serialize_block_2caml_serialize_block_4caml_serialize_block_8caml_serialize_block_float_8caml_serialize_float_8caml_obj_reachable_wordscaml_extern_compress_outputZXC$ 2200 ! D! P! !  "   # p$  H2000 0$ % H! T!  H!  H< `% &  ! J2XR0XT' ` d# ( ) * x ` ` 2 2 0 0  $  *2 .0 0+ <  B2 F0 H+ T  Z2 ^0 `+ 2 0 ,  2 @ - <&  x ! ! ,! f2 j@& ` x x. &  x0 xx  x $ D   h  x d ` `( `L ` `, ` ` ` `T x ` ` `h ` ` ` `- $& , ` | `  `  `  ! `! `" `" `" `" `#  `#  `#h `# `# `# #2#2#0#0# # `# `$ $$ `$d $j2$n0$p+ $ $2$0$+ %20%00% 0%2H%0H% / %*2p%20p%4 0%:2%B0%D 0%J2%R0%T 0%\ %b2 %f0 %h+ %t %z2%~0%" % H%Z%X%C%C%! &2&2&0&"0&$ &F2&J2&R0&V0&\ &Z&X&C&2 &$ '8 'L3 'p3 '! ' '4 '28'08'" '# (Z(X(C(6 (1 (7 (8 (2(2(0(0( )Z)"X)$C)P5 ) )4 )Z)X)C*$ *\ *l; *& *& *! * +4 +# + : +>Z+JX+TC+ +> +& ,4 ,@4 ,J20,N00,P" ,= ,Z,X,C-($ -p -A -& -& -! .0 .@4 .H# .T H.vZ.zX.|C. `/04 />2`/F0`/L/ /fZ/jX/lC/ `0 4 0.2`060`0</ 0VZ0ZX0\C0 `14 12`1&0`1,/ 1FZ1JX1LC1 `24 22`20`2/ 2:Z2>X2@C2 `24 22`20`3/ 3.Z36X38C3& 3 `3& 44 4 2`40`4/ 4>Z4FX4HC4& 4 `4& 54 52`50`5 / 5NZ5VX5XC5& 5 `5& 6 4 6*2`6.0`60/ 6^Z6fX6hC6& 6 `6& 704 7:2`7>0`7@/ 7fZ7jX7lC8P `84 82`80`8/ 8K 9 Z9X9C: x;0! ;\! ;h! ; <4 < &3& 30&83H&P3`&0h3x&3&3&3&3& 3&%3&&3 &((38&)@3P&)X3h&+ p3&+03&,p3&,3&.p3&/`3&0P3&1@3(&2003@&3 H3X&40`3p&5@x3&6P3&7`3&83&93&   &*/#= Datmt M{  f~}    ^)3GU_ZngtkF LM "(vD Vn}t zT b  T^eZF  0 >LZ 5hv9 z # B [ z,:*H V drR-(N  3,p8DR^ jv i|9a%xN*>6B hN kZfrEvB   s(~2A^M W HdNq~( ; %p6[#o1EfO#iv" T    P  2W 8 >{ D K X e r  d  B  E   <    %y 29 ? z La    )  ! ; U B b o7 | [  } A    " + 8 R l yI     C     I ) < I  qb ~   I  f  J)/ 5 ;BdZ m d`I  4N&R6_&ho> 5Q+nF\}r* n% ,BIdtx&9 I^X~t $48FJO 4bfvz D;7&<&:&:LJ&:VT!d%`,&:K&9U a k&;x&< &9 us&9 }&:   "&/&:$9 $EIRVb&; l&; &;8&;8&;8&;D&;D  &;P&;P,05&;dB&;pRY&7`p{-v  $ 75 A?K#I2U6SE_I]Xi\gksoq~}{&7` &8&8&`&8T&6P$(6<:8C&6PM Y&78f&7Hw&`&6&6&7 &40)4]8KHLZ^g&40q S}&5&5(&`&4&4&4u&3 &#*:>oLPY&3 c 4o&4|&4&`&3&3&3&8&83:&20Z^g&20q }!@: ie&20 &2&3 &`&2  8&1@26xDHQ&1@[ g&2t&2$&`&1 &1 {&0P GC%&0P/ ;&1H&14Y&`h&0r ZV}y&0 &/`&/` &0(&0D-&`<&/F VZcgm&/&.p[W&.p &/8&/T&` &.&M-&,M|QjV[aeu 0y   oM      &-     0$ .)&-C <G 8L&-j&-}&, k k&.4&.H&-  T P&-0&.P &-t 8&- P&- n&.X  &,p  g  c  }  y   ! ! ! [! ! !* !. !3&,!f!q&+0! ! ![! =! 3! s! e! ! !M!!" " " !" "&+0") L"5 L"?&,8"L&,H"[&+"&+"&+"&,X"&0""&+ #  -# )#[#  C#$ ?#)&+$#F#Q&)#q e#u U#z[# # #M### # # # # # # <# 6#$ T$  R$ `$ \$#&*$A q$E o$J&*$h&*$z&)$ "$ "$&*$&+$&*$ <$ }$ y$&*$&+%&*`%4&*t%A&*%b P%m&)%a% % % % %[%%%9%7%&)% % %&)&&)&&)T&%&0&(&Ga&RG&VA&dg&ha&m[&x&|&& @&&&&j&&&&&&&(& &&'&('&('3&('K&('c&('t&'&'N'&&'`'''5'%'[''t'M((((#(.(2(@(D(M&&(W (c (m&'(z&'(&&( (((&&(&'(&&(&'<)&'T)=&'x)[&')h&')y&8) )& )));)7)[)N)J)M)h)`))** ***l*$ */*3*C*G*W7*[+*d&!*n*~h*b**&!(****~***& ****+&#0++%+.+2+;+?+L& +V+f +j+s)+w%+&++B+8+u+i++++ +++&+ ,+ +,9, 1, ,,e,],& F,/,3,?&,I `,Y,],f,j,o `,x',|!, k,G,?,&, v,r,h,,, v,,, ,,,&- -#--$S-(I-- -6-:-C -L-P-X& -n&%x-&%-&-&%-& -------F-&...U.I.& .+& .5.E.I.R& $.\& $.r.v........&.s.......s/// &//# /'/0/4/@&/J/Z7/^-/gh/k^/t/x////&////////&/&0)0 '0&!0+&l0I&0S0_70c30lJ0pF0u&"00]0Y0&0~00l0~000d04080(1&11 1$q1-111:&1D1T31X-1aO1eK1nd1r`1{&1&1u1s11}1&01&1!11122&2$&2.12>2B2K2O2X2\2a&P2&2<222 2 2 ,2 (2&2G2 =2 ;2 G2 E2& 03 &(3)&`33W3C o3G Q3P 3T 3]&|3g3w!A3{!=3!T3!P3&3&`33!k3!c3!3!3!3!3& 4&@44 !4$!4-!41!4:!4>!4G&t4Q4a"4e!4n"4r"4x&4&44".4"&4"U4"Q4"j4"f4&44"{4"y4"5"5&#5"&5D&5\&H5t&5&#5&5&5&P5!5"5"5"5"5"5"6@6"6"6&6&E66#6:#6C#26G#.6P#G6T#C6]&6gZ6w#X6{#V6#f6#b6&6&|6&%H6&%H6#{6#y6#6#7#7#7&%H7%&%X7<&7I&7m&$7& L7t7t7#7#7#7#77& 78 $8 $8%f8%R8(%8,%818:%8>%8G&8K& 8T&L8X&@8a&8e&w8n& 8x8&8&8&8&8& 8& $88&8&8&8&8'8&8& D9& 96&9@9P'9T'9]'(9a'$9f&#9& 99';9'79'N9'J9'a9']9&,9&#9&t:&t:$'r:('p:7&:A :Q'|:U'z:d&%X:n&%X:':':':':&%`:&%p:& :& :& t;&;&&p;H&#l;e&%(;v&H;& ;&@;+;';';';';';';&X;Y<(< (<(<(<&h<<(=G(=K(=V&=`=p)=t(=)7=)+=&==)f=)b=)y=)u=)=)=&=&=)=)>)>)> &>+&>5>E)>I)>R)>V)>_)>c)>l&>v>)>)>*>)>*>*>&$>&|>&>B>*)?*%? *<?*8?*Q?*M? &#$?:&X?]&%H?t&?&d?&p?M?*d?*`?&p?g?*w?*s?*?*@&@&@(r@4*@8*@A*@E*@N*@R*@[&@er@q*@u*@~*@*@+@*@&l@@+3@+@&@@+@+@,S@,EA&HAA!,A%,A.,A2,A;,A?,AH&hAR&hAn,Ar,A{,A,A&"A&xAA,A,A,A,A-A-A&A&B&<B'B7-%B;-!BD-8BH-4BM&#Bk& Bu,B-OB-GB-pB-lB-B-B&$(B&#B&%8B&pC&C&CD&CN7C^-Cb-Ck-Co-Cx-C|-C&C&C-C-C-C-C&CLC-C-CWD.D -D&`DD+.;D/./D8.rD<.fDE&|DOD_.Dc.Dl.Dp.Dy.D}.D&D&D.D.D.D.D&"D& @DD.D.E/E /E/E/E&$E<&!dEFEV/-EZ/)Ec/@Eg/<Ep/UEt/QE}&!E&!E/fE/dE/pE/nE&"E&E&$`F&$`F/|F#/zF,/F0/F5&$hFM&$xF^&Fm&$Fw&$F/F/F/F/F&$F&$F&F&G&4G%&GI& Gh& GrG/G/G0G0 G&G*G0UG0SG0_G0]G&G5G0kG0gG0~G0zH0H 0H&,H,&pH6@HF0HJ0HS0HW0H`0Hd0Hm&Hw&H0H0H0H0H&H&HKH0H0H1 H1H1I1I & IVI#10I'1.I01:I418I:&IX&%Ib&%I1FI1DI&%I&0I& I& I& I1PI1NJ& J& J*1ZJ.1XJ4& JM& JW& Jo1dJs1bJ|& J& J1nJ1lJ& (J& 4J& @JaJ1zJ1vJ&!J K 1K 1K K%&!K/&!KL1KP1KY1K]1Ki&Ks K1K1K1K1K& K K1K1K1K1K&K&K1K1L2 L 2L&L&L:2L>2LG2!LK2LU&",L_ Lo2-Ls2+L|2<L2:L&"@L L2FL2DL2PL2NL&"DL&"DL2\L2ZL2fL2dM&"dM &"dM&2rM*2pM32|M72zMA&"MK&"Mg2Mk2Mt2Mx2M~& M&MgM 8NMTN_ wNk N7N8N N N&N2N2OO 2O2O3$O"3O'dO23bO63VO?&OIxOY3O]3Of3Oj3Os3Ow3O& OO3O3O3O3O&|O&(OO3O3O4 O4P4P4P &P*& P4& PP4/PT4-P]4BPa4@Pf& (P~& 8P&P& 8P& 8P4LP4JP4_P4]P& @P& PQ&Q& PQ& PQ:&QH4iQL4gQQ& XQi& hQz&Q&Q&Q&Q& Q&Q&Q R  wR, R8 _RDRPyR\aRiRTR\R QRS-SQPSu S{&S4wS4qSS4S4S4S4S& SmS4S4S4S4T&@T nT-TGT_TyGTT|TTTFTUU7Ua\Uz U U ZUVV &V)5V-5 V=5$VA5 VF&V_&VtV #V&V57V53V&V&VW$ W*&0WJ5WWN5IWS*W^5Wb5Wr5Wv5W{W5W5W&xW&W&W&0WW&W5W5W&X6#X#6X(X36;X769X<&XN&XX&Xt6EXx6CX&X&X6OX6MX&X&(X&(X6YX6WX&4X&4Y6cY6aY&LY'&XY7 YPOYi Y"YYY%Y Z ZZ#:Z/Z^ Z Z Z Z Z&[6s[6k[6[6[[&6[*6[/t[96[=6[B[L6[P6[Y&H[c&H[~7[7[&\[&X[&d[&l[&[&\ &\B\4 \;&%\R&%\_&&,\t&\&\&&d\&\&\\ ?\J\]]&r]7i]q&]7]7 ]&P] ]7*]7(]&,]&]&]&^ &^$7<^(70^17u^57m^>7^B7^K&0^U^f7^j7^s7^w7^&0^&^8 ^8 ^&^1^8!^8^1^8P^8H^8|^8r^8^8^8_8_ 8_ 8_9 _9_#95_'9%_0&_:&_V9_Z9_c9_g9_p9_t9_~A_9_9_&_L_:_:_:_:_&_W_:_:_:1_:-`&` b`:B`:@`(&`B&`a&P`y&\`&`&`&`&5@`:\`:Ja:a :a;a:a&5@a) ma5&6(aB&68aS&`a^&5a|&5a&5aa((GPSP_P--. . '& /&/&46&4S&9^&&P|04p D%&())@+ T+0,p,.p8/`0P1@@203 405@<6Pt7`89.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @<, @Y@!&A@9 8`8@8H89p!!p9A!!xapA@&, @88`H`!@a#`B!AHIa8!|N ```<@\{B}I9I|I*9)|Q*B8! a|N ```,*^|JxG@K`<Al9!p9@9x>AAxpH`|dxaH8!|N ```< ?kn bA?' "  (   " %  (( +0 .8 2@ 6H 9P =X AX` Cbh Fp Ix L P T [ ` r tV w y { }    b ( H(08(id H@HHbPX`hpxH)b  EX F G{8 Hp$]@     gJ @jmpABC$ &) 22G.*Y.iA? L! H"*iAF.+buf/8 5B 5Bend 5B 5Bptr 5B 5B  5( 50 7{ 8 b 9 s : b8 < <end < <ptr < <  <( <0G > ? bmem @ smax A s8 C Cend C Cptr C C  C( C0  Abbbbbb bb~b}b  b|b , E{b A bzb V E,[ h b2b } E,b s -e E H@(  V( ' V( ^ V(  V(  V{( " msg{,b SS Vv( Y Vq(  Vl( msgl3b  SS Vg( < msgg3E  .SS Vb( msgb+b , SS V]( msg]+E A SS VX$ XX.b msgXGE JSSTT VS$ S,bS<H argSI SSTTUU VN$RN+b argN=bDSSTT VI$I+bfSS V>b>3b msg>KE@ @@g @H A b u Bb hS S T U@.b.1b//H/<1 11g 1H2g~ 2H 5 b./i: H ;b }S $ &T0 &S T U7 }IS $ &T0 {S T U1 S T U3 S T U3"b|f"0b arg"Bb$ $$g $H%b`%g~ %H +b }S2T0 S T U$ 7S T U& S T U&0b10b2f w3f w S T UN S T UNI~ : ; 9 I 8  :! ; 9!I!8 : ; 9 I8  !IH}H}.?:!; 9!'@z $ >  : ; 9 I 4:!; 9 IB I :!; 9 IB:!; 9 IB< : ; 9 I8  : ; 9!.?:!; 9!'I<.?: ; 9!'I<4:!; 9!I!I/ H}I:!;9 I: ; 9 I .?:!; 9!'I@z4:!; 9!I &I !!: ; 9! :!; 9 I8 1B!% "$ > # $GI% : ; 9 &5I'  : ; 9 ( : ; 9 I 8)4: ; 9 I?<*I + : ; 9 I 8 ,.?: ; 9 '<-.?: ;9 '<. U/4: ; 9 IB0.?: ; 9 'I 1: ; 9 I2.1@z31RB UX Y W SS S S S S S S S S S S T T S S T T U U S S T T S S S S q#0 T m T T m o 0 S T SSSq#0ToToToUnUnYnUnmmm0000SS00SSSq#0TTq#8oo0000`S S ,o,<S<oSho,'hR runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/caml/usr/include/powerpc64-linux-gnu/bits/typesfail.cstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.halloc.h =K< ."f.":!M=;//. K-!!!-==L K !!./ .<xX  XZt J  =//=!. /I0!!/ > / K/ # X.>8. #>8.   X #V> # > 8   .u K/<w   JZt J  =!!/!../K!.!   <.U  X X= = = = =.x=.x=.x=.x=.x=.x=.x=.x=.x=.x=.x=.memprof_young_triggeratomic_uintnatexn_handlercaml_raise_out_of_memorycaml_exception_invalid_argument_value__jmp_bufsize_tc_stack_linkdependent_sizetag_trequested_global_major_sliceyoung_limitmajor_slice_epochgc_policymlsize_tcaml_exception_not_found__jmpbufswept_wordscaml_local_roots_ptrbacktrace_posnargsv_msgunique_idmemprofcaml_failed_assert__int64_tsigjmp_buflimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnextcaml_invalid_argument_valuelong long intsigned char__jmp_buf_tagmark_stacklong long unsigned intcaml_exception_failure_valuerequested_major_sliceparser_tracecaml_raise_zero_divideint64_tlong intmajor_work_done_between_slicesallocated_words_directcaml_minor_tablesbucketextra_heap_resources_minordoublecaml_exception_sys_blocked_iocaml_exception_zero_dividecurrent_stackcaml_exception_invalid_argumentbacktrace_slotslice_targetcaml_raisecustomcaml_heap_stateoo_next_id_localbacktrace_last_exntablesintern_statecaml_exception_stack_overflowrequested_minor_gcallocated_wordscaml_exception_constantvaluechar_oscaml_exception_sys_errorinside_stw_handlerlocal_rootsblockunsigned intstack_cache__int128backtrace_active__valGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intcaml_array_bound_errorslice_budgetcaml_ephe_info__sigset_tcaml_statecaml_raise_not_foundintnatdependent_allocatedcaml__roots_argsstat_major_wordsallocated_words_resumeduintnatcaml__framesweeping_donecaml_custom_eltcaml__roots_bucketintptr_tc_stackyoung_ptrcaml__dummy_exn_constrmarking_doneminor_heap_wszbasetrap_sp_offcaml_raise_with_argyoung_startasize_t__mask_was_savedstack_infoextern_statecaml_exception_with_stringtrap_barrier_offexn_constr/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_ephe_ref_tableephe_infoexn_bucketextra_paramscaml__dummy_argsfinal_infouintptr_texternal_raiseextra_params_area__saved_maskcaml_invalid_argumentcaml_raise_sys_erroryoung_endlockedthreshold_Boolmemprof_domain_sunsigned charcaml__temp_resultcaml__roots_exn_constrshort intgc_regs_bucketsdls_rootcaml_ephe_ref_eltcaml_raise_with_stringcaml_exception_with_argcaml_raise_with_argscaml_exception_with_argsstat_minor_wordscaml_custom_tablecompare_unorderedntablesstat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infocaml_exception_failurestat_blocks_markedcaml_alloc_smallcaml_raise_constantcaml_domain_statetrap_barrier_blockoffsetcaml_exception_array_bound_errorshort unsigned intallocated_words_suspendedruntime/fail.ccaml_raise_sys_blocked_iocaml_exception_out_of_memorycaml_failwith_valuecaml_raise_end_of_fileyoung_triggernitemscaml_gc_policyephe_refreservecaml__dummy_bucketcaml_exception_end_of_filerequested_external_interruptcaml_failwithminor_tablesshared_heapsizecaml_copy_stringbacktrace_buffermajor_refargsaction_pendingstat_promoted_wordscaml_raise_stack_overflowcaml__roots_blockcaml_extern_state__int128 unsignedcaml_ref_tableephelongjmp_bufferGCC: (Debian 13.2.0-18) 13.2.0zRxA 8CF BA A AFA~EAC AFA~DCA(T|C AEA~l DAD 4C ADFA~t GAD ,C AGA~U EAD $CpA~$CpA~$CpA~0$CpA~H(CpA~`(CpA~x(CpA~(CpA~(CpA~(CpA~(CpA~(CpA~(CpA~ (CpA~8(CpA~P(CpA~    3|KVg0H`$x$$$ (0(Da(w( (8()GP(\uh((((?(Yfail.ccaml_exception_constantcaml_failed_assertcaml_exception_with_argcaml_statecaml_alloc_smallcaml_exception_with_argscaml_exception_with_stringcaml_copy_stringcaml_raise_constantcaml_raisecaml_raise_with_argcaml_raise_with_argscaml_raise_with_stringcaml_failwithcaml_exception_failurecaml_failwith_valuecaml_exception_failure_valuecaml_invalid_argumentcaml_exception_invalid_argumentcaml_invalid_argument_valuecaml_exception_invalid_argument_valuecaml_raise_out_of_memorycaml_exception_out_of_memorycaml_raise_stack_overflowcaml_exception_stack_overflowcaml_raise_sys_errorcaml_exception_sys_errorcaml_raise_end_of_filecaml_exception_end_of_filecaml_raise_zero_dividecaml_exception_zero_dividecaml_raise_not_foundcaml_exception_not_foundcaml_array_bound_errorcaml_exception_array_bound_errorcaml_raise_sys_blocked_iocaml_exception_sys_blocked_io62:2B0F0L n2r2(z0(~0 ZXCP 22P00P 2200 22(00( >ZJXTC 22h00h  22P00P 2200 "2&2(.020(4 ^ZfXlC  22P00P , 0 \ `        $ L" T |$  &  (   *  <, D l. t 0  2  4  &3& 30&083H&PP3`& h3x&P3&3&3&3&3&@3&p3 &(38&@3P&X3h&0p3&`3&3&3&3    Y&* 1 6 zD hR Y  ` g  n u |  s   r   -   3 $ x) 5 _K W  =c Yt       ]  ( \ %  ( {6 D R  `  n (|  A 1          $ 2 4@ N  \ j  {x  g     }    N    " . : F R ^ j  Xv          =  O  X     % 1  >  LK ^ (h  Bt     6        T     % ~/  =< M pj u    % }    x  n (  5  UH T  a  bn g|   n     U O   i) C n] j  w  U   f #  i  A  p g    J  j - J B  W  i  ~   `  & & & z & & & (  -& D& Q& _  d&` {&t &|   &0 &D &L H &   & & #  ( (& ?& L& Z 1 _& v& &  &p & " & & 2 &@ <  8 &T /&\ =  B& c R g N l&$ &,  & h d & &  &  N  ~  z "  &  +& K& Y  * ^& u N    B     & &  &P N    %&`E&hS  )X& o Ny } &0&8 "&P N 0 * T J  5 } {  $ ( - H7 ; @&U _ c h&v&& &P&  ?&0 N   B       % 5/ Y3 S8 F P sT oY g q u z      &,   && &h&'&J&_&Pl&|& &&&<&(&  & N    # - 57 ;  @ N X "\ a n _|  ] 7 3&t  L H&X&&P&&&(&8&I&(V&g Ax N& f \&h    &&(&&T&&&&&0&PX0P P4Ld|@p0 `$<T.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@C &X,X12XE@@LO +J@P$[7i""~%0y@uX0 %+& V@uH0,_ 08 9d@u; @xwwfiber.bd.o/ 0 0 0 644 69352 ` ELF(@@!|+x|3xAa|;x}Cx|#x|}x?!Qj?,)AH,>A,Al{$H*,?A\=BJ}I**9@|=H@A 9} 9Jy)B@|=H@@|P@?Ht``|{$8~gH`|yA9>G<}?J8y)9 ?}@P}t|}@8}JB}@9@L,|9 )9_8I8* ?0(}*@P})t|)@A8!x!AaN ```y)B|=H@A9@K```|K`|<@H`|<| H@L,|)@A(|ap,)A_(H,**@8,>A?, AT})88y)$8B}^H*_I*|(PH`8apH`8!|N _=|99J }_PP}Jt} @}*HP} A@L,8Bx|(PH`xH`8apH`8!|N ``<,**HA<ap,)A(=")^PP{"|)| H@L,88|PP|}|txH @Px|) @x@A8ap;H`8!{|N `(?x&@80xH|yAa{$|j| P|ePH`_;,) A)@,)@HD),)A8I|*@I}8P}JBI),)@jxH<,)A(8ap;aH`8!{|N ```K<|?H@A888cH`?, @>|?H@@="))|?H@A=")), @="))| H@L,()A|9@} |)@ }@@L,}>Kx@8apH`8!x|N `=")88c)}?H|1||H`K``xH`="))| H@L,()@|?H@@=")88c)}?H|1||H`888cH`Kx8!xa|N ``<=size_bucket_wsz/2stack->cache_bucket == stack_cache_bucket(wosize)Stack_high(stack) - Stack_base(stack) >= wosizeFatal error: exception %s Changing stack limit to %luk bytesruntime/caml/mlvalues.h((value)p & 1) == 0stack->magic == 42Growing stack to %luk bytesGrowing stack to %lu bytesIs_block (cont)Tag_val(cont) == Cont_tagIs_block(cont)cont: is_block(%d) tag_val(%ul) is_young(%d)val & 1bEffect.Continuation_already_resumedEffect.Unhandled*E: M Fint       ,:::G %&% W: ZM l& m&5H  4 4MDM   3 5# 6#W 7W(  T w T w  T "  #  $I(C 1)E)F1)G :AM'HRJOA*w XY+N%+2+9;K%>?wB13T6 7 8 9 : (; 0< 8= @@ HA PB XD`FhHTpITtJ xMpN~OQшY [ۘ\]^ _ A`TbL+MM5,M?M" "% ((+0.82 +@6 0H9P=XA j`C thFpIxLPT[`rtwy { }   T(S0 8NidT@THP X `hpx  T 3 =8+sp0 1 3g:T; A < (id= 0p +uspw x +E jF G X8H p 5 o@      y     @ 3jmpA B C  8,&,22 [ B*w  ` 2385 5 end5 5 ptr5 5  5S(5S07 X8 9 : 8< < end< < ptr< < <S(<S0 #> ? mem@ maxA 8C dC dendC dC dptrC dC d CS(CS0 ]  : M& ,* : M?6   7! T7"DhAOw 1P! " # $T% & ) (i MP  M,F 6. Qbuf/  *w   R% g ! " #%  -7 -8 Slf   !,T"} ,TU^ TI8#< _V[q909S $=TA.T$+MAWTH 1:g:fa 6S.I8.eeT;$ 4SS_h -   y Tres exn '} O  /%/23?I*S *WS< kS2T0S2T0 IS T U  ;xexn   /]X %Y23?IS *WS< _  M!DM!90exn Z2 M =M  (h &>stk?n 0bT'8  h  m[*  * IS T U . IS T U      " .  stk) d ) IS T U 3)  ) IS T U 3 >Sx8> x-vz >0SSZ Z3v\ \] ^T@1$ qh q])g)l9^)?))6xS T1UV0S@6S T1UqSS@ISTU a6?S T0UIkS TU bISTU gIS T U c6S T0UV0 IS TU c (Ph P'@ S (3 3*5T` 6 0 S8TB!S`?STBWSoS`IS T U 9IS T U 6 IS T U 8+<x +3id-0stk.A#YT1U1V1T $S  "  S TT@  '  +1h  . IS T U S@6S #YS* U%S=S@6\S IS T U  IS T U '(!q>f , :  $low  ' spv !q  ! ! S@"SUxBSUx!q U ! !!q ! !!q ! !" SU"!S"!SI!LS T U "!`SBS T!!5 2vB{"? {1req} Sx!SI"1S T U ~h#Y h' h3 h?spj idk l* x #- * IS T U .$#KT0US#$!/;GCid T3'$_ '-'8'D IS T UA$SSUTVU_''3TG$0Cid>g 03'% '-'8'D IS T U`'Q &% 'a'l'x  S3**#&X *I *<I&S T UI&S T UI&S T U IS T U4T'QD.$ $T4o 'Do:$q Aalenr A#a 0T'c 01'bii T  S(#Z (Y[ IS T U[cK)K*MN S6(S T7% IS T UM#> L)Rd@ @A #: ()@-; ) ; 4m)=$o )$o eT 1* 2val1! ,**2p,! *W!+!:fD* ? ,*T US S2g%I~ : ; 9 I8  !IH} : ; 9 I 8  :!; 9!I!8: ; 9 II 1B H} :!;9 IB 4:!;9 IB $ > ( 41B : ; 9 4:!;9 IB : ; 9 I8 H}<1RB UX!YW :!; 9 IB4:!; 9 IB!I/ 4: ; 9 I?<I.?:!;9 'I@z4:!;9 I.?: ; 9 'I<4:!;9 I U .: ;9 'I !: ;9 I"H}#.?:!; 9 'I@z$4: ; 9 I%&I&GI' U(.?:!;9!'@z) :!; 9 I*>! !I: ; 9 +:!;9 I,: ; 9 I -4:!; 9 I..?:!;9 '</ 1U04:!;9 I1 2: ;9 I31RB UX!Y W 4.: ; 9 'I !57I6 !!: ; 9!7 :!; 9 I889.?: ; 9 '<:.?:!; 9!'<;.?:!;9!'@z:!;9 IB?41@ AH}BH}C:!; 9 IBD:!; 9 IE% F$ > G H : ; 9 I : ; 9 J&K5IL: ; 9 M  : ; 9 N : ; 9 I 8O> I: ; 9 PI Q : ; 9 I 8 R'S4G: ;9 T.?: ;9 '<U.?: ;9 'I<V.?: ; 9 '<W.?: ;9 'I<X41Y 1Z [1RB UX YW \4: ;9 I ]1RB X YW ^ 1U_.: ; 9 'I@z`1RB X Y W a4: ; 9 Ib4: ; 9 IBc.?: ; 9 '@zd4: ; 9 I e.: ; 9 'I f.1@zg.?<n: ; ..S./S+,S..S..q#0,-m---.m....m,.0..0,-S-.S,,S,-o-.o--S..S,, -- .. ,, -- .. ,,S--S--o--S--o..S..o,. .. ,,S,-o--S--o-. --S-.o**S** *+ ** *+ **S**S*+S**S**S++ ++S((S()n))S))S)*n**S((T()o))))T))T))o)***T()1))1((S()n))S))S)*n**S()))o))T#)*o**T#((T((o))T))o&'S''n'(S((n((S&'T''k'(T((k&'U''l'(U((l&'V''m'(V((m''S'(o((S((o''''n((''S''o((S((o''n((n++S++S++S!!S!#o##S#$o$$S$&o""n#$n"#o##S&&o"#1&&1""Y$$Y S o S o oSoSoSonnnnSSWSoSoSnnnnSoy(o z88ToTooo z3& z3& z3&YYYYXSnSnTTUkUkVllWWommoUxoUxooo@TT@TTT@TTTTTTTSS#STTTS#SSTTTSSS SnS1&nS1& n S U S T V T U W Uss8YY XSosSoSoSoSo S o S S S o T n U T n U m V U U m V V V P W W W X T S S o Y Y 0 T T T`S`mSmSm`T`lTlTl`U`hUhUh`V`iViVi`W`jWjWj`X`kXkXkxoSoSoSoYYYXnnnmmmYY0ZZZm3$3$S@s"#8 S 0 1 2 3 4 5 Y YSno S nY yy8# SSSUS,|   """"###$''''((''((((((()))(((((())))*****+****,,----..,,,,------..T runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesfiber.cmisc.hmlvalues.hmajor_gc.hdomain.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstruct_FILE.hFILE.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hstdio.hstdatomic.haddress_class.hsetjmp.hstruct___jmp_buf_tag.hplatform.hcodefrag.hsetjmp.hroots.hgc_ctrl.halloc.hstdlib.hcallback.hstring.h #<."0 /-0  b ." a ` +3!!./  ?  .  <.2} %} }  }!<y!! v !! ! "$. 1< .EJ  / JJ    X<"<) fX^  !Ji f. !Xx(x.(x.6 /({ fit!#[[&/&/<.!- J#=J</XM/<.&v .J.' t'&/J.!%-=.&f.0&, !%=k"00 #0-0000t  3 !+3!!. L  " .  / J <... =X000g< #0 .  " "!JJ.X .(fX> ! !  ?(G #J(= !m  (G #J(.  h  . f . d . m .J bXJ<(  /!m.<.. gJ<. ;f d f.f   d.  f.JJO>,"//!0"//  / ##" "v<<< u./ ]j<<< kJv""  Bz 4z &z 20" .!,& .!Y#&!z &!z  " $  !!x *(x .fAJ""!_&l !  &  r  .M)  !& v & v    & !=0  =$.k   $ h ./ .!   .fEfJrJt.t&`.t~t0!"<.% /% 2<G  <?<-J.J.Mt!!  !/O.jw0 "  Xv@<{X.? |."| J3.<..m B> |."| J/!pg@x y v!j  X }   !}!2 } /  ! ! !J .}J.f } = }}.! }  X ". }    f/"."fn   sJX6 q. </ $J Pf =!1H ;X=!-/!. d X !( ./ !"! . dJ  </ $ .m.. / !"! . x..X.  f= c_stack_linksize_tallocated_words_resumedmark_stack__atomic_compare_exchange_ptr__kindwosizememory_order_acquiredependent_size_IO_codecvtbacktrace_slotephe_infocaml_make_unhandled_effect_exn__pthread_list_tmemprof_IO_save_endlive_stack_counterhandle_exncaml_raise_out_of_memory__next__data_IO_write_base__prev_lockcaml_alloc_stack_cachestderrshared_heapcaml_heap_statescanning_action__pthread_internal_listblock_IO_save_base__ownerrequested_major_slicecaml_ref_tablecontsize_bucket_wszcaml_raise_stack_overflow_chainephe_cur_columnslice_targetVal_ptrcaml_continuation_replacecaml_minor_heaps_endcaml_custom_tablecaml_ephe_infostat_promoted_wordscaml_marking_startedcaml__roots_effectlong intlocal_rootsexittrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_failed_assertruntime/fiber.c_IO_markercaml_plat_mutexcaml_intern_statestat_blocks_markedcaml_final_infomemprof_domain_shigh__nuserscompare_unorderedcaml_minor_tablesntables__atomic_store_tmpsigned char_IO_FILEtrap_sp_off_IO_wide_dataDIGEST_LATERdigest__pthread_mutex_scaml_find_code_fragment_by_pcunsigned charcaml_ensure_stack_capacitycaml_alloc_main_stack__spins_freeres_listbacktrace_last_exndefault_stack_wsizecaml_custom_elt__atomic_load_ptrcaml_statefinal_infocaml_named_valuePhase_mark_final_Boolvaluehandle_valuecaml_gc_policycharcaml_ephe_ref_tablehandler_IO_lock_tcaml_stat_alloc_noexcalloc_for_stackcode_endcaml_darken_contextra_params__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml_try_realloc_stackflagsPhase_sweep_and_mark_main_IO_read_ptr__jmp_buf_tagyoung_startptrdiff_talloc_size_class_stack_noexccaml_current_stack_sizeextern_statecaml_continuation_usecaml_free_gc_regs_bucketscaml__noalloc_markerscaml_domain_alonecaml_alloc_smallsweeping_donehefftablesreservecaml_continuation_use_and_update_handler_noexccaml_exception_contextcaml_alloc_stack_noexc__lockcaml_raise_offsetmax_stack_wsizeoo_next_id_localminor_heap_wszcaml_unhandled_effect_exndigest_statuscode_fragmentlong unsigned int_flags2dependent_allocatedstack_len_IO_read_baseslice_budgetexn_bucketlink_unused2longjmp_buffer__mask_was_saveduintptr_t__sizeSCANNING_ONLY_RECENT_FRAMEScaml_gc_logyoung_end_old_offsetexternal_raisec_stacksigjmp_bufgc_regsv_gc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockextra_heap_resourcesmemory_order_consumememory_order_seq_cststack_handlerdoublestackcaml_minor_heaps_start_IO_write_endstack_cache_bucketgc_phase_tparentalignmutexcaml_extern_statememory_order_releasecaml__dummy_effectswept_wordsthreshold_IO_buf_basecaml__temp_resultunsigned intcaml__roots_blockfflagsDIGEST_IGNOREDIGEST_NOWSCANNING_ONLY_YOUNG_VALUESpthread_mutex_tintptr_tfiber_idinit_wsizegc_regs_bucketsold_stack__pad5requested_external_interrupt__int128 unsignedeffect__atomic_compare_exchange_tmpPhase_sweep_ephecurrent_ramp_up_allocated_words_diffatomic_value_flagsoffsetcaml_continuation_use_noexc__saved_mask_modehval__jmpbufcaml_global_data_codecvt__count__jmp_buf__atomic_store_ptrnitemsallocated_wordsnextyoung_limitcachelong doublePhase_sweep_mainFILEcaml_get_init_stack_wsizenew_max_wsizeunique_idcaml_scan_stackcaml_noalloc_endfdataallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listfragnumcaml_stat_block__off_thexncaml_change_max_stack_sizehandle_effectdeltaallocated_words_suspended_freeres_bufephe_refinside_stw_handlercaml_raise_continuation_already_resumedmemsetnull_stk_IO_backup_base_shortbufwsizechar_osstack_wsizecaml_free_stack__int128__align__off64_tcaml_live_stacks_memorybacktrace_activecache_named_exceptioncaml_alloc_stackstat_major_wordsmemprof_young_triggerPtr_valrequested_minor_gcyoung_triggergc_policy_IO_buf_endnamehandfprintfcaml_continuation_already_resumed_exn__atomic_load_tmpcurrent_stackatomic_uintnatshort intrequested_global_major_sliceis_scannablecaml__framecache_bucketatomic_intnatscanning_action_flags_vtable_offset__elisioncaml_noalloc_beginextra_params_areatag_tbucket__valexn_handler__int64_textra_heap_resources_minorcode_startmemcpyyoung_ptrcaml_raise_unhandled_effectcaml_local_roots_ptr_IO_read_endasize_tdls_rootmlsize_tstack_infostat_minor_wordslockedrequired_spacecaml_fiber_wsz_filenoDIGEST_PROVIDEDcaml_stat_free_wide_datanew_stackstack_usedshort unsigned intmagicexception_ptrbasemajor_ref_IO_write_ptrintern_state/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_max_stack_wsizecaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tcaml_gc_phaseprevcaml_round_upmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA BDDDBe ACA~VAQ ID HA~BAC AFA~EAE AFA~DAB AFA~DAB AFA~EAE AFA~EADHpA~(L8BCX ADA~DAC BB A AFA~EA,BH EA A AFA~EBAEHTDpA~KBA0hBDP HB I AHA~GA HA~U DAC 8I AHFA~s HAAFC <4C AFA~^ DAA Y DAC PHC ADDA~d GAB RpCGADA~QHBCM CC A ABA~EDADA AFA~E AA $hABB AAA~NAAAHC ADA~y FAB a FAA AAjAKO4\C ADEA~Q HAC <CBL BA A AFA~DAB AFA~DCAxDA~8CpA~D BAA HhC AFA~] GAC AMFGAAA~I\$CpA~ &DCV_   0(#HL=`Xdx|T<(;BSb y8Ph "h>O~x8h"$>fiber.calloc_size_class_stack_noexccache_named_exception.part.0live_stack_counterfiber_idcaml_continuation_already_resumed_exncaml_unhandled_effect_exncaml_fiber_wszcaml_statecaml_stat_alloc_noexccaml_failed_assertstderrfprintfexitcaml_live_stacks_memorycaml_max_stack_wsizecaml_get_init_stack_wsizecaml_change_max_stack_sizecaml_gc_logcaml_current_stack_sizecaml_alloc_stack_cachecaml_alloc_stack_noexccaml_alloc_stackcaml_raise_out_of_memorycaml_scan_stackcaml_find_code_fragment_by_pccaml_alloc_main_stackcaml_free_stackcaml_noalloc_beginmemsetcaml_noalloc_endcaml_stat_freecaml_try_realloc_stackmemcpycaml_ensure_stack_capacitycaml_raise_stack_overflowcaml_free_gc_regs_bucketscaml_minor_heaps_endcaml_minor_heaps_startcaml_gc_phasecaml_num_domains_runningcaml_continuation_use_noexccaml_darken_contcaml_continuation_use_and_update_handler_noexccaml_continuation_replacecaml_raise_continuation_already_resumedcaml_raisecaml_named_valuecaml_continuation_usecaml_make_unhandled_effect_exncaml_alloc_smallcaml_raise_unhandled_effectcaml_global_data:ZBXDC~2@ 202200 &2*2(2060(< V2Z2b0f0l 22X00X 228008 2 @20$ 0 V2Z@2@ZXC2"@F2N0T" 2200 ZXC2 200 p 2@8 f2r28v0~08 202@ B2F2 N0R0 T `' ) ) $) ) 2 28 0 08  v2 z0 % Z X C , 4- @. f2 n0 - / . 2 2( 0 0(  2 2 0 0  22 628 >0 B08 D nZ zX C , 2 @ . N2P V0P X" x% C 1  C(+ H. 2p0p" 2200 2200 2200 *Z6X8C0 2200 3 H/ , 2@20" 2 @ 2(@(&20*@0t. 2 @ 20" : 20@0. J2N2R0V0d n2r@2 @ 20" 20  2200 "2204" B2N0P 9 220"0$ 2262>0B0D 22 00  2200 B2F@`> j2n0t? 2@ 9 = ZXCJ2N@pB 2808? 2@B "2&2.0204 H lA p> &&&5& 6&(7&08&&3& 30&P83H&P3`&h3x&3&`3&3&3&3& p3& 3 & `(38& @3P&X3h&p3&p3&`3&03&3&3&`3  VG&*/=B PG^ e $lxsvz -UT`v# +,'CESXeEr(H U5/&XB Tl r #xc~  8Nx+gT6 _% l2k?LY6fs   $/Y 0)L6C PV]jw   AW&i$8 FTb p~jI  1Y  De,  H & 4BP :^ l z!  ( 4@Lpf nr~ _xa<&2>J V "bnz   b  6 C P ] p, z :    [   |  [  r   & 9 CG P m 0 sQ y=  )    h k       b $r 1+ > s K Y{ f     b     #  = J Wb j xO  D  x    b + 4  a %7 + S 29 ?z L Y< f+ sA   9   l  & M3Z@M|Z m y2  &&D&&2&7-*J,`rG Z !7 J4fl&`  &p&x& (" LB$ /x3tCGW[`i tx&HbbG9w}y  &+&LD&P&xl&&<&&&0&0G !G*C.=7WF&T]XYb&{nl&|&&&h  &X4 @SQY&`p{7:. uk&p-&& &&9&J&W&puj&p \.&VVN b~v &,05&,F&S&i&r &L&&&&  &1&? zJ&alp~TP&H7ic &&&0!/3:&G&\&y&|&&&& &l&(&@&U&l&&&&&<&&X&!&,&C NRW&@h sw|&P?&  b & & < & H"& @& X& p& &(&& &&& L&8&& p( 3?7;FSJQ[& y4& `e[ a%k*$^X"+6v:t?& T_c~i&z&&& & & `&P& |& &,&&P>&S&p]&r&&&&& x& L  b"&+ L6:J,N*S^8b4gZzY~Ge&$&&&L &\ " 2  6 ? # C  H& , Z&l c s @ w 8  g  a &  &x      & & ` & !& !& !/&8!<&!M& (!a& X!r!K!!& !! ! ! ! !&!&"&"!&"2&"@"K&"b "m ="q 7"v\" \" V"V" {" u" " " " " b" " "&"J" " "&\#& #&#.&#L&h#Z#d&#{\# <# 0# # t# j#\# # #V# # # # ## )# '#&#:$ 7$  1$:$ Q$ M$' h$+ `$0&$A&8$N&$`&<$$&$\$ $ $$ $ $ $ $ $\$ 7$ +$V$ n% b% % % b%! %% %*%%4%8%= %GE%K?%T&%] %l`%pZ%u %~z%v%%%&%&8%&%&%&%%%%&& &&&*&&3%&B&F&O&S&Y&&n&&{&&&D&&(&&&&t&&&&&&'&X' &' '.\'9'E<'R'b\'mu'R'&`'Y'''&'(''&x'(&(j("](&Y(+&$(<&(I&(Za(a&(x `(v(l(j(((%(((&\(&(&(&)&) F)&)2)?3)I)M)Sj)]&P)t&P))&)X)))%))X))* I*+*=T*J *\&*w*{***&,*&*&8**&8&8&8&&/&&&&&&#&3&u&&& & `&`PL`l p L ` `p`0``.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @ &, 12IE 8@@OXJ@ Yh*T@P eG?nxMs@pP ]0@0]_pX@H0q0 p@8 x OHfinalise.bd.o/ 0 0 0 644 62760 ` ELF@@||}xd|#x!q8cH`|yA9 ?=X,)A@I,*@dX8!|N ```PX8!|N ```<, AT_?9J})R _?J})R?9)?p8!N `>_y)U)8}JB*>_y)y)$})P}JB*?9)?p8!N ```8`H`?,)@?,)@9@_x|K|<Alx.:;;:::H\`XX|*;}*" @8X})"8X})"I =:;|)@@x=}IJqH@| ,A@J|UJ|'P|BAl|*E::;|A*F=|)@A@|<@xx@|=|)@@d|wP7c~x`}KSx9J|J|H*|}J|I*9)|(P@A:~P~˺8XAD,>A<;``_8X8cx;})RH`7@K``< ,)A8!8`xcN `|x|x8`H`x8xH8`H`9 8`xc> x8!|N `!>H,)A8!8`xcN `|x|x8`H`8(8xH8`H`9 8`xc>Hx8!|N `?|~x!Aj?,)AL?`,)@t?P,)Ah|A(=")),)AIi}IIN!A(<8`8H`P,#A!?"A?Ba;9;`;p;;Z#, A@$_Px*9)*?PI J})RI `}J|*H`!px`}*v, @P,#@!Aa<8`8H`=")),)AIi}IIN!A(|9@9 8!x^>N `H`,8Px@XKX```8$xCxH`K``|K`>x!Aa8!|N `|<^|*H@A,).:;;`A|```>_x}I|*|_N!A(xA,>_}I})8_N!A(>;{;|)@A>8^0|*H@At,).:;;`Ap>(_x}I|*|_N!A(xA,>(_}I})8_N!A(>8;{;|)@A~P,;A``;;;, Al```?xx;})_N!A(?8x;})_N!A(; |=H@A{,;@|8!Aa|} N <K<8Kp`|A|;x}&a|x|+x!aA(~>|;H@AD|)@@p`>_x;{}I|*|_N!A(>_x}I})8;_N!A(>|)@A~0>8|;H@A|)@@.:``>(_x}I|*|_N!A(xA,>(_}I})8_N!A(>8;{;|)@A8!Aa|} N `<~K``<8~0K```A|zx!10?8|>H@A\@t|a;`!?H`?8;;|>H@@`?(}))q*@,\|)P@@=BJJ|)P@@}#Kx;H`?8;0c|>H@{A,;@0|=H@@H`?8;;|=H@@?(}))q*@\|)P@@=BJJ|)P@@}#KxH`,#@x?(;});IJI?8|=H@A```!a|8!AN ??";;9x#x8H`?(8x#x}))q*AH`?(}))K`?B?b;Z;{Dxcx8H`?(8 Dxcx}))q*AH`?(}))K`CxxxH`CxdH0?8|=H@@Hx; H@;} Cx} B|I*?8;Z;|:H@@h_(}*iph@>:,A|#@@@=|#@@@H`,#@_(}*Kd@|;@@?X8 `B?8Kd``>H@Kp`<^})B,)>}JB^A<?;9 Aa?B?b;Z;{```>})),)A,q*@\|)P@@,=BJ8YDxcxJ|)P@@ H`^;|)P@A^Aa|*H@@8>})),)Aq)@^;|)P@A8!|N !x?"!x}))K```<}))K`<}))K`|#xH`>~,)@,%@~?K|``;Kt``<todo_tail->next == NULLGc.finalisefinal->old <= final->youngfinal->old == 0final->young == 0final->young < final->sizeIs_block (final->table[i].val)Tag_val (final->table[i].val) != Forward_tagi == final->oldk == todo_countCaml_state_opt != NULLCalling finalisation functions. fi->todo_head->size > 0Done calling finalisation functions. f->first.old <= f->first.youngf->last.old <= f->last.youngi == final->youngcaml_get_header_val(final->table[i].val) == 0target->old <= target->youngsource->old == source->youngtarget->old == 0target->young == 0target->table[i].valIs_block(target->table[i].val)Is_block (target->table[i].val)!Is_young(target->table[i].val)%=DX :  Eint[ 2T        ,`F  W` Z: l m3G   ::  H O.)|]  X!/3pI44|45|!NT2!2!9 ;J < > :?K " j d j j "j %j  (t( +0 .8 2~@ 6H 9jP =jX A` Ch Fp Ix L P T [ ` r t w y  { }     d H( 08Lid H@HHPX`hpxHjoyt E Fk G 8 Hp@     4p:; < = (> H? P@ XA `Bh @jmpA B C* &" 22 b$,jSkHl "2"38 5 5end 5 5ptr 5 5  5 ( 5 0j 7  8  9  : 8 <t <tend <t <tptr <t <t  < ( < 0 > ? mem @ max A 8 C  C end C  C ptr C  C   C ( C 0y   :j D:)|J }      !"#$%&'()*+,-./01 } D** ` :?5   6! H6"M  :*F 5. Nbuf/  )| 0    H MO b fun val H   old ! "  b- . /H0   b $P: DE dF $F $F $"H! 0= H.Qd O+ ./ . (  ( Z (   [  )) D+S V (# oHO7R O7a (  +/ +h #e O H#I  }#H }$X{,f [Sp %.ST0Up$%* S T U $f@vIEETU xS T U  ETU$Ef+v4ETU *S T U  ETUSc %c9fcFvcO8e9$)$$ $ $9$*u$$ $ $  S  S T U o S T U  4S T U u gS T U v S  -3 %4%4486,iU H  STU Y LS TU X xS TU Y S T U W S T U ] S T U \  %7  uS T U : S T U 8 S T U ? S T U @-,$HTd,1S,f.-'`d'7U)V  .2   STU STU.   ~STU  STU  S T U !.R    S#c=ST  vS TU  S TU   S TU   S U  'S T U  S TU  S T UW d:// ;fi<;i<i jk0i=iact </ 0=dH f iSS iSS :S T U S T U=Nact </ 0=dH f2 i!SSq i`SS>& X| iSUSUp S T U S T UY  | f b res fi> &  D'$0<$ % %?% %'$ g$'$4$ % % ?% % VST  )S V)ST  MSTU S T U@H d0 f SBST(U0 SB@tHdt1 fv eSASTU1 SAA4 #cd55.59H&7 f8!* i;1$1= $A($L^$f$\'$R $$ $ $($qR$$ S T U<#4 iL jL kL1$1S "$A($L^$f$\1$R !$Z$ $ $($qR$$ "4S#c"RST "oSU0 "S T UR "S T UQ #S T Uc S T Ub S T U:A$1d,3H&!  f$ #SH# $S T U, oS  ]H$Lv]# QH$qvQ&sQ0 $ MH$hdM(sM3 $ +$val80/ $/ d tH$:tE,[@%)\a@>%)hBp0B%)Bp|CCI~(  : ; 9 I8 H} : ; 9 I 8 I :! ; 9!I!8 !I : ; 9 I H} 41B 4:!; 9 IB $ >  : ; 9! : ; 9 I8 1BH}:!; 9 IB1<.?: ; 9 'I<:!; 9 IB:!;9 IB U: ; 9 II!I/  14: ;9 IH}H} .: ; 9 'I !!:!;9 I"4: ; 9 I?<#.?: ;9 '<$.?:!;9 'I@z%:!;9 IB&4:!; 9 IB'1RB X Y W (1RB UX!Y W! )>! !I: ; 9 *: ; 9 I +.?: ; 9 '<,4:!;9 IB-.?:!;9!'@z. 1U/4: ; 9 I0 11RB UX Y W 2&I3GI44:!;9!!I?<5 !!: ; 9!6 :!; 9 I8784:!;9! IB91RB X!YW :: ; 9 I;4:!; 9 I< =.?:!; 9!'@z> ?41@.?:!; 9!'I@zA.:!; 9! '@zB4:!;!9!IC.?<n:!;!D% E$ > F G : ; 9 H&I'J5IK  : ; 9 L : ; 9 I 8MI N : ; 9 I 8 O'P!IQ.?: ; 9 '<R.?: ;9 '<S.: ;9 '@zT: ;9 IU1RB UX YW V UW.: ; 9 ' X Y.?: ; 9 'I@|Z 1U[.: ;9 ' \: ;9 I 88S88o88S67S77S77S77S55S55n55S56S66n66S55T55U55m55T56T66m66T33S34n44S44S44n45S34T44U44m44T44T44m45TSoSoSoSoSSTlTlTlTlTTUnUnUnUnUUmNNnxYnxY+,S,-o-1S12o22S23o33S+,T,/n//T/2n22T23n,,m11m23m--0-/m/1m12033m++Y !S!"j"$S$$j$%S%&j&)S))S)*j**S**j*+S++j++S $($+( !S!"j"$S$$j$%S%&j&)S))S)*j**S**j*+S++j++S !0!"k$$k%)k)*0*+k $o$+o!!0!"n""""n$$n%&n**n++n"#m####m$%m**m%&m&'j')j**m*+j++m++j%&m&&&)m*+m%&0&'i')i))))i**0*+i++0++iSoSS oTTT TUlSlUU lVV V VWjW W jn nkk0kSoSSoTTTTUlSlSlUUlVVVVWjWWjnn0k0kk0mm TUZ TZYXoohYYYYYYSSSoSnS#nSSSoSnS#nS k S kSkT m T mTmU j U jUj0 l l0l h h0n n nYzxZYZ 0 g  g g Z [ Z 0 o  o g0g 0  f  f f f0f 0 n n0n W zx Z W ZS4m4S/T/xnxTnTn0`S`|oSoSo4tmmm,X             #$+!!!"$$**"#$%''**%'')*+---//122H runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesfinalise.cmlvalues.hshared_heap.hmisc.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfinalise.hfail.haddress_class.hstdatomic.hruntime_events.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hroots.hstring.hcallback.hmajor_gc.hsignals.h ![>>!// 2=!&< yX!&< b.Yx. f1 L>=i.> Y 5!0#"Y"=@' Y$ LJ!.y.+~  ' ).' =+~  $ *. ( $ 3J!.jJ=!/ /6Jp     ZtuuX6x v .X.}< "/./  s +  (m  . p(9 .<'<< JJ uXY=  W  !%  <   Cy  K #%  / ( "v."  =</=  w   s +  v   o   t  "q< q  "q< .!4z !!u  ! Y"! !!. ?G #G.gX u .0@ 2200 "2&2.0204  2 @ 2  @ -  2  @ - 2200, T r2v2z0~0    f2j0 2  @ - 2200 "2*00 N2V0\ 22X00X "2&2.0204 B2F0N2 V0 X f2j2r0v0x 20 20X 0 1  2 @2200. 2 2 @ L 2200 20 B2F2N0R0T r2v2~00 2200  22X0"0X$ B2F28N0R08T b2f2xn0r0xt 2200 $Z$X$C 22620:0>00D \ $Z$X$C 220 000 0 j$Zn$Xp$C220000  ,6 &3& 30&83H&P3`&h3x& 3& 3&`3&`3&3&3&3 &(38&`@3P&X3&!&"&*& +&   M &*/=kDWctj Rq xL `.z  y!9 ? E^K ,Q,W `eqt: #n *8{FTgbp~ Al = `   * &%4 B APu^yl}z P  hlT  m$(0J VbnzA`` a  @". m:IFR^pz  = m &  (5 BtO\i v   Ot}! -9,F?T `9lx M c  5? 3 MMZ cg z `N M c   $Z ) Q W f ] c i o u {     W    L   [  X       #     Q D  H #] )# / 5 ;< A G N MZ Ss Y _F e k qe w ~  m  z  B   $ * 16 = c:  5      c    c  ^ %} 1 = . J W e q k     <  5 *( Es W pn    6    *&; ?  D&\&4| r&` 0 (&&0&& _ S # (&F&[&0h&y&4Y&   ! &&L &0&+&`F N&e:p mt Y   5 !   & &   &     &@ &@< @ I&@^ b k o v&&&&X&&,&&&\&x$&5&J&W&h&y&H&W   5 )  i c  &T!&6&M& b&y&\&&&&&&&&&`&)&6&C&,X&Xe&v&\&8&&|&x&&&& 7&? C IO&`o s |&x N J } a   / + N >&&4&\7D H M&Z&&&<&&     3 !& &>&K&`&w&8&&d&&`& & &&(&9&S&d&Xq&$:c&`' + x0 : > C $M Q ^ b gq Lu B w s  &&  &x& & &+&;&<L&Y&jo&       $ 0  { sg      & h"& 3D H M& a& (r& <    & P    & & &$&& &H1&>&OZ& y  @}  <  d  b  w  s&     & & l& l    & l2  6  A& PJ& Pl& u&     &     & &H& D&  &*& 4N& _&0l&} &        &&& M&5  )9  F  YJ  SO&,f&<&Ht&    t:    @    c  ,  "  V   R  %  o )  e 2&P ; P&T Y' c  g  u&T ~&T &T     &X 2     &! &!&!+=!<  !@  !M  k!Q  Y!^  !b  !k&!tH!&!]!  !  !&!m!m!  !  !  !  !&!x"  "  "  "  "&"5&"S&"p& "&"&"&<"&"&"&"& "&#&#&#$&#5&t#F&X#S&#d#i&#  #  # c#  ;#  /##  s#  g#  #  #&0#&#&($&$&$'&$2*$MN$r$$$$$$%%%/ k%3%8%< &W&X  ``T`.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @X@h8&,12 Eh@@O! (J@pxY!H%AT@B0 eFsL= Y0@0Z! [*@H0m0I l@`hH( pfloats.bd.o/ 0 0 0 644 85488 ` ELFG0@@="),)L |<888`!H`8!p="i|N ``;@$,*Ad?8;xxH`xH`9@|ixx}\IH`|xH``}#KxH`|~xK```yIe yJ"9)0,?<}Cx@1*})Qq)Ah9 .8<H8`q)yIe + 9 09)WA<@}(Kx8yJ";,?9?Hy)@1*})QK9 ,_A >;9JB|>@^A<, -A, +x;@A, 0@#q), XA<8xH`!|>H@|=Ax!H`!HA8!|N `<8|Kt`8c!|>@a@,}#P;`})8;; ;```|hx8c#q*, PAU*>, .@ ,@8xB9@H`9 U>( AD9J;9, @\,?A,;A\9@{&8BK``9 U>(@9)U)>( AT9J;9,;}J@c;{B4Kd```(, A8 8H`!|>H@= |#H@09 |jxU)||#HAX,A,`B A yP,@ <`}; P| P@|H`,A!aK,;;9A,9J{&}J8K```<8|;@K`8cA;pH`9^||xK|R,AKp!a|=AxH`?O V?I" < W < < "< %< (( +0 .8 2@ 6H 9<P =<X A` C'h Fp Ix L P T [ ` r t w ym {w }          W k( 0 8Jidk@ kH P .X .` h p x          k   q   <  8+sp0 <1 <3 :k; < (id= q0 Apuspw x  EFG 98H p  "@mm    , r | t   @jmpABmC  +&K22 +*5'V?6[   7! k7"L'lV+F[6.Mbuf/l y85 5 end5 5 ptr5 5 5(50 <7 98 9 : 8< < end< < ptr< < <(<0 > ? mem@ maxA 8C BC BendC BC BptrC BC B C(C0  5 U:NO < V   ! " # Oq e POm 0 . K.. . a. erf. u. z. . w. . . .. . . ;. .. Y. . 9. . U. /. 5. E. W. [. 7. q. K. . tanB. . G. . cos>. . I. . sin@. . pow. .. . . . 4. n. O. O . . j. k. . logh. . ,  b. . k . ..QfmaT. ...$.'.. .=.$-.T.$1.k. .. exp_.. e..k 5 ZkRb$(. Ze$p,S, _ 2B +b$y Z _ :S eeT ,Xkk , ,e eLkeTvd*-DWo$ vdo*.Xr8d.8iur#ns et hXvfh)!vgh3T-58jOEYf4ff$!gf-Te41fe$!ge-Td4rfd$!gd-Tc4fc$!gc-Tb4fb$!gb-Ta45fa%!ga.TPf fP*. gP4.resY K(fK)-M@ x@$.;(wf;*g;39w=i0+-. x-(. y-2.4f&! " K0+.- x$.4f%  a0+. x#.44f' & u0+4f'  0+. x%.. x%.8uf'g0u g 0+. x%. y/.4f& 0+8Jf'g0 0+4f'  0+. x%.4*f& 0+4f'  0+. x%.4 f& /0+4f' r E0+y. xy%.t4ft& [0+o49fo& q0+j4fj% 0+e4fe& 0+`4&f`% 0+[4uf[& 0+V4fV% 0+Q8%fQ'gQ0 0+L4fL&N  0+A. xA$.<Lf<&0+ 0+-sf-&%/s"/m.quo0P.rem0H&0,"0kres1 &2 .@/"9 4 T@0+0+ CS2T0S T U / m(4f(&*  T0+. x$.4 Xf' j0+4 f% 0+<!f'i0!TT1&0+ .4!|f (.i 2!!.TT"f'%s"m&P&,"kres &kX/"P" "hTX0+ "S2T0S T U 8#$f1&f20 0+ #f1%f2/f399# ####0+,.$ x,#. y,-. z,7.8$x+y4$ $$$ 0+.$ x). y3.4%f''0+ 4%f '% %y%=0+.% f%.4&f'& & &(T0+.&3 x%.4&f&& &&k0+.& x$.4'f%0+'gf%g.0+'f%g.0+(f%g.0+(cf%g.0+(f%0+(f%0+$)6n(Y0+!p5.,)kf(w(,Qvsw+&y,Q~bufz dstz.endzsrc{len| "}kd~ .Z/*oc ,a +,,},s:,,,,,,[,,0,+,0-+M-;,-TU:0-+-+S+ST+S0+y,S,5SS ,aV?\ k-* s+ end; resI Om q%!k%"k%#k%$kexp&kp' f( .<-c+ <-e2 5(dH k(adjf k1 /s)arg.=9=F]->i>d.u#-kexp km ^,Qbuf p dkres 2.txt7b.STb.S,S2/!i ky/9S /^S TS10+)fmt()arg3res d .e0SS1t1)d*.res 21?2Q12b:2n_2x02y2?21|282,;2D2ES T UST1U1V1W0@\1@X2,S2T U0`2Q3$35(aib(k23(=4 (424 W&02&k!!.&03&(T!!.%03W%=!!.$03$$ !!."".#3###"###04) T!!.04j !!.04 E!!.04 !!.05- !!.u05 !!."".05 !!.06 u!!.06H a!!.06" K!!.w,6#"06#!5H7#E!#O"YT7b#!cI:!;9 IBI~.?:!;9 'I@z1B : ; 9 I8 H}H}  !I .?: ; 9 'I< : ; 9 I 8 :!; 9!I!8 :!;9 IH}: ; 9 I41B.?:!;9 'I !.1@z$ > ( 1RB UX!YW H} : ; 9! : ; 9 I8 4:!;9 I4:!; 9 IB!I/ <4:!;9 IB4:!; 9 IBI .?:!; 9!'I<!:!;9 I"4:!;9 IB#1$.?: ;9 'I<%4:!;9 I&4:!;9 I'&I( ):!; 9 IB*:! ;9 I+: ; 9 I ,.?: ; 9 '<-1RB X!YW! .4:!;9 I/ 0 1U1.?:!; 9 'I@z2 U3: ; 9 I44:!;!+9 I57I6 !!: ; 9!7 :!; 9 I88 :!;!9 I91RB X!YW! : U; 1U< =:!; 9 IB> :!; 9 I?1RB UX!Y W!@.?:!; 9!'@zA% B$ > C D : ; 9 E&FGIG> I: ; 9 H5II  : ; 9 J : ; 9 I 8K4: ; 9 I?<LI M : ; 9 I 8 N> I: ; 9 O4: ; 9 I?P> I: ;9 Q.?: ;9 'I<R.?: ; 9 '<ST.?: ;9 '<U.?: ;9 '<V.?: ; 9 '<W41X : ;9 YH}Z : ;9 [41\.: ;9 'I ] : ; 9 ^4: ; 9 I_ 1`.: ; 9 ' a4: ; 9 Ib.: ; 9 'I c.?<n: ; 77S78S88S88S77s78S88s88S77y1$77Z78y1$88S1$88Z77z5%78y1$5%88 S1$5%66S66S66 66,66,,. .+ . .),. .-,.,.)"55S55S56S66S55S55S55S55S44S44S45S55S44S44S44S44S33S33S34S44S33S33S33S33S22S22S22s22S11S11S11T11T11t11s00S01S00s//S/0S//s./S//S..s..S..S..s--S--S--T--T--t--"--s,,S,,S++S+,S++T+,T++S++S++s**S**S)*S**S))s))S))S((S((S((s''S'(S''S''S&&S&'S&&S&&S%%S%&S%%S%%S$$S$%S$$S$$S$$T$$T##S#$S##s""S""S""S"#S S "m""S""S""m "o!"0!"S!"S S S sSSSSSSTT!!.TTSmSSmo0SSSSTTSSTTUUutsSSTTt"sSSSSsSSsSSsSSSSTTSSTTSSTTSSTTSSSSSSSS S o SoSo ~ m l SlSll~ ~ m l n  n nSnn~ o o  o l S Ss~lSoo S Z z z~ z zzSnZZ 1 j 1j1 jj ! !  Y X XXnnnnSS0oooooo0iiii00kkk hhh0Z0ZTZ0!5.!!xsxsxsZZ s7SSkkkSkS k S kTTT TUlUlUUl UZz?%?%?%UU0U U U U UZYZZ0Z Z Z Z Zn n nnlXnl  X W W l   oT1& o o T1& oy4% Y y z4%S S o So=2$ =2$Yv Y v Y vS STyv  y v  y v T TSoSTTSoST`q`Sn!?s?s?!!.nSnSooooYYooYY11nn0101!!.!!.!!.!!."".!!.! !.##!##!.((!((!.))!))!.*+!++!.,,!,-!.,,",-".--!-.!...!..!.//!//!.00!00!.11!11!.23,!.".+".".)!.".-!.!.)"77!77y1$77Z77y1$77!1$77z5%77y1$5%77 !1$5%,4    ####(((()))*++++------......./////0000E runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/types/usr/includefloats.cdomain.hmemory.htypes.hstddef.h__locale_t.hlocale_t.hstdint-intn.h__sigset_t.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.hmathcalls.halloc.hstdlib.hstring.hlocale.h Ov vJ .2$$w.#.#>/0", =!-/ 1,./  .0 P. 0P<0 P  ./R . R .  HQ!. -fuR . R .  HQ!. J!tJ.fQy. 0 % /-!  =  . < [u "# s # .."!!"!   (6 0#  ! # r.!! !!!!  " "  !   "  ! ft 4 J  %! U<  J"  !,.  !K<  !! <%j< . 0X!    !  ./   !  /! ! + "     !  !  < C ":" <". /J< N.  .  <( . "  ! z "fw  3/ !3!    < L /<    $!" / ! "# .Q J4."...! % <.jJ   1  ..  z ! !#Q  !h /    < !<#$! ./  >!  ! X  <  = &<("! "   !  Q R = K A  @ %<!2$?  "".<.<"&f ! ('     !J<!$  5t.  M5! i   <<1.=<p  XJ ' . /. S.<!z X!i$ J.j <\ <\ JN JN JN JN == ;x >2wu. y <  ;x >2wu. y <  ;x >.we. i < ;x == ;x =/wy $  < ;f w~ <.A ! /= ;j=!!/ .!2.=$< ! ! ! /#! ! ..v..XX ! //0!  /= ;\ == ;x == ;x >2wu. y <  ;x=!!/ .! \.K $4ws . w <  ;x ! /= ;j == ;x == ;x == ;x == ;x == ;x == ;x == ;x >2wu. y <  ;x == ;x >2wu. y <  ;x == ;x >2wu. y <  ;x ! /= ;j == ;x > .wl p   p < ;l > .w >6wc. g < ;xl. p < ;t >2wu. y <  ;x >2wu. y <  ; t " 0 <[p f  \  .PMs   Xi) <  ).<.. -11y3JG 3< 0u2JF 2< 0u2XF 2. 0u2JE 2< 0u2XF 2. 0u2JE 2< w f. ) <  ).<.. -<!y"/ !  ! &z ! !JwU! !  ! &z ! !a #c_stack_linksize_tallocated_words_resumedmark_stack__locale_t__ctype_touppercaml_tan_floatwosizememory_order_acquiredependent_sizecaml_classify_floatcaml_fmod_floatbacktrace_slotephe_infocaml_sinh_floatDEBUG_clearmemprofsqrtvstylehandle_exncaml_atan2_floatextra_heap_resourcescaml_atan_floatsigncaml_alloc_sprintfcaml_abs_floatshared_heapcaml_heap_statecaml_tanh_floatcaml_ldexp_float_unboxedcaml_stat_allocmajor_refcaml_signbitrequested_major_slicecaml_ref_tablelocale_tcaml_add_floatdom_stcaml_acos_floatephecaml_mul_floatslice_targetheader_tresultcaml_custom_tablestat_promoted_wordscaml_hexstring_of_floatlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_intern_statestat_blocks_markederrorcaml_log10_floatcaml_final_infomemprof_domain_scaml_nextaftertanhcaml_bad_caml_statecompare_unorderedcaml_expm1caml_minor_tablesntablessigned charcaml_hypot_floatn_bitsmodftrap_sp_offnextaftercaml_erfc_floatcaml_failwithcaml_expm1_floatcaml_float_comparecaml_exp2unsigned charcaml__dummy_mantissa__int128 unsignedbacktrace_last_exncaml_acoshcaml_cosh_floatcopysigncaml_custom_elt__atomic_load_ptrcaml_statefinal_infofmod_Boolcaml_asin_floatcaml_neg_floatvaluehandle_valuecoshcaml_gc_policycharcaml_floor_floatcaml_sqrt_floatcaml_ephe_ref_tablecaml_fma_floatFP_normalextra_paramslog10sinh__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml_ldexp_floatextern_state__jmp_buf_tagyoung_start__ctype_toloweratan2log1pcaml_hypotcaml_alloc_smallsweeping_doneatanhcaml_log1p_floattablesuselocalereservebuffercaml__roots_mantissacaml_exception_contextcaml_ceil_floatCAML_FROM_CAMLfloorcaml_le_floatlog2caml_int_of_floatparse_bufferoo_next_id_localminor_heap_wsz__uint64_tcaml__framelong unsigned intfreelocalecaml_alloc_small_flagsdependent_allocatedslice_budgetcaml_cos_floatexn_bucketstrtod_llongjmp_buffercaml_round_floaterfc__mask_was_saveduintptr_tasinhyoung_endcaml_lt_floatcaml_check_gc_interruptexternal_raisec_stacksigjmp_buf__localescaml_cbrt_floatgc_regs__uint32_tGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockcaml_log_floatcaml_log2_floatcaml_ephe_infomemory_order_consumememory_order_seq_cststack_handlerdoublestackvprecCAML_DO_TRACKmaskparentcaml_extern_stateroundmemory_order_releasefloatswept_wordscaml_nextafter_floatthresholddec_pointcaml__temp_resultunsigned intcaml__roots_blockcaml_signbit_floatFP_subnormalintptr_tgc_regs_bucketsrequested_external_interruptcaml_power_floatcaml_sin_floatm_bitscurrent_ramp_up_allocated_words_diffoffsetcaml_eq_floatcaml_float_of_hex__saved_maskblock__jmpbufcaml_float_of_stringcbrtcaml_sub_float__jmp_bufnitemsallocated_wordsnextyoung_limitcaml_format_floatlong doublecaml_log2__locale_structx_bitscaml_modf_floatcaml_div_floatruntime/floats.csaved_localeatanunique_idcaml_asinh_floatallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcaml_alloc_small_dispatchldexpcaml_stat_blockfrexpcaml_roundcaml_localehandle_effectacosexpm1caml_erfccaml_copy_doubleallocated_words_suspendedcaml_copysign_floatephe_refinside_stw_handlercaml_atanh_floatexponentcaml_classify_float_unboxedasinhalftruncacoshcaml_failed_assertcaml_copy_stringcaml_float_of_intchar_oscaml_neq_floatCAML_FROM_C__int128handlerbacktrace_active__locale_datacaml_exp_floatstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policyfracnewlocalemantissacaml_string_lengthcaml_float_compare_unboxedcaml_acosh_floatstrtolcaml_exp2_floatcaml_log1p__atomic_load_tmpcurrent_stackatomic_uintnatshort intcaml_trunc_floatuint64_trequested_global_major_slicecaml_copysigncaml_erf_floatcaml_erfcaml_atanhcache_bucketextra_params_areatag_thypot__valexn_handlerFP_infinitecaml_fmastrlen__int64_textra_heap_resources_minorcaml_cbrtmemcpyyoung_ptrunitcaml_local_roots_ptrFP_nancaml_ge_floatasize_tdls_rootmlsize_tstack_infostat_minor_wordsuint32_tlockedcaml_free_localecaml_trunccaml_stat_freeceilcaml_frexp_floatfremshort unsigned intmagicCAML_DONT_TRACKexception_ptrbase__namescaml__roots_quocaml_asinhintern_state/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beprecparser_traceint64_tintnatFP_zerocaml_gt_floatexp2caml_domain_statestack_cachecaml_init_localeminor_tablescaml_ephe_ref_elt__sigset_t__ctype_bprevcaml_alloc_point_herecaml__dummy_quomajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA XKpA~CDA8\GpA~CEA4XtIA~[ LAD I LAC $C AEA~OEA4 C AEEA~ HAA x(C AEA~Ir AFAB FABl AAA LDBFEAAGABH AAA LBl,$ 4CpA~DBA,0CpA~CBAL4CpA~DBAl0CpA~CBA4CpA~DBA0CpA~CBA4CpA~DBA4CpA~DBA 0CpA~CBA,8DpA~DBAL` t8DpA~DBA,C AGA~[ JAA 4DpA~CBA<EpA~DBA4CpA~DBA$4CpA~DBAD0CpA~CBAd4CpA~DBA,C AGA~c GAD LJpA~CBA0CpA~CBA4CpA~DBA8DpA~DBA44CpA~DBAT4CpA~DBAt4CpA~DBA4CpA~DBA4CpA~DBA4CpA~DBA4CpA~DBA0CpA~CBA44CpA~DBAT4CpA~DBAt0CpA~CBA4CpA~DBA4CpA~DBA0CpA~CBA4CpA~DBA8DpA~DBA44CpA~DBAT0CpA~CBAt8DpA~DBA0CpA~CBA0CpA~CBA4CpA~DBA4CpA~DBA0CpA~CBA44CpA~DBAT0CpA~CBAt4CpA~DBA,(0(H4 4 4 44 H4 \4 pX T TAgnu    X%\6A0tRh{H` .x(CV_flz,$ 8P4hh0 4!0&,4=0BH4Y4jp0u(8@X p84<4"&47=0BG4W0glHL|`0x4844(4O4Y4 4 84"P0'-h4>4NS0X^4o4048(4@0X8p0044 0%)480=B4R0,`H(t`0x(H44444 48XPT3hTGfloats.ccaml_init_localenewlocalecaml_free_localefreelocalecaml_copy_doublecaml_alloc_point_herecaml_failed_assertcaml_alloc_small_dispatchcaml_bad_caml_statecaml_format_floatuselocalecaml_alloc_sprintfcaml_hexstring_of_floatmemcpystrlencaml_copy_stringcaml_stat_alloccaml_stat_freecaml_float_of_stringcaml_string_lengthstrtod_lstrtolldexpcaml_failwithcaml_int_of_floatcaml_float_of_intcaml_neg_floatcaml_abs_floatcaml_add_floatcaml_sub_floatcaml_mul_floatcaml_div_floatcaml_exp_floatcaml_exp2caml_exp2_floatcaml_trunccaml_trunc_floatcaml_roundcaml_round_floatcaml_floor_floatfloorcaml_nextaftercaml_nextafter_floatcaml_fmacaml_fma_floatcaml_fmod_floatfmodcaml_frexp_floatfrexpcaml_alloc_smallcaml_ldexp_float_unboxedcaml_ldexp_floatcaml_log_floatlogcaml_log10_floatlog10caml_log2caml_log2_floatcaml_modf_floatmodfcaml_sqrt_floatsqrtcaml_cbrtcaml_cbrt_floatcaml_power_floatpowcaml_sin_floatcaml_sinh_floatcaml_cos_floatcaml_cosh_floatcaml_tan_floatcaml_tanh_floatcaml_asin_floatasincaml_asinhcaml_asinh_floatcaml_acos_floatacoscaml_acoshcaml_acosh_floatcaml_atan_floatatancaml_atanhcaml_atanh_floatcaml_atan2_floatatan2caml_ceil_floatceilcaml_hypotcaml_hypot_floatcaml_expm1caml_log1pcaml_expm1_floatcaml_log1p_floatcaml_erfcaml_erf_floatcaml_erfccaml_erfc_floatcaml_copysigncaml_copysign_floatcaml_signbitcaml_signbit_floatcaml_float_compare_unboxedcaml_neq_floatcaml_eq_floatcaml_le_floatcaml_lt_floatcaml_ge_floatcaml_gt_floatcaml_float_comparecaml_classify_float_unboxedcaml_classify_floatcaml_locale2@20, :2B@b2f@| 2@2@ZXC 22 0 0    R2V@h   2X0X$ 0! H" d# 2`&0`( @$ r2Hz0H& 2@' $  D( ) ,# h$ r2h ~0h * 2 0 2 0 D h      04 D l6 6  9 9 $ L< <  ?  A 4A H  F  Z X CDH L `I 2x20x0 ) () < `M t O  Q Q $ NZVX\CT   I "2x&2.0x204 R2Z0h xV  X X  $[ 8 `] t _  a   c 4 `e t g  i  k Pk d n  p p  @s T |u u  x  0z D l| |    @ T      , ` t  &3&` 30&83H&@P3`&h3x&3& 3& 03& `3& 3& 3& 3 & (38& @3P& X3h& `p3& 3& 3& 3& @3& p3& 3& 3(& 03@& `H3X& `3p& x3& 3&3&3&P3&3&3& 30&@83H&PP3`&h3x&3&3&P3&3&3&3&P3 &(38&@3P&X3h&@p3&3&3&3&03&p3&3&3(& 03@&`H3X&`3p&x3&3&03&p3&3&3& 3&P 30&83H&P3`&h3x& 3&P3&3&3& 3&`3&3 &(38& @3P&X3h&p3  z &* 1 8?)F&R ?Y=`g`xo+&    MvBb6IU7frk  { ~, 2 `8h> DJ uSXQduB a &4CBP Q^:l/z gL, > } : 8  "0>LZh `v8 s^g a (4@5L}Xqd5p|df o  +$w0qBZOg0t n9  f #,- L9 FS v`cs Q}m .  l(3 :AN 'mBz]  nt Y !  , :D F] `  z  n t   4 R ]    ( n 5t J' QL ` lZ ~?           & g  q  $ * 1 L v      L    0  F \ rN    X  5 U k~ -   (> U l - CZc$z?j  SO-MX&y }  && ? 7 l b   % 0& Q U k&(t&(       & 8 0& c [2=&`] a s~&    &   & $ 6g ^r&  6 2& &  L H R& b ^" x& t/&8&S W ` d j&x&P  &P   &h&x .9&Y ] f&o   &&R&p  &p u  &'&5@&0` d m&0v j  &H&X&y& ( $ >" :+&4 ZD TH PQ gU eZ&h&v"&  t p&8&H&  ' + 0&=& K V&v z & O  &&*&0  &H&X+6&V Z c&l D|  &&q&   &&  )&@6 $:  C&@L 9\ 8` 6e&Xs&hz& E A&&}& [ W&,&:RE&Pe qi mn&h{&x|&  &(&8&   &&'2&R V [&h&v &P  &h&x &     &,&<&W1&Q  U ^&g .w { &&P4&P 0 (&l&& &@> ]B SGpS1^ b j    !& -  &&&(&D&<U&b&xy A&  & #  &&(  & 5  9  >& K& Y 2 d&P   &h &x  &     &0! &@!!"&!B *!F &!T C!X ?!]&!}!& ! _! U!p!1! ! !!!7! ! " " " "'&"< -"G "K "Q&L"i&P"v&h"&"&"&x""& " " # # # & #& #%X#0& #Q #U #d #h #w  #{ #& #& # # # *# (# 5# 3#& #$  $& $4 B$8 >$F X$J T$S& $\ $l n$p j$y $} $& <$& L$?$#$& $ $ $& %& %%& p%= %A %J& p%S %c %g %l& %z& % %j%& % % %& % % % %& & & (&&4&?& &_ &c &l& &u & & && && &&W&& & & && 8'& H' '& '? 'C 'Q 3'U /'Z& 'h&'s& ' I' E' _' ['& ' ]'& ' u' q' ' (& ((& (; (? (M (Q (V& (dR(o& ( ( (& ((& `( ( (& l( (& 0) ) )& H)7)B& )b  )f  )l C)w&)  -)  !))  p)  ^)  )  )  :)  "*  *  *:*  *  *.  W*2  O*7*?& \*H&0*f  *j  *t&$*} *  *  *  *  *  *  * *  %*  *  b*  X*  *  *  *  *  *  *  *  +  *+  "+ +*  \+.  P+7 +D  +H  +R +[  +_  +d&L+ +  +  +&+&+&+&+&,& 4,& p,6& ,G&h,b ,, , , #-+x-5&-V  -Z  -_ -i $-m -r-| W- G- - -:- - - - - H- 4-|. . . . ..' b.+ V.8 .< .K .O .T y.g .k .p&,.&8.&P. n. . .k. #. . . [. W. / x/ j// / /"&l/:&0/O&`/_&H/t /~&@/ / / / / / / #/ / / ?/ ;/&p/&0&0, '06&0U b0Y N0h 0l 0q  0z 0 0 0&0 50 0 0 50 0 0&0 0 0 ,0 (0&1 &@1 @1! ?1% ;1. T12 P1; @1D k1H c1M&1^& 1k&1}&1&(11&`1&1;1&1&42&2 2-K29a2R2c 2o 2z212& `2 2 2& t2& 2 2 2& 3& @36 3: 3?& T3\& 3w 3{ 3 3 3& 3& `3  3  3&4 &4 "4&4.&4I ?4M ;4R&4o&4 X4 T4&$4&4 q4 m4&4&p5 5 5&52&`5M 5Q 5Z 5^ 5c&t5&5 5 5&5&5 5 5&6 &6' 6+ 60&6M& 6h  6l 6q&46&6 96 56&6&P7 P7 N7&7? 7C 7L 7P 7Y 7] 7cZ7g *$ *$ *$ *$&T&&<`\@p  0 `      0 `P p   @ p  0 P `d x  P(Hh@P8PXxP8@Xx0p8 X`x0p8X xP P  $ 8` L ` t  .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @4@h&t,x12xE @@xJ$\$7nW@x^ h\6{bTv@=` xF0@>X0xvz @>000  @>oL`X SF8gc_ctrl.bd.o/ 0 0 0 644 91624 ` ELF_(@@||~x8`;!aH`|N >8!x|N ``<A99@9!8apAAA!H`=BJ=")j||@L,=")||@L,8`H`!pa,)A! `B H`|dxaH`!x,)A! `B H`|dxa8cH`!,)A! `B H`|dxa8cH`a{88cH`a{d88c H`!a|J8c(x8H`a88c0H`!a|J8c8x8H`!a|J8c@x8H`A!a|R8cH|HPx8H`a88cPH`a88cXH`ax8c`8H`a{88chH`!a|J8cpx8H`H`xda88cxH`ax8c8H`H`xda88cH`a8!`a|N ``y*y)B}JKxA `B !*H`|dxaH`!x,)@py*y)B}JKxA `B !*H`|dxa8cH`!,)@`y*y)B}JKxA `B !*KL<A8HH`8!|N ``<A9Ap9 88^89A!9jp!A!!!xH_,*AH*,)A!*,)`BA!*,)`BA!`B*H` aH` aH`|fx8`H`8!|N y(y)B}Kx*,)`B*@At9p9@9!j8` A!pAAxH`?a,)A\0x8H`=")ax8c8H`=")ax8c8H`|<| @L,ax88c(H`=")ax8c@8H`=")ax8cH8H`=")ax8cP8H`a8!|N ```<j!a),)AH|x8`H`,?@@;;pk|c4Tc~H`H`xH`!rx. @p;,@}>j),)AdI8`9JIH`8!x|} N ```}>j),)@<,)APIx}JIH``<K|?|~t<j88`@x!H`?,)A,I8!8`}JI|N <<>?r  !"1#H?? "     " % (( +0 .8 2.@ 63H 9P =X Al` Cvh Fp Ix L P T [ ` r t w y { }@   E        O( 40 O8@idO@ OH P .X .` h p x   Y c      O        8+sp0 1 3 :O; < < (id= 0 p.uspw x.  ElF 1G 8H sp 8 q@    { p:@;M< =M(> H?P@XA `B@h   J T ^@jmpAOBC h + &1 22 b$jkOl  6[Mfun val O old ! "  -./O0 "AH!q@# $ % & ' ( ) (* 0+ 8 7 8 9 : ; `D E F )r   /85 5 end5 5 ptr5 5 54(540 7 8 9 : 8< :< :end< :< :ptr< :< : <4(<40 > s? mem@ maxA 8C C endC C ptrC C C4(C40 ?" #H)rJ C      !"#$%&'()*+,-./01}    ! " # O "%& 4( * (+ 0, 8- @/ H0 P1 X2 `3 h4 p6 x7 8 9 : & =( &+*"5#H?3  4! O4"!B(#H+F3.OCbuf/( 55+ 5, .01Dw    )  : ,2 V' X> *P -83j O-W E[ F *-KG >I CR  4:   ,  O , H* C8 4@  e    6#6$,  4 .. T   e   O+ S T U S@T Up) .{OHvH.{~O. @$resS0T/9798&8rS|S T U SU@S T U  I8  #6  $res J%S TU %*S T U S T U S@T STTU1S@T U S TU DSTTU1wS T U S T U K 81L67S T U ,m6/S TUqqqq!S T U TS T U S T U S T U <1y$%y-kk,zS S T U mS ML SSH XX~ ZZ \\*S ' F]%vF+S T U I:P%v:#<NoutA8C 8rSS1 S`/S11S1'%v'),$i/ OXS  $@M$)PS87 /8rSFS5]S5S T U 5S5S T U +S5 %v+"8$ w8rS@>S1&S`S@S T U   %v)8 o8r SpS T U O@!!$i OP$res/9 !F79X!]S0PS!S4!S !S4S T U #jv$/#j\ "#{Q#"}S3"S jX"S0P"S`S38 #-8rS T U #0%O $v$R8 $ 8r$$S2$IS`$`S2S T U)v"        % %  % & &I  &r &  & &  S8'Z8T89898*'~S0'S1&'S T 'S T U:%( S (0S T:%(HS(_S0(S T:%(S(S T U)S T U)'S T )YS T U)~S T S T )'p))'p))'p$|. v|" ~~(resP!{O*{S T U$+] +O {$+ + {0,${$, , {$-  - {$- - {--S;S T U~j@/vj' ll!m!m!m(resm!m{~mOp .q .r ./y0/N!>./h!?.@/S0/S T UqS T Uld0vd*ff0g00S T Uf].1S T U_408v4) 66(res7!7{~7O: ::(s; ~1 > > 2- ??2BB2z!@5.{2!@5.@5."{3ICC3!@5.{3;!@5.@5."{3DD{3EE{T1$#4;FF{T1$#$4GG{4II{T1$5JJ{$5eLL{,5NN{5QQ{T16LRR{T16SS{6TT{T1$#$72UU{ 7WWp{7XX{ 8'YYe{8PZ8iS~8SBS T U680G+9'val8U    tO9#0tEVS T U I~ : ; 9 I8 4:!; 9 IBH}( H}H}  I : ; 9 I 8  !I :!; 9!I!8 4: ; 9 I: ; 9 I : ; 9!$ >  : ; 9 I8 4: ; 9 I?<.?:!;9 'I@z4:!;9 IB1B U1RB UX!YW :!;9 IB.?: ; 9 'I<.?: ; 9 '<.?:!; 9 'I@z:!; 9 IB.: ; 9 'I <.?: ;9 '< 4:!;9 I!4:!; 9!I"I#!I/ $4:!;9 IB%:!;9 IB&&I': ; 9 I(4:!; 9 I)>! !I: ; 9 *:! ;9 I+: ; 9 I ,-.?: ; 9 '<.4:!;9 I/1RB X!YW 0: ; 9 I1GI24:! ;9 I?<3 !!: ; 9!4 :!; 9 I854G:!; 9 6.?:!;9!'I<718:!;9 I941B:% ;$ > < = : ; 9 >5I?  : ; 9 @ : ; 9 I 8A!IBI C : ; 9 I 8 D4G: ;9 E.?: ; 9 '<F.?: ; 9 'I<G.?: ; 9 '<H4: ;9 II.?: ;9 ' J1RB UX YW K.: ;9 ' L.: ;9 'I M.?: ;9 '@zN : ;9 O.: ;9 'I@zP UQ41R1RB UX Y W S1RB X Y W T 1U V.1@z[AASABSABnBBS1&BBnBBS1&ABnBBn>>S@@S@@q#0?@l@@@@l@Al?@0@A0?@0@A0?@m@@m@Am?@S?? 0m@@S@@m@@o@Ao77T78m88T8:T:;m;;T;<T<=m78U8:k::U:=k88x188W::W78s8:::s:=9:m;<m:;099l;<l66S66S66S67S66S66Y66S/0S03S33S36S//S//S//S//S-.S..S..S..S,,#y#1#+(,,%#1#+(,,%#1#+(,-%#1#+(----X**S**S**S*+S))S)*S))o))o))o)* 0o))o** 0o%&S&&o&(S((S((S((o()S&&0 &&Ym&&0 &' 0m''S''Ym'' m'(m((S(( 01))m&'o'(o((0()o'' 0m((m((S))m$$S$$o$%S%%o%%S$$on$$n%%S%%n""S"#S##S##S##S##S##S##S@@0YX S !S!"S""S""S""S !0!!on!!oS!!S""oS""onSoSSS o Sonn S nSoSoSoSnnmmmllS1&1&%1&#1#+(%1&#1#+(%1&#1#+(%1&#1#+(%1&#1#+(1&1&1&ZmllZZZZZZZoxYYYSSSSmm0000 y1$#T2t1$#TT3t1$#TT5t1$#T8t1$#TT9t1$#TT:t1$#TTPSSSSSmm0!!@>>?S S S S S   o o S SS S S S o o 0k kl lm ml lm m 0ST S T 1 1ST S T 2 2ST 31$#T1$# 41$#T1$# 5~~"1$# 6 1 7~~"1$# 8~~"1$# 9~~~1$# : 1 ; 1 < ~1$#T =1$#T1$# >~~"1$# ?s1$#T @ ~1$#T As1$#T S==S==n==S==S=>n>>S,!t@@DHddlp|      !!""######$$%%&&((''(())))**,,,,,,----8888888888:::;;;889999;;;;;;999999;;;<??@@@@???@@@@@@@AAAAAAAABBBBBB~{ runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesgc_ctrl.cmlvalues.hfail.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hmisc.hstdatomic.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfinalise.hcustom.hdomain.hgc_ctrl.hgc_stats.hmajor_gc.hshared_heap.hruntime_events.hstartup_aux.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.halloc.hcallback.hsignals.h Y!//[!//9 !~$8&J.!// / -/<(7/ %XUt~X=/!/ .!3.? %/  / -! Xt =! .<t <<t <<<<<XXXX.<<.. <X... < .. .gJ .< <<r.X(X /J/  < J L ," :h ,0 9f.z=;/ .! . < H.X ! . < w=/!/ .!X[!  .2K -=2 !2-=  I#/ !/ ! /- ! ! / <  w<2= 2! K2 =2!2K E.XX=!-/ .!1 " " >/!.<.<...<...f. <<...<...<... .. pf.X\t 2 =! / !%-!!"0x !0</!X\?+  z. . .=j.B.. /Z]?=JJ.nJZ>YY JtX a . . %<3f.  /!`x (x (x D XtqX< E.  /!XX 2!Xi< 1<%=;/K ///K!/!1<yfL.f=;/=/p=K/=/K!/  .< UK.f.f!;/=/ ~.  ~ .qK.~f.fK///=K!/~!1<7~.f==-=K /+ (Y/Y* ...!//~f.c  .. X!=/~ f.qJLx !//~f00/ K1/~J 0 /~ /J.0 ,0. .J.0 , Li*",*"0;?K/-!< 0/-?ttJ2*$0>!/"  Bxt.Z PK w f  =[$#J/ *$/!guuuu. u. g s    s. !! pt.nz &z &z [ ` uf g s    !0 /[/ . <!9!.;// . <!Kt Kv Kv  .Kt  Kv  Kv  .0 ).!k    k  /6 $dj   a 4f  @\  /3  #! _ .! _J4 "2! .6.."f. tm j< Y g ! . a g.4 2\  X^ z .!<#! _ .tX &tiXt/X////<'.!' ! X.J./' = 3v3=3/3-/3!. /0#+!;//!!}3};!J <<*u t  '.} ' . }<.XTt1X1o<.!m  .100j '. 'i...i<t 'i.<.major_wordsc_stack_linksize_tallocated_words_resumedmark_stackEV_STW_HANDLERcaml_verb_gcmemory_order_acquireEV_DOMAIN_RESIZE_HEAP_RESERVATIONdependent_sizecaml_major_collection_slicecaml__temp_offsetbacktrace_slotephe_infoEV_FINALISE_UPDATE_LASTEV_MAJOR_EPHE_MARKmemprofcaml_init_gccaml_alloc_sprintfcaml__dummy_minwords_ramp_up_alreadyhandle_exnset_ramp_up_suspended_wordsramp_up_wordsextra_heap_resourcescaml_callback_resget_ramp_up_suspended_wordsEV_MINOR_GLOBAL_ROOTSshared_heapcaml_heap_stateEV_EXPLICIT_GC_FULL_MAJORcaml__dummy_vcaml_raiserequested_major_slicecaml_ref_tablecallbackcaml_runtime_randomizedepheslice_targetnorm_custom_majheader_tminor_wordscaml_gc_getis_exceptioncaml_custom_tablestat_promoted_wordslong intlocal_rootstrap_barrier_offlimitcaml_empty_minor_heaps_oncestat_forced_major_collectionsuintnattodo_headEV_EXPLICIT_GC_MINOREV_EXPLICIT_GC_MAJOR_SLICE__saved_maskinit_percent_freecaml_intern_statestat_blocks_markedcaml__roots_resvboolcaml_major_cycles_completedcaml_final_infomemprof_domain_sEV_MAJOR_GC_STWcaml_bad_caml_statecompare_unorderedev_runtime_phaseEV_EXPLICIT_GC_SETout_suspended_wordscaml_minor_tablesntables__atomic_store_tmpsigned charmajwords_finaltrap_sp_offgc_full_major_resinit_custom_major_ratiounsigned charinit_minor_heap_wsz__int128 unsignedbacktrace_last_exnmajcollcaml_custom_elt__atomic_load_ptrcaml_statefinal_inforesultcaml_alloc_tuplecaml_set_minor_heap_sizePhase_mark_finalnewpf_Booltablevaluehandle_valuealloc_statscaml_gc_policycharcaml_process_pending_actions_resEV_MAJOR_FINISH_CYCLEcaml_ephe_ref_tablecaml_paramscaml__roots_callbackextra_paramsmemory_order_acq_relmajor_work_done_between_slicescaml__roots_vPhase_sweep_and_mark_mainextern_state__jmp_buf_tagyoung_startcaml_result_privateinit_custom_minor_max_bszcaml_ml_enable_runtime_warningscaml_ml_gc_ramp_downcaml_current_stack_sizenew_verb_gcpool_max_wordsEV_STW_API_BARRIERsuspended_words_outersweeping_doneinit_custom_minor_ratiogc_statsupdated_lastcaml__roots_minwords_tablesreserveEV_MAJOR_FINISH_MARKINGEV_EMPTY_MINORtrace_levelcaml_exception_contextEV_MINOR_FINALIZEDsigjmp_bufcaml_gc_minor_wordsvunitcaml_gc_ramp_downlarge_max_wordsnorm_custom_minEV_COMPACT_RELEASEruntime/gc_ctrl.cEV_MINOR_CLEARnew_custom_majminwordsoo_next_id_localminor_heap_wsz__uint64_tcaml__frameEV_STW_LEADERlong unsigned intcaml_runtime_warningsforced_major_collectionsdependent_allocatedcaml_custom_major_ratioslice_budgetexn_bucketresumed_wordsEV_MINOR_EPHE_CLEANcaml_gc_minorlongjmp_buffercaml_percent_freenew_custom_min__mask_was_saveduintptr_tyoungcaml_gc_logyoung_endEV_EXPLICIT_GC_COMPACTcaml_init_domainscaml_gc_full_majorcompactionsexternal_raiseheap_statsEV_INTERRUPT_REMOTEc_stackfinalisableEV_MAJOR_SWEEPcds_fileEV_MAJOR_MEMPROF_ROOTScaml_runtime_is_randomizedgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donelarge_wordstrap_barrier_blocksection_table_sizeEV_EXPLICIT_GC_MAJORcaml_ephe_infomemory_order_consumecaml_ev_endmemory_order_seq_cststack_handlercaml_ev_begindoublestackinit_max_stack_wszcaml_init_gc_statsgc_phase_tsuspended_words_innercaml__temp_valparentcaml_extern_statecaml_compute_gc_statsmemory_order_releasecaml__dummy_callbackpool_live_wordsbacktrace_enabledcaml_gc_setswept_wordsthresholdEV_MINORcaml__temp_resultunsigned intcaml__roots_blockEV_MINOR_FINALIZERS_OLDIFYintptr_tnew_max_stack_sizenewminwszgc_regs_bucketscaml_modifyforce_compactionrequested_external_interruptprowords_caml_gc_minor_words_unboxedPhase_sweep_ephecurrent_ramp_up_allocated_words_diffcaml_gc_majorcleanup_on_exitcaml__dummy_resoffsetcaml_minor_collections_countfirstblockcaml_get_value_or_raiseEV_EXPLICIT_GC_STAT__jmpbufcaml_alloc_2caml_alloc_3exe_namecaml_reset_major_pacingcaml_runtime_parameters__jmp_buf__atomic_store_ptrnitemsallocated_wordsnextproc_self_exeyoung_limitlong doublePhase_sweep_mainEV_MAJOR_SLICEworkEV_MAJOR_MARK_ROOTSruntime_events_log_wsizeruntime_warningscaml_ml_gc_ramp_upunique_idcaml_update_minor_heap_maxEV_MINOR_MEMPROF_ROOTStodo_tailcaml_gc_phaseallocated_words_directaction_pendingbacktrace_positemsizecaml_gc_quick_statbacktrace_buffersuspended_wordslong long unsigned intcustomcaml_ml_runtime_warnings_enabledmemory_order_relaxedprowordscaml_gc_counterspool_wordsupdated_firstpool_frag_wordscaml_change_max_stack_sizehandle_effectcaml_copy_doublemax_domainscaml_resultallocated_words_suspendedcaml_gc_major_sliceEV_COMPACT_FORWARDephe_refinside_stw_handlermincollcaml_minor_heap_max_wszEV_MINOR_LOCAL_ROOTS_PROMOTEcaml_custom_minor_max_bszcaml_gc_ramp_upcaml_failed_assertnew_custom_szcaml_gc_compactioncaml_copy_stringEV_MAJORchar_os__int128EV_MINOR_REMEMBERED_SET_PROMOTEhandlerpromoted_wordsEV_MAJOR_MARKcaml_live_stacks_memorybacktrace_activecaml_compactions_countstat_major_wordsmemprof_young_triggerEV_COMPACTEV_MAJOR_FINISH_SWEEPINGEV_MINOR_REMEMBERED_SETrequested_minor_gcyoung_triggergc_policysection_tablecaml_get_minor_freecaml_finish_major_cyclecaml_norm_minor_heap_sizecaml_gc_message__atomic_load_tmpcurrent_stackatomic_uintnatshort intEV_MAJOR_EPHE_SWEEPuint64_trequested_global_major_sliceminwords_pool_live_blocksgc_major_resEV_MAJOR_GC_CYCLE_DOMAINScache_bucketverify_heapEV_MINOR_MEMPROF_CLEANextra_params_areatag_t__valexn_handlerlarge_blocks__int64_tcaml_custom_minor_ratioextra_heap_resources_minoryoung_ptrunitcaml_local_roots_ptrEV_MAJOR_MEMPROF_CLEANmajwordsasize_tdls_rootmlsize_tstack_infostat_minor_wordslockedcaml_fiber_wszEV_COMPACT_EVACUATEEV_DOMAIN_CONDITION_WAITnorm_pfreeEV_MINOR_LOCAL_ROOTScaml_minor_collectionshort unsigned intmagicfinal_todoexception_ptrbasemajor_refcaml_result_is_exceptionintern_stateEV_MAJOR_GC_PHASE_CHANGEHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatrunning_finalisation_functioncaml_max_stack_wsizeevent_traceatomic_boolEV_MINOR_FINALIZERS_ADMINcaml_domain_statestack_cachecaml_gc_statdeferred_wordsminor_tablescaml_ephe_ref_elt__sigset_tEV_MAJOR_MARK_OPPORTUNISTICdataEV_MINOR_LEAVE_BARRIERprevcaml_runtime_variantcaml_runtime_randomizeEV_FINALISE_UPDATE_FIRSTlastmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 8@C ACCA~f HAA C FAC 4T0C AHA~ GAC 0BU CB G DA A AFA~EA0C AEA~I DAC NDA4@C AHA~E GAA ,,C AFA~V EAD <\E AGA~W KAB $HA~X DAD $HA~` DAD FA~L BAD (C ADA~T DAA D<C AIA~Fg HAAFD U HAAFB EA~UDA,BI DA A AFA~EBAE$D ACA~yCA$DpA~F BAD LBA($<<4PKA~] IAC ,TpA~JBA@C ADDIA~Fu JAAFD AU0BCG DD A AFA~EAAE04pC AGA~g FAA 0hC AJA~G GAA IHAAgnu @   +7Og 0  1BNf~0H`@5xAYe!/K^r 8Ph#4$K<f|, (p/<@Qixgc_ctrl.cgc_full_major_rescaml_ev_begincaml_gc_logcaml_finish_major_cyclecaml_reset_major_pacingcaml_process_pending_actions_rescaml_ev_endcaml_failed_assertcaml_major_cycles_completedcaml_minor_collections_countcaml_compactions_countcaml_gc_quick_statcaml_compute_gc_statscaml_alloc_tuplecaml_copy_doublecaml_modifycaml_current_stack_sizecaml_live_stacks_memorycaml_gc_minor_words_unboxedcaml_gc_minor_wordscaml_gc_counterscaml_alloc_3caml_percent_freecaml_verb_gccaml_custom_major_ratiocaml_custom_minor_ratiocaml_custom_minor_max_bszcaml_gc_getcaml_minor_heap_max_wszcaml_gc_setcaml_norm_minor_heap_sizecaml_change_max_stack_sizecaml_gc_messagecaml_set_minor_heap_sizecaml_update_minor_heap_maxcaml_gc_minorcaml_minor_collectioncaml_bad_caml_statecaml_raisecaml_gc_majorcaml_empty_minor_heaps_oncecaml_gc_full_majorcaml_gc_major_slicecaml_major_collection_slicecaml_gc_compactioncaml_gc_statcaml_get_minor_freecaml_paramscaml_gc_phasecaml_init_gccaml_init_domainscaml_init_gc_statscaml_runtime_variantcaml_copy_stringcaml_runtime_randomizecaml_runtime_is_randomizedcaml_runtime_warningscaml_runtime_parameterscaml_alloc_sprintfcaml_ml_enable_runtime_warningscaml_ml_runtime_warnings_enabledcaml_gc_ramp_upcaml_callback_rescaml_gc_ramp_downcaml_ml_gc_ramp_upcaml_alloc_2caml_ml_gc_ramp_downcaml_runtime_randomizedcaml_fiber_wszcaml_max_stack_wsize$ .2608 H P \ ZXC 2200"00$ NZZX`C 2@2@2@ ! ," P! d" ! " " " " " (" L" x" " " " " " # " 4" <$ T" ! " ! " B2F20N0R00T zZ~XC220"0&00, ^ZbXdC% ! 220000 % ! Z*X0CpC% ! ! $! @( 220 0 00  "2 &20 .0 200 4 ^Z fX hC C " 2 @ " 2 @ " *2 .@ L" V2( Z@( p" z20 ~@0 " 28 @8 " 2 20 0 00  "2 &20 *00 20 4 1  2 2 @ 2H 0H 3 &2 *@ >Z BX DC b2 j0 p3 z2@ ~@@ C 2H 0H  2p 0p  4  "2 *0 , 85 N2 R2 TC ^0 b0 d 2 20 0 00  2( @( 20 @0 28 @8Z2"X(C.003 R2V20^0b00d 20@02(@(2h0h3  203 "28&@8^ZbXdC 7   8 2200  9 NZRXTCx 20 ;     8 220"0$ 09 VZZX\C 8 2200 9  0> < P 2200 9 ZXC ( 0 < `C C220C000  @8 R2V2^0b0d  9    9   :Z>X@Cv2z20000 2H@H1 2@@@ 2@2"2&@*@>2B0P ^2(b@(z20~@028@82P@PE F 2 0 H 2262>0B0D N2R0TH 2020"Z&X(C:2H>@HV2Z@j2(n@(20@028@82@C20C&2 *@ V2XZ@Xv2~0M Z2X2C00 220000 22620F0R00X 20C220000 2X@XJ2XN@Xv2z200 2X@X2hZX 0hC 3 hCxQ C203 C62:2>0@CN0P f20r00t CQ 220000C 220000 22620>0B00D b2f20n0r00t ZXC220000 NZZX\CP T C D9 R2 V20 ^0 b00 d 2 20 0 00  Z X 2 C 0 3 !"2!&20!*00!20!4 &3&@ 30&p83H&PP3`&h3x& P3& `3&P3&@3&P3&3&3 &(38&0@3P&X3h&p3&3&3&3&3&@3&3&3(&@03@& H3&&&)& *&(+&0,&8-&@/&HB&PC&XK&    &*1 8=K Y `8g*nOu |2 t32P3 :d"05MS Y__ pek r#{R $=,K\Y(g u% +Y 8 ) +9iG Uc q4_^a T BY!t-9%E eQkwA   F+7CO B[ gs"sGb  !B9ER_r8|E }Q" l&A3KU H_i ,]4& @-N 3Zt GhGB_ p   % 2 ? L Y 6 f s         D       &4 2X > X r$ G L   -  o   $ G -L @y LW t   $ G L   L  u #v ) h / 5 ;r A ? Gi M W S Y _$ e k q w }s     < T   =  U Y  -   +  C  C   \    t 8 % + 1  7l = , Ds P \ ie v2  A      U  N % { } $81>KHX e r tQ ~ )6 N]X&nW&w ])V&,a ( ?QYk*s789M   +Afq|i@ Z-& d $  ) 4 *8 "A& J Z U^ Qc&!<t&0&& &&@g j dk   ! , 0 CS)^ b g      &&&& ~   & L+& (4 D 7H 3M& ^&0k&}&& l&0&& g V F!, 0 5U@ D I` d i t  x &\ &X +  &|&0& E& &0&/&8 dH (L $Q&b&0o&&(&h&&&&X &!&E&LZ&0g&x&|&0&pp&@f ? 7&&%&7bB&Yd hh bny&f  &&&&&"&7&0D&U&`j&0w&&&0& n&  \&  &G1&HfS W \&q&{&L&&&\&&   &X(4? ^C \I&t^ju y    &&X&&&&0% ) .&?&0L&^i&    &  K G&&&&0&=&QN\&| t f    \ T&0&8&D&   z&0& G&^&s&0&& &H&l&&&&' + 0; ? H&XQ a e j&x&$&8&D&X&&&  &P 3 , 7  @& I  Y d ] ` b& p& & & & &  &  } {! ! ! ! &l!)&l!G&P!^&X!k&d!&,!&@!&!&!&,!&0!&!"&@"' "+ "4&t"=&t"Y "] "g&"~&"&"&"&"&"&"&"&# # # # &8#.&#;&,#L&#Y&#k#|u## @#&P# <# .## y# w#&# # # $&($&$%&$2&$J&$a&$n&$&$&$ $& `$ $ $O$ $ $$ $  $$ )% %%<% >% 8% <%% `%) \%. o%8 %< %A@%K  E%O  ?%T& %i%u%  i%  g%& %%%  s%  q%& $%%%  %  {% y%&&  &  &&&1&=&J &S&_&i  &m  &s&&&& &&&  &  &&&&&& 0'& 0'!  '%  '.& 0'C  'G  'P  'T  '[& 'h& '& '& $'&H'& x'&'& (&H( & (&p(1& (I& (`& 4(u&(& @(& l(& (&(& (&0(&)&8)&)(&l)=&0)J&)Z&)u&h)& )&)))))& P*  *"  *'k*3 *=  3*A  -*T*b*l  O*p  K*u d*~*  d*  `* 2*  y*  u*& *& <*&0*&*& **  +  + 2+  +  +& +0+<+F  +J  +P& +^& +s+}  +  + 2+  +  +& +++  +  +& $+& $++  +  , 2,  ,  ,& T,%& T,:,D  ,H  ,M 2,W  ,[  ,`& T,u,,  6,  4,& x,& x,,  @,  >, 2,  M,  I,& x,,-  d-  b-& -!& -6-@  n-D  l-I 2-S  {-W  w-\& -q-}-  -  -& -& - -  -  -& -& -&0-&..&.7  .;  .@k.L .V  .Z  ._v.m.{./.?.  .  . K.  .  ..  %.  !..  8.  6.&H/ /  C/  A/&/(& /5&/O&,/i&H/& /&0/&/& </&0/&//&P0  S0  K0k0  z0!  v0& 00  04  09 Y0B 0L  0P  0U&0b&0o&0|&0&0&00&00&p0&40&00&1 L1&@12  16  1;k1G 1Q  1U  1i1w1  1  1q1  1  11  1  1 1  (1  $1 (111  ;1  71&222$  N2(  J2. 3272A  _2E  ]2J 22T  p2X  h2]&$2{&42&2&2 C22  2  2 22  2  2&X3 &l3&3<&3J N3S3]  3a  3f 23p  3t  3y&3&3&33  3  3 23 3  3&3&34 $4 "4 24 34 -4#&4<&4Q4[ W4_ U4d 24n b4r `4w&4&44 y4 w4 24 4 4& 4& 44 4 4 25 5 5&05&0525< 5@ 5E 25O 5S 5X&T5f&T5{5 5 5 25 5 5&5&55 5 5 25 5 5&5&66 6! 6& 260 64 69&6M&6b6l &6p $6u 26 36 /6&6&66 L6 J6 26 [6 U6&6&67 7 }7 27 7 7%&73&7H7R 7V 7[ 27e 7i 7n&7{& 7& 77 7 7 27 7 7&<7&<77 7 7 28 8 8 &D8&\8(&\8= 8G 8K  8Q&8j&8&\8&08&8]8888999(&9? .9C "9H&9Y&09f& &&X@pP0 P` `P@P@0,@T@8@l .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @!t@,&!,!12!E$X@@O'`J@8 Y'x9xT@Xn@ e`ysfi_v0@[0vx@[0G0  @[XoX ^8gc_stats.bd.o/ 0 0 0 644 34464 ` ELF@@#C})B|*H#@}*KxC$|)P@}ISx# #(C0|*|2 }: (})B|*H#(@}*KxC0$0|)P@}ISx#0#8D8})R#8N $c (C8})XP#$})(P#$})0P#$ })8P# $(})@P#($8})PP#8N C#|2}:}JBCD})R#N #$#$#$#$N 9 ####N ```|?;|xx!H`,@<_x?|2<}:=}JB_=BJ})R?H`,@08!|N |dx,)A8`8 @x;_ H`CxH`xH=")(P6,)A4x>9j;9 :Hx``|H*_8 ;?|2}:}JB_^})R?H(^P|)8@{BR@)`|WHCxJ@9,)A i_8 Cx);|J}Z}**|?H(^P|)8@{BRApx(P8!!Aa|N <K lockunlockFailed to allocate sampled_gc_statsruntime/gc_stats.cCaml_state_opt != NULL. A /int       ,.-A0 W.ZAlm1   3" 5#" 6#" 7 (  H k H k  H " y # y $'2( C E3FG .A' H O5  XN29 ; >a=qA?3" kkk"k%k (u(+0.82@6H9kP=kXA`ChFpIxLPT[`֠rt1wy{}#(= H(0284idH@HH=P7X7`hpxCMHWakU= p zu EFnG8Hp  @   4  % -  > H R \5&q%22f @#$ % & ' ( ) (* 0+ 8 7A8 9 : ;  `DnEF 855end55ptr55 5(50k 78 =9 I: = 8<v<vend<v<vptr<v<v <(<0 >? =mem@ ImaxA I 8C C endC C ptrC C  C(C0{  :k DA6k0 h7!H    " % & ( * (+ 0, 8- @/ H0 P1 X2 `3 h4 p6 x7 8 9 :  %=(   S T q F6 $ $8 e F  H1 ]2 $= }H5H S  (&   9z ( 'CH  &  H'H  `E(buf-  H) *i H:*s ) z+,  ;  -/$x KST )S T U  /$ xT  ST0U`  SpS )S T U :  }SST0U` FT {\4< sTs" SST` S ^p^1+_ b  c1 g S  S h/$-iZ S  SV(accV8 Y' S  S ZZ/$-[ S  S I!I7 ?!@!A 59acc6s79A+psacc+0 $Sh+NsTacc/ $ShMsT  ,! &Q='>a&b0"#m4 "#m;"?( #err4H$P2$S/T$0\ST$$S@ : ; 9 I8 1B :!; 9!I!8  :!; 9!I!8 !II~: ; 9 II $ >   : ; 9  H} 1RB UX!Y W  < :!; 9 I8 ( .?:!; 9!'@zH}&I14:!; 9 IB1RB UX!YW!:!; 9 I:!; 9 I :! ; 9 II!I/ :! ;9 I4:!; 9 I.?: ; 9 '<.?: ; 9 'I<:!; 9 IB .?:!; 9!' !!:!; 9 I".:!;9!' !#:!;9 I$.1@z%4: ; 9 I?<&.?: ;!9 '<'.?:!;9! 'I<(:!; 9 IB) U*4:!; 9 IB+4:!; 9 I,1RB X!Y W -1RB UX!Y W!.% /$ > 0 1GI2 : ; 9 3  : ; 9 4 : ; 9 I 85: ; 9 I 6> I: ; 9 74: ;9 I?<8.?: ;9 '<9: U;1.: ; 9 'I ?: ;9 I@.?<n: ; t S oSoSo 0 k(S#(k0 0 lS#Pl0 hh 0 m  m mm n nn   o n nn o oo S o S o S m m m oSSSYSSYY  SS     SS  SoSo  SS   o  SS   Y Z$$t$$ZYZt0Z,R  HLx|                      runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includegc_stats.cplatform.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hgc_stats.hstartup_aux.hshared_heap.hstring.hdomain.hpthread.h )%%!y.!xQ!!!!u (===u. !s. !r J!KM/!!!!/=====O/!!!/==!=O !! ! !$/M/!!(!|}<}. }.p..}[=! !| /KK!JT.}.J ..<.9}9aJ9m. 9}  .9}e.!!!!+ f!!!( p..}M!!!!! | !!!!!!!!!! -T.}. .<.}f"0-"""I./>//!- g-4/!--!! ]J.G  !! ! !$.>J.j>0>L /-!"0= ." +! "" ' f t  X/! 2x ! /==!< o.!n  ! 2n%+y!#!'& .!!!+ ~! ~.!"2  "!!!!! ~ #o.!n  ! 2n ."!#!J< .'v.tXb.Xmemprof_young_triggershort intcaml_plat_lock_blockingsize_tsizec_stack_linkdependent_size__alignuint64_trequested_global_major_sliceyoung_limitmajor_slice_epochlarge_max_wordsmlsize_t__sizeswept_wordsbacktrace_pos__builtin_memsettrace_levellong long unsigned intunique_idmemprofcaml_failed_assert__nextintnat_maxlimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffsample__int64_tpthread_mutex_lockextra_params_areacheck_errsigned charcaml_plat_mutexpool_wordsmark_stackcaml_free_gc_statsrequested_major_slicecaml_accum_alloc_statsint64_tcaml_stat_calloc_noexclarge_wordslocallong intpool_frag_wordsmajor_work_done_between_slicesallocated_words_directunsigned intstatscaml_minor_tableslong long intextra_heap_resources_minordoublecaml_collect_alloc_stats_samplelarge_blocks__pthread_list_tcurrent_stackbacktrace_slotslice_targetcustom__prevcaml_heap_stateoo_next_id_localbacktrace_last_exnactiontablesintern_stateruntime_warningsrequested_minor_gcallocated_wordssection_table_sizevalueproc_self_exemajor_wordsinside_stw_handlerlocal_rootsPTHREAD_MUTEX_ERRORCHECKblockcaml_fatal_errorstack_cache__int128backtrace_activeorphaned_alloc_statsgc_policylong unsigned int__kind__datacaml_ephe_infoGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_stateminor_heap_wszintnatinit_minor_heap_wszdependent_allocatedshort unsigned intcaml_orphan_alloc_statsstat_major_wordsinit_custom_major_ratioallocated_words_resumeduintnatcaml_reset_domain_alloc_statsheap_statssweeping_donecaml_custom_eltgc_statsintptr_tcaml_stat_freepool_live_blocksc_stackyoung_ptrruntime/gc_stats.c__ownermy_idbaseverify_heaptrap_sp_offyoung_startasize_tPTHREAD_MUTEX_NORMALstack_infoatomic_uintnatextern_statetrap_barrier_offsampled_gc_stats/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bemarking_donepthread_mutex_tcaml_ephe_ref_tablecaml_collect_heap_stats_sampleephe_infoextra_paramsfinal_infouintptr_texternal_raisecaml_paramsexn_handler__pthread_internal_list__uint64_t__elisionforced_major_collectionscaml_init_gc_statsorphan_lockexe_namecaml_accum_heap_statsnitemspool_maxPTHREAD_MUTEX_RECURSIVE_NPmemprof_domain_s__int128 unsignedyoung_endlockedthresholdslice_budget_Boollarge_maxunsigned charPTHREAD_MUTEX_ADAPTIVE_NPpool_live_wordsgc_regs_bucketsdls_rootcaml_ephe_ref_eltcaml_plat_unlockbacktrace_enabled__pthread_mutex_scaml_collect_gc_stats_sample_stw__countstat_minor_wordscaml_custom_tableinit_custom_minor_ratioinit_percent_free__lockinit_custom_minor_max_bszcompare_unorderedntablescaml_stat_blockpromoted_wordsstat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infoinit_max_stack_wszruntime_events_log_wsizePTHREAD_MUTEX_ERRORCHECK_NPstat_blocks_markedsection_tablecaml_compute_gc_statsmax_domainscaml_accum_orphan_heap_statscaml_lockdepthtrap_barrier_blockoffsetcaml_domain_stateallocated_words_suspendedcaml_domain_terminatingcds_fileminor_words__spinsyoung_triggeralloc_statscaml_gc_policymemsetephe_refreservePTHREAD_MUTEX_RECURSIVEevent_traceparser_tracePTHREAD_MUTEX_DEFAULTrequested_external_interrupt__nuserscaml_remove_heap_statsPTHREAD_MUTEX_TIMED_NPchar_osminor_tablesdomaincaml_plat_fatal_errorcleanup_on_exitshared_heapcaml_accum_orphan_alloc_statsnext__listbacktrace_bufferpool_max_wordspthread_mutex_unlockmajor_refaction_pendingstat_promoted_wordscaml__roots_blockcaml_extern_statecaml_ref_tableepheGCC: (Debian 13.2.0-18) 13.2.0zRxA ,p@PT0h$(|C AFA~^ DAA 0G AFA~b GAA TDpA~G BAA \GpA~CEA8E AEA~M FAC MFA`X`C AD HA~X BHACJAA A~L (( -H   >Tpk0PH0`$x4TG^o\`:gc_stats.corphan_lockorphaned_alloc_statssampled_gc_statscaml_accum_heap_statscaml_remove_heap_statscaml_accum_alloc_statscaml_collect_alloc_stats_samplecaml_reset_domain_alloc_statscaml_accum_orphan_alloc_statspthread_mutex_lockpthread_mutex_unlockcaml_plat_fatal_errorcaml_orphan_alloc_statscaml_init_gc_statscaml_stat_calloc_noexccaml_fatal_errorcaml_free_gc_statscaml_stat_freecaml_collect_gc_stats_sample_stwcaml_domain_terminatingmemsetcaml_collect_heap_stats_samplecaml_paramscaml_compute_gc_statscaml_statecaml_accum_orphan_heap_statscaml_failed_assert20 2(@(:20>@0J28N@8Z2@^@@h 20 20 20$ 62(:20>28B2@F@(J@0R@8V@@j@(n@0r@8v@@x 20 20  2H@H20 B2HF@H\" n2Hv@H2H@H2H@H$ % H& )Z)X)C% *  2@2$)C20  282P080P+ 282P080P+ &3& 30&083H&P3`&h3x&3&3&3&@3&3&3'&  &*168DRY "` gnu| @Zha]?(\4 "A N U[h 4u  `: b k&{2 >;JV}. d m"  E s "-8C @NEYdozn?V  -q   %1 KW cno {Q q ]1   ["#~/ ;kG$S_IqW{D E    M.:(?WI .SW] Ag .t  yO   { 'O4GT aoi| uQ?  x ' n 6 uOQ\?i | n uQ?   $ R ) S T Y & _ e kB q wz }     z A   (  r    p   , 9- F S ` ] m  z    z  &  &(  &H  *, G ^ ~ Z   b     & >  B  G  Q R U F Z d  h  m w  {      !    & & 9 7 & 1  H  F $ W ( U .& L& ]&P j&8 & F e _  { & & & &&(&P5&8F 4K&b l p u  &     &&&P &@'&d5:&Q [ _ d&&(&&    &m ) ' : 6&x( K, I6&$?N WR S[&,ds |w x  &&&,&4    &x  &) - 6 :  ?&P&[&q v& 7 /&" [ W& <  |  &&& ,&5GD H Q U _&hhRr v &pb      &&&pe/C? =D&y ~&&  0 . 8 6&$&$ @ > I G#&,; Q? OH [L YV&_&w e{ c p nF   &07&a& @  O  0 ^&n&&& &(&&&%&b&r&&&&(&&&$& &&8&0D0Xl@ \.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@I& , P6 1@P;2 (gO J@RY T@R( e# x#0xs@{ '0@}0'V). @}002;}0@ @@}B  FMglobroots.bd.o/ 0 0 0 644 57304 ` ELF@@|pi|~x!q@?;xH`,@?x8j8}(?9)?H`?x9)?H`,@\8!|N ``<9)>H`>x9)>H`,@=-9)), ALxH`,@="x8}j?9)?H`?x9)?H`,A|dxA;|(H,?x})_N!A(,>A<xI,*@|+xcxH`,>@``=-9)), @p?,>A;|H0`?x})_N!A(,>A<xI,*@|+xcxH`,>@``=-9)), @?;|H,>ADxI,*A?x})_N!A(,>@="=M)9J})jx 89 H`,@8!a|N `|+xcxH`K@```<@|K<@K|dxA;|(H,?x})_N!A(,>A<xI,*@|+xcxH`,>@``=-9)), @0??b{,>@0H?x})_N!A(,>A4xI,*@|+xcxH`,>@?,?A0?x8xH`,?@cxH`="x)=M})j9J 98 H`,@8!a|N ```<@Kx|dx 0"0  A 1int        ,.2 (  W. ZA l m3 3 5# 6#  7(  H k H k  H " y # y $4( C  E F G .A' H O5  X!N(!2!9 ;5% >1 S%cA?6 " ]]]"]%] (g(+0.82q@6vH9]P=]XA`ChFpIxLʀPʈTʐ[ʘ`rʨtwʸy{ }% H(0$87idH@HH%P)X)`hpx5?HIS]G%blgEFG18Hp{@   P  0:DN8 &c" 22qX"2"3855end55ptr55 5(50]718 %9 6: %8<<end<<ptr<< <(<0>? %mem@ 6maxA 68C=C=endC=C=ptrC=C= C(C0  ]`A)k0 h9!H : % B  ! "H  A ' Nkey( ) * N  ];A*  *#H )k% #. #0 #2 <ke =OLD>U  ? >$R H ;  $< U U  +CH o o@  H+H o$L H  A e  HB Cf 3D <E< ,e F G,r] SU0 "d '"o "z "" tS  S     S !S S T U  t   S !S S T U "I"T "zl"" tS  ZS S f--6"d`"o "zK"" tS  S B    S !S S T U $    S !S S T U     S !S S T UH"I"T "zx"" tS  ZS%f<> 2&e I &r]r=]-F%c  J* p* *" u"" ", " ;S #TJ"dG"" "dP"o"z"" S"I RX"T"zC"" ZS !ST"*< )"?"4"dB"o"z"" S"* {"?"4"dB"o "z"" tS  S"IDm"T "zX"" tS  ZS  r=] *""" ",Z " ;S #T"G"" "dP"o "z"" tS  S"IR"T "z"" tS  ZS !ST""" " ' " ;ST"G"" "dP"o "z"" tS  S"I8R~"T"z i"" tS  ZS !STStrt?]y *"*{"?"4"dB"o"z"" "*~"?"4"dBF"o "z8"" tS  "ID"T "z"" tS  ZS   S T UwKk 4vk2%` ?r`0]"b"." "  " ;S #(TS"G"." "dP"o "z"" tS  S"IR !"T "z "" tS  ZS !S(T0X"rX2]"*[!"?"4"dB!("o "z!"" tS  S"ID!"T "z!"" tS  ZS S(TU0 S T UZ%G"*G< rGJ]&pK U%@"I@< r@J]/"_'m4"_/"z'm;"_LM('err4H1BI~H} : ; 9 I8  :!; 9!I!8  :!; 9!I!8 !I1RB UX!Y W  1RB UX YW! 41B I : ; 9 I $ > (  : ; 9 < 1 : ; 9 I8 1RB UX!Y W .?:!; 9 '@z:!; 9 IBH}IH}1RB X!YW!!I/  1U:!; 9 I:!; 9 I4:!; 9 I1RB X!Y W  :! ; 9 I!:! ;9 I"4: ; 9 I?<#4:!; 9!I?$.?:!; 9 'I<%.:!; 9!' !& ':!;9 I(&I)>! !I: ; 9 *4:!; 9 I+.?:!;9! 'I<,4:!;!9!IB-:!; 9 IB.1/.:!;9!' !0% 1$ > 2 3GI4 : ; 9 55I6  : ; 9 7 : ; 9 I 88: ; 9 I 94: ;9 I?<:';!I<> I: ; 9 =( >.?: ; 9 '<?.?: ; 9 '<@.?: ;9 '<A.?: ;9 '<B.?: ;9 '@zC: ;9 IBD: ;9 IBE F4: ;9 IBG H1RB UX YW I4: ; 9 IJ1RB X Y W K.: ; 9 'I L.: ;9 ' M: ;9 ISoSoSTmTmoYooy  SS  mm  oonYnYnnnnUmm  oonYnYnnnU  SS  SoSoTmTm  SS  mm  oonYnYnnnnUmm  oonYnYnnnnUmm  oonnYnYnnU  SS   S nSnSSnTnSSnSn T oToSToSToTo T TT sss ss S nSn   SSn  S  S  n     S Sn  S  S S o S S o T S oYSo S o o   S S o o     S S     S S   o S o T S o    S o T S o     S S    S T SoTSoTSSSoSYYoT  S oT  S   SS  STSST0q00STSST0q00Sq#00q00  SS    SS  $S$nSSn$nSn$  $d  8@SS8@  l  SS  ,$$DHLPTXd8@l                                        runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeglobroots.cplatform.hstddef.htypes.hstdint-intn.hstdint.hconfig.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.haddress_class.hroots.hskiplist.hpthread.h !g!epX.|  |  |  <|/!/T.}.JV. f.<.}h .f h.> = ! .t .| . p.<}  X}/!/T.}J  <.<.}t!<=L r K.}J<Bp..|  | |  | Y! ! ..>K ! .f.| .p..}  }  J}/!/T.}.. : p<.}  } J}/!/T. ..J.<.<. }fR+ SX! /.Q !.;B.!tW / /N!.J 1<> K! ! . p<.|  |  | <.!#!# <.. }.p<.|  |  |  |!~  ~  ~  ~  ~ !T.~.XTtu < .<.atomic_uintnatexn_handlerrootlistcaml_skiplist_insertcaml_plat_lock_blockingcaml_delete_global_rootsize_tc_stack_linkdependent_size__alignrequested_global_major_sliceyoung_limitmajor_slice_epochgc_policymlsize_tskiplist__sizeswept_wordslong intbacktrace_poscaml_iterate_global_rootsscanning_actionunique_idmemprofcaml_failed_assert__next__int64_tnewvallimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnextpthread_mutex_lockextra_params_areacaml_minor_heaps_startcheck_errsigned chargc_root_classcaml_plat_mutexcaml_global_roots_oldmark_stacklong long unsigned intrequested_major_sliceint64_tpthread_mutex_truntime/globroots.cclassify_gc_rootPTHREAD_MUTEX_ERRORCHECK_NPmajor_work_done_between_slicesallocated_words_directcaml_minor_tableslong long intextra_heap_resources_minordouble__pthread_list_tcurrent_stackbacktrace_slotslice_targetYOUNGcustom__prevcaml_heap_stateoo_next_id_localbacktrace_last_exnactiontablesintern_statecaml_bad_caml_statecaml__nextrequested_minor_gcallocated_wordscaml_register_generational_global_rootvaluecaml_register_global_rootmajor_refinside_stw_handlerlocal_rootsPTHREAD_MUTEX_ERRORCHECKblockunsigned intcaml_minor_heaps_endstack_cache__int128caml_global_roots_youngGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned int__kind__datacaml_ephe_infocaml_stateminor_heap_wszleveldatadependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatmemprof_young_triggersweeping_donecaml_custom_eltintnatcaml_skiplist_find_ptriterating_rootsintptr_tc_stackforwardyoung_ptrcaml_remove_global_rootfdata__ownerbasetrap_sp_offyoung_startROOT_DELETEDasize_troots_mutexPTHREAD_MUTEX_NORMALstack_infocaml_modify_generational_global_rootextern_statetrap_barrier_offdls_root/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bemarking_donecaml_ephe_ref_tableephe_infocaml_scan_global_rootsextra_paramsfinal_infouintptr_texternal_raisePTHREAD_MUTEX_RECURSIVE_NP__pthread_internal_listcaml_global_roots__int128 unsignedyoung_endlockedthresholdslice_budget_Boolmemprof_domain_sunsigned charPTHREAD_MUTEX_ADAPTIVE_NPshort intgc_regs_bucketscaml_ephe_ref_eltcaml_plat_unlockcaml_skiplist_remove__pthread_mutex_scaml_scan_global_young_rootsstat_minor_wordscaml_custom_table__count__lockcompare_unorderedntablescaml_insert_global_rootROOT_PRESENTstat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infostat_blocks_markedUNTRACKED__elisioncaml_domain_statecaml_lockdepthtrap_barrier_blockoffsetbacktrace_activeallocated_words_suspendedPTHREAD_MUTEX_DEFAULTskipcell__spinsyoung_triggernitemscaml_gc_policyephe_refreservecaml_remove_generational_global_rootparser_tracePTHREAD_MUTEX_RECURSIVErequested_external_interrupt__nusersPTHREAD_MUTEX_TIMED_NPchar_osminor_tablescaml_plat_fatal_errorshared_heapsize__listcaml_skiplist_emptybacktrace_bufferpthread_mutex_unlocklistaction_pendingstat_promoted_wordscaml__roots_blockcaml_extern_statecaml_ref_tableepheGCC: (Debian 13.2.0-18) 13.2.0zRxA ,E ACA~\ EAC 0HFA~L BAD ADX AABAA \|AHF AAFA~\AAAACA~PAA AAAAA~DAA AFA~DAAA~4 F AEA~h DAA BZ^MCCBM BD GF AACA~[AA AAA~DAABCA AABCA~YAABABBACA~`AA ABBA~4 C ADFA~~ GAB 4C ADFA~t GAD    (  )CVez(0XOcH `x H #(globroots.citerating_rootsroots_mutexcaml_register_global_rootpthread_mutex_lockcaml_lockdepthcaml_skiplist_insertpthread_mutex_unlockcaml_failed_assertcaml_plat_fatal_errorcaml_remove_global_rootcaml_skiplist_find_ptrcaml_skiplist_removecaml_minor_heaps_endcaml_minor_heaps_startcaml_register_generational_global_rootcaml_bad_caml_statecaml_remove_generational_global_rootcaml_modify_generational_global_rootcaml_scan_global_rootscaml_scan_global_young_rootscaml_skiplist_emptycaml_global_roots_oldcaml_global_roots_youngcaml_global_roots&2*00 BZJXPCd | 2200 2000 2808 HF62(:0(< v2~0 ZXC  2000 2808 6!Z:!X<!Cr2v@z2~0 ZXC  2@$ 6Z>XDC`" v2z200 2000 2808 2@2@"2&06H:FJ2HR0HV2X b0vHzF 20 ZXC  *H2FD VZ^XdCt  2808 2000 2808 2000 2"@b2f@HF2H0H2 0 ZXC# J2R0\ nZvX|C  20 ZXC, D Z28^08` v2~02000 20 HZ F X C  H F 2 @  2H 6F F2H J@H Z H X F C   "2 &2@ .0 20@ 4 >2 B@ R2 V2@ ^0 b0@ d r2 v2@ ~0 0@  20 00  28 08  2 0  H Z "F &X (C  H F 2 @ 2 @ 8 J2 N@ Z2 ^@ t ' Z X H C F  22@00@ "2&2@.020@4 R20V00X f28j08l &3& 30&083H&P3`&h3x&3& 3&&&&H  %&*16iDR7Y @` gnu| 0k ^YSidg ) 6 CP ]j 'w  '0  D&n7Hoz /x m : c ^ q7*5 @;KValw N  B $   # =?IUaEm}y  |* " {  ! -c9IE[QAcYmp|% S^   = k ,`1 ; LEOY fw | " \ J   $2 ?Ys| " \ |# "0 \ELm sry D  8 /   4 A ^8 j& s N   #  *&  )& H (& *    .  " m < [ S u  $ Q  &     ! H % @ *& H E n I h N Z  ^  c& h z  ~  & | & %   &  ]     &` &0 &  ,& H 5h E  I  R  V  _ 2 c . lx y M } A | x & `   & & &< &@ & &  '  +  4  8  A  E  N& g  k  t  x  & # ! &  & @ & &@ & &  / +"& +; T? PH gL cQ&tb&8m& & *&    &g  &   ' + 0& A&0L&e& (n~ 9 5 L H q m    & @  & `& & %&@2&G& P` d m q z ~   +  Z V&  k i& & & <&@&)& 02B wF sO S \ ` iv z   & p  & & & l&@& & !  %  .& 7G 2K .T EX A]& n&8y& d&  f u  )&2A bE \O&|Xg ~k xu&8~&8  &    &  & &$&-&E I R V _&hw ({ &&& ; 9 E C&&4&4 X V &L&L- k1 i: u> sD&LY&4z&&    &  &&    &.&P7F J S W `&Pi'x | &dF     &&0&d&Q + )&\' >+ <4 H8 F=&hN&8Y&n&|& d& i Y&  &4'    &H-  1  6&`G&_&h7s  'w  !  A  =&B  f  b&\        &&0&&g.  2  ;& DrT  X  a  e  j&{&8& &&t}  (    _  Y&     &,&@5@  D  M  Q  Z&@cr  v  &L      #  &&0&L&|&|  F  D&&8  [<  WE  lI  jN&_&8j&&|G&0    }&`    &$        (&$1<  %@  #I&,R&,m  8q  6z  B~  @&,&  W  S  h  f&  {  y&        &.&09&K&Tc  g  p&y         &&8&&&h&& &5;&Z  ^  g& pF{  e  U*&&4    &D&&|`    *&&|k,  0  9&BR V  _ c h& y&0&& ; 7& ` \ s o& &8 & "& @t F& e  i  r&$ {     &$    &8 ( + ' < 8 &! &0!&8!-&l!61!E _!I [!R&![;!k !o !x !| !&!&8!&!&l!&!&!&"Q"  h"+ "5 h"J \"e9"{"&&&0&0*&$*&)&)&6&F&n&8~&8&&&0+&0S*&c*&)&)&(&(&&$&L&8\&8(&(&(&/&L&0_&|&8)&&&0(&&&02&O&8(&(& (& H(& X(& m& }& &0 &0 & & &8 &8 f)& v)& )& )& )& & & *&0 :&0 M& s&8 )& ,& I&0 o(& & &0 & & &8 &8 & &&0-&0B&R&z&8&8*&*& &&A&0Q&0e&u&&8&8 &&L0 .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.tbss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @o&,12TE@@PO J@P`T_"Z@F k2~7cy@HG0@0GJK@00Y 0f f@Hh l5hash.bd.o/ 0 0 0 644 27136 ` ELFc@@@= ̞a*-Q= |!a)5Tx>})!}#xTih>Tcx:|cJ})Q}#xTih>Tcx:|cJ}JAU)x>})A}CxTjh>Tcx:|cRU#x:|cRU)x>}Q})Q} xUHh>UJx:}JB=JT9Jkd})RxU*h>U#x:|cR}J9}JxUHh>UJx:}JB=JT9Jkd})RxU*h>U#x:|cR})Cx, @d=|jx|@A@= ̞=a)-Qa5})9U)x>})AUHh>UJx:}JB=JT9Jkd})RxU*h>U#x:|cRUJx:}JB=JT9Jkd})RxU*h>U#x:|cR}JI}IxU*h>U#x:|cRU#x:|cR})Y})xU'h>U)x:}):=)T9)kdy? @xi()A()A|()@H9@}$<̞=`-Qa5})Sx})9U)x>})A})xU*h>U)x:})R=)T9)kdy? 8!|cxxc |N ```}D*U)JUJ@.}JKxK|`9 }DK`8K@```}&($|t!1@;|wupx"@|A(p!A? d?@̞a?`xcZ-Qc{5c9j;h;:` :s@9?)x9) U*>( A=BJy)}*J})R})N h888```?),)A$Iix}IIN!A(= ̞=@a)-Q})aJ5U)x>})Q:})xU*h>U)x:})R=)T;kd|8@,7A```px!Aa|Wʄ>= }Jxa)k}JI=²a58!UI~})Rx})A} U#>|cJxxch8cN _?yJy)}YQy)$P9?xUJx>)}J9) }JxUHh>UJx:}JB=JT;kdU*>( @X``?_yJU)*})U)x>})})xU(h>U)x:})B=)T;kdA|=@}J })R{$q*}@P9Ap}JBA;:|=} *AXy)B9)})H,`|=96A8;:|=} I*A 6;}**B```|5@L :sALvv})Rx=@̞aJ-Q})x})Q=@K`?{ :H|~xK``{ xH:|~xK``{AxPH```|7:AX6{ H6|~x@K``_:}Iv}Hv})Bx}Jt})Rx})U)x>})K$`zzB~4@A?=̞=@a-QaJ5,6U)*})AU)x>})Q})xU*h>U)x:})R=)T;kdAl~<̞<`-Q`5x```H9}Iv}Gv}):x})Rx}))U)x>})1}#xTih>Tcx:|cJ})Q})xU*h>U)x:})R=)T;kdK@ `|xc"!H==@²akaJ5xi"8!p}#x|cA|Ti~})x})QU#>|cJxxch8cN ``C, A89 })t)})RC})y)9), @}#N `8`N runtime/hash.cstartenv <= len ) T*int)<*_,.+tW.Z5lm,-_ 9     X.NL;<>   @# ^  .  G  [ z # ( $ G0 %%8.c#<Gcc3[cLucuu`/e^<Y0p{c9cT,1tag91^2; c.ch 'c 3ch0 S S1% TT cl  c-c:cobjFc3 ord wr sz num h v clen {4PMi{len{! 6$8 G S T ^ S li{Tn  + !5S"Li{6{# 6[ G S T ^ 6% G S T ^   + !     S T U "i{7len{8 6$ G S T ^   + !   + !! 6%r G S T ^ 6 G S T ^# 6%  G S T ^  @       9 S ST:c ;5  Wh3s<clen {i {w S z z2$dz> !%| f} i~u n  Y Y3$dY@!%[ 5d\ i^( 5<^ S&h^&l^#ub hc lc Lp hL2dL=hiN loN''8 h83d8=n: '0 6h03d0?=+o jval8c>( j(@? H  ! +@ X A T 4:!; 9 IB$ > 1B41B: ; 9 III~ !I :! ; 9 I8 1 ( H} .?:!; 9 'I@z:!; 9 IB:!; 9 IB1RBUX!Y W : ; 9 I4:!; 9 I 11RBUX!YW  :!; 9 I&I'I4:!;9 IB  1U U41 :! ; 9!'.?:!;9 'I@z :!;!9 IB!1RBX!Y W " U#1RBX!YW $:!; 9 I% :!; 9!& :!; 9 I8 '.?:!; 9!'I !(4:!; 9! I)% *$ > + ,GI-> I: ; 9 .: ;9 I/.?: ;9 '<0.?: ;9 'I<1: ;9 IB24: ;9 IB34: ; 9 I4 : ; 9 5H}64: ;9 I74: ;9 I81RBUX YW 9H}:I;!I/ < : ; 9 =.: ; 9 'I > ?.1@z@.1@zA1SSsSS1YY1SSTTs1&S1&SYsy'Sy@%y' S S T T U U V V 0 ee 1 hhhh mm s1& g s1& g gggggggg u1& n n ZYsy'Sy@%y'nnnnSnSnSnSnnnnndd0:%oxo S S Y y 5 n Y yC# $  %! n00xdxxYYy Y y 5y Y y 5nYyC# $  %!nnYyC# $  %!nZnSsC# $  %!Ez &w'z'u?$  # %!v'C# $  %!nY y 5-z &w'z'u?$  # %! 50 xz:%3$Z z 5nZzC# $  %!ny Y y 5nYyC# $  %!nxZxYnnYYz1&ZnY y 5SoYyC# $  %!Sz}8$zH$!v!u!p?$  # %!{'C# $  %!Y Y yC# $  %! o s' S oT n T n S S0x|t| 0Y y 54z}8$v!u!w!p?$  # %! 5;z}8$zH$!v!u!p?$  # %! 50Z Y y 5 /t"z!w?$  # %! 5 0 Y Z 0SyC# $  %!sѲ~sS s QV'yC# $  %!sѲ~sS!!!!SzC# $  %!ZYyC# $  %!sѲ~sSzC# $  %!A!|?$  # %!ws'C# $  %!ZYyC# $  %!sѲ~sSsC# $  %!ZYyC# $  %!sѲ~sS s̚|'zC# $  %!s ]'C# $  %!ZYyC# $  %!sѲ~sSWWx %WWX!XX!XSSsC# $  %!BT|?$  # %!xS'C# $  %!SYyC# $  %!sѲ~sSTTT t|"t|?$  # %!(t|?$  # %! 5TZ z 5)T|?$  # %! 5 S S (sC# $  %!(,%t 5S'C# $  %!,0sѲ~04s4HSTTH t 5PSSsC# $  %!It &t?&'t'x?$  # %!zS'C# $  %!sѲ~sSlxYx| y 5|0t &t?&'t'x?$  # %! 5, T        runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/lib/gcc/powerpc64-linux-gnu/13/includehash.cmlvalues.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hcustom.hstdatomic.h 0J...   " ky ' y  'y '.   .   " kW! !- . <  < " R"H"  3 ?Y!! .< < " z ?..< < " 1u<, & 3  @sX < "  <.< < " R! .  2 M< " &w<5  < " kK=/ .OtJ !  #) 1! ! !$    Jw  e&#  ! I !    J&" . wf  &   . + tJ !v u  .!u <* ! ! ~t 1 ".$.J ,J . /# u~J. ~  . < J.X<.f<.2$<   # !  +T  ~ %* !~   g.~  ~ ~  . < +S  ,b X+  ~ 5  ~    . < + 5 !  /=5   X = /=5  !  =5J/ "/~  'y.' <   /  /z<  =  !B+b   K >> !J %~   ~     ~ '  . +   ! !0+  ~J ~    . < ~ X ;J~  ~    '   . < $4 !<  !% . X = /%  !  %J@ J  <,6 !  !.]~  'y.' . v+  ~ J~    . < %X#1!Z ,.   !!y  <!   - ! .)  5 y<#limitmemory_order_acq_relcaml_hashatomic_uintnatshort intintptr_tcaml_hash_mix_uint32caml_hash_mix_floatlong long intcustom_operationschar_os__int128Hd_valint64_tvaluememory_order_acquirecaml_string_hashaccucaml_hash_mix_intnatuintptr_tcompare_extfinalizememory_order_seq_cstidentifiermemory_order_releasefloatruntime/hash.c__int128 unsignedlong long unsigned intintnatlong int__int64_tstringcaml_hash_mix_int64custom_fixed_lengthheader_tqueuelong doubleunsigned charGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_hash_mix_doublehashmlsize_tsigned charuintnatcaml_hash_variantuint32_tunsigned int__atomic_load_tmpshort unsigned intcharseedstartenvint32_tcaml_failed_assert_Booldeserializecaml_hash_mix_stringlong unsigned intdoublememory_order_relaxed__uint32_tbsize_32countcompare__int32_tbsize_64__atomic_load_ptrserializememory_order_consumefixed_lengthcaml_string_length/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beagainGCC: (Debian 13.2.0-18) 13.2.0zRxA H,X@pTh(|C AEA~~ FAD lD DFG AB A AAACB BACA~FAAAAAAAAAAHHFDA A~F,hDpA~GDALTAgnu   HX20pFH[`oxlhThash.ccaml_hash_mix_uint32caml_hash_mix_intnatcaml_hash_mix_int64caml_hash_mix_doublecaml_hash_mix_floatcaml_hash_mix_stringcaml_string_lengthcaml_hashcaml_failed_assertcaml_string_hashcaml_hash_variant 2@   &2 *2 20 60 8  &3&P 30&83H& P3`&h3x&3& 3& 3& 3&  P&* 18]FpMT[bip4u>qv!'5-3<6A%Mdp|o~* < _#&    # G' ?-8& O X j\ faj n ||  & &         - )0 E4 ?B fF \T X g k x o| ? , (`& = ; J F&& &! _% ]. k2 i9& N& m&@ u s&\ @  }  &\   & `& `/& `D H Q U `& xj      & "& |  A 5  &         & @.&;&M V_ c y& a a  &4     4 ,& 0 q k  &0&&0F&0[ _ h l w&| K K&&&     &x  l $  (  - l 6  :  E& 4 O w ^ * b & k ? o = t w } K G & & H & z b  b Z     )  -  :  >  C& X\ b& y       J  &     e  G i  = v  | z  p  &          G 7 U _ t& u g   &P    &&& 0PDX l 0 P .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @ T@D & , 6 1@E;2 p O J@GhY T@G ewsQ/I0@a0/y0@ @aH00;f0?x ?\@axo@A CbPintern.bd.o/ 0 0 0 644 132152 ` ELF8@@C|ix9JjIN ```|y|#x!q|+xAD?,)@x?,)@8!N ```|<,)A08!x|N ```<8!x|N `||x!c,#AH`9 ?,#AH`9 ? ; 9 ?0|#@AH`9?  ?(8!|N |?aA|#x,<!aA(AE|x|+xCxH`|}yA<|Dx})\N!A(>|#H@\,#A H`8!Aa|N H<cx8HxH`xH<cx8HxHH````||~xA>;{$!J})R>H`>^|*H@A\{Ud?9)?cc*{{ggcc>;9>x``>|)@7;@;9;0!x|,:9 ;@;,)@8!AaN `#0,)A|<08!cx})>0a|N ``d88xxH`|iyA]8p}*}J*]A]}J*]=BJ{UdJ, =BJAJB;iRxcx8H`8!cxa|N ```<0K```JKtxHH````|?|}xj!1,>A\9!p9@9x>AAxpHH`a8!|N <$_H@8qEyJ`}IKx@>9(?(q*y)`AH88`x``9H|)0@y)>$_H@8`qEyJ`}IKx@|x>9(?(q*y)`AD88`x`9H|)0@y)>$_H@8`qEyJ`}IKx@|x>_9*? qA`9*? q@9I_IqHyJ`AH88`x``9 |*0@yJ>$ @8`qy`} Sx@|x,^ A|||#x<8H```|9@ 9 E%(#9)#H|ixx>>H~xH~ |8!N ```9@9 8!E%(C*9JCy) %%`B#I9)#yI %`B#9 9I)Cy) % N `8K||#x<8H`|=@aJ<@yJ|~xeJaJ!q #(}(HP P})tQ{|?8@@x8xH`|}yA` xH`~ 9> |#HA H` |}8!(|N <8`8H`xHH`||#x}&?|}x|+x!Aja!1A(_,:A h =(;|)@@9@9 ; _?} @``A?( A( A, @?9^_9),)?@;=:iWw>(?@(@W{>zb,7@Wc>H`||x``} @Kd_>;})R>} @KD>,)@;@K,``x;H`} K``(@W{vxW{>:8zDxxH]||x,*A=9 y)$|jI*z$9<9Wex~PP)*x~QH`=})=K`*A L={j}HR}JB}IN (DX0pD\  DD`{{h;Kh`Wf>~xDxxH]||x,*A=9 y)$|jI*(;xA=(|)@@9 x;K`; |#@AH`9=  =(8!!Aa|} N (7A(7A,=(|)@@:9@9<;[;=(x|)@@9@9 ;D$=(|)@@9@9 _?KxxH|xKDdxxH|{xKxH|wx8~xDxxH]||x,*A=9 y)$|jI*z$s{x~ųxH`=, })=At,7Alrx8~xAP,(A(,(@h8}L,:|L,9)x 8}L,,7|L,9)x A yJ}I9@|L,8} L,9@y} <,|<,9@y9 |D,}D,9I9) x8|T,}@T, xIBK~óxH`|{yAAt=```}(Kx9)=I, @@;888xDx8xH||x8c|;(Ii}IIN!A(|7@],*A=9 y)$I*;,)As@="))|xwKxH||xK89)=W>K$9)=V>zKd9I]V>K9)={ K9)=z K9I]t{;K,9)=4{;K8I9 :p~xy[ gGApaxH`,#A #|,)A<,)Ai,#A4|jH`?,)A$9@I|8!N <|KT|Aa=")})j!),)A|~x,?AxH`,A ;p8xxH`,#A,#@= 9Ata)p_|HA\m {j, @;;audxxxH`|#A?b;A;{ExdxxHxH`|}yAxxxH`|<@A0xxxH!, ?8AExdxxH,$AhxH8dxxHxH8!Aa|N ``;;auK`?,)A<A\^9@9!p9`>A,?ApAxA`?b8x;!;{|"H%xdxxH!a`H`|<@A,$AxHA!`, })_8?A%xdxxH8dxxHxH^8!0!Aa|N `?,)A|<$J@8qEyJ`}IKx@,9G}JAH|AT|#x{xH`>8!})>|N ```H`AT|#x{dxH`>8!})>|N ```H`AT|#x{$xH`>8!})>|N ```H`Ax,$@l|x```I  8c9)icCBx$"px8!N ``|pxH`|intern_input == NULLs->intern_obj_table == NULL%s: %sinput_value: unknown code module %02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02X%02XCaml_state_opt != NULLdecompression errorcompressed object, cannot decompress%s: %s %sruntime/caml/memory.hField(result, i) == Debug_free_minors->intern_dest == NULL(value*)s->intern_dest >= d->young_start && (value*)s->intern_dest < d->young_endobject too large to be read back on this platformbad objectStack overflow in un-marshaling value size >= 2ofs < s->obj_counters->intern_obj_table != NULLDebugger.function_placeholdercustom blocks serialized with OCaml 4.08.0 (or prior) are no longer supportedunknown custom block identifierexpected a fixed-size custom blockerror while deserializing custom blockIs_block (v)runtime/caml/minor_gc.htbl->ptr == tbl->limitill-formed messageinput_val_from_blockinput_value: not a binary channelinput_value: truncated objecthlen > 5input_valueinput_val_from_stringinput_val_from_string: bad lengthinput_value_from_mallocinput_value_from_blockinput_val_from_block: bad lengthMarshal.data_size: object too large to be read back on this platformMarshal.data_size: bad objectintern_state not initialized: it is likely that a caml_deserialize_* function was called without going through caml_input_*.V.T/ :Uint[(T(` ' (A )H *l , -: VT A z      W Z: lE mQWiX $: : z35#6# 7(cHlHl  H" # $Y(C =E=F=G $T :' HcZ O.5l Xu>NT(>2>9] ;][)() <i =? >i ?l5 D Et $) :?\"     " % (( +0 .]8 2@ 6 H 9P =X AZ` Cdh Fip Iix Li Pi Ti [i `] ri t wi y { } ] ]  ) ]iiii H(08]idH@HH)PX`ihip]x]]liii]iH]])' 'EZF 8G 8H ~p%'_@ ] ] .i''''^@<l>]AXI L OC ,RS ,US(,WX0,[T8@jmpA {BCoq'?&-22G)5l  - -2i-3i85 5 end5 5 ptr5 5 5(507 8 )9 W: )8< D< Dend< D< Dptr< D< D <(<0 > ~? )mem@ WmaxA W8C C endC C ptrC C C(C0 I :Hl .$ > ::?* P$ ` :?I   C,! H," hHl P! &" # $H% & +) (( $` ; : c ] ]( ;@ O    % # 9($ 0%% >86H )) 6] ) G )  i 6i 9 * c_ ` T :?F CI. {`buf/ T a +.5fd/H0 end1 2 max3 4 (55P55X6 i`7Hh8 p9 x 6.XXi]i`g- n:5l! DiEF FF-H!5l- *>+oarg, ]op1( $ S : ?a0) -)H) i) i) i) i )H(bb5 cO73pW).u5.t)5d$"._ CC ~-mWcK.!,)..H@HO7z 3 z H.O7QX "+.T 55O h#< >PO3)gc3)~)ea .X]HHXJc)%:)O7Z A>@&8 Af3&)8.Ail]_5]JboO^H5.S @eOH fxcmsg5Osl N-!A S  JU_SB 7!lenD] sl p] q]% _p _aT _bT _cT _dT _eT _fT _gT _hTB81!len>] slBf1!len>] slK}}1len}>]sl N-! S V&SSUKvv1lenv>]sxl N-x! S V&SSUo"fq !crzn N-! S #h fj 8kOC[N-! S atic  d!-N-! S Z9tAi\ 9 ]!-N-! S T sVl N-V! S LW LLN-sPl N-P!g S LQ MM HHNsJl N-J! S MK M*M4BHsDl N-D! S MAE MRM\<Hs>l N->!t S Mi? Mz6Ht5s8l N-8! S M9 MC& &3X"msg(}ST U q_S$T :g9X3 cf  &) -)ofs9)/ -H isl N:!NK O}  L MM M>M L4 LOLEL[LeLoLMM#L{L|4MM L :MM L uMM _ S  L_S )!;OlenH]"h]sl N:!!gNK O} K!STSU0. !ST U"!ST_S )"6ofsC]"h]@sl N:!"NK O} K"S. "ST U"ST8)$s=lh;$"obj )P -#---PSTU E$GFFFF&F2Qf$SS T U 5$kSTUP4S])$str2)ofs=)M$SSTT1&)'str2)ofs>]/'0i~H"h]sl"obj )D%)4S N:!&NK O} E&FFFF&F2Qf&SS T U  -'---PSTUK'5SU0. 'YSTU 5'STU'S T U _S )(+7)M(+SS))')/'0iH5"res)P0i~HD))).S))FS)^SS T U [)-[&5r] ]0^-~"h_]` sallH"obj )H N:a!*}NK O}  Lm *MM - +&---PSTU E+FFFF&F2Qf+SS T U M q +Mo, S?,.STU5?,RSTU. ,vSTU!,S?,STUK,STU5,STUH4-S-ES T U v-]S_-|S  8_-S  $T- :69:. !s:@l;2O!h<=$% blkAX resF .Nl4s9l,Oh?$E4 H M.M L4/sLOLEL[LeLo*M/9M#L{L|4MM L40@LOLEL[LeLo*M0M#L{L|4MM L41 LOLEL[LeLo*M0M#L{L|4MML40 1LOLEL[LeLo*M 1MOL{L|hM M L4 2LOLEL[LeLo*M 2M#L{L|4MML 3MM L.3BMM L3MM L3MM L3MM I4STT L47SL4OSL4gSISTT LMM 8)5s3lres<)/'0iHD5x)JU5S )S T U N D>s2l%O(oltag c WlenWWv )ofs  ?0 +ops5 spS d:::5:gE7 >:7S JU7S5SE9i iO N 8OO%OOO118vSS T U8SD>8STU3%#VP9SL9SH9ISTU V9|S T U H9STU VHSTU VM :M L:kL'LLV&SUK :K*NV :Nc  Gl <GGGG L7;QL'LLV&SU#GG#GGHH HH#H.H9HDHOHb8b =3HHwHm L<L'LLOHHHHHHHHHHMf=gML p=MM L ( =LLM4>M L>XMM MA <>MRM\L G>MM M S?ML ??OMM L V?MM Mi" ?MzM % @M*M4 Ly@@MM Lz @L'LL {@SP@SgASD>A=STU3%VD>AjSTUVFKASTFKASTLASD>ASTUVD>BSTU1VFKB/STLBGSLB_SLBwSLBSFKBSTFKBSBS T U JUCSIC5ST ChS T U 8CS T U 7CS T U FKCSTFKDSJUDSIST 8)Es9ldO(Wtag6cp O>EOcOWOK NnE1iOpkmEZSTUV1HE}TUV0mESTV1ES T U JUES 9FK!s<lHW+W/ W v )%/8YSGsYKlspZLG\ ] ^SG$`)GKGG%S4T JUG=S GhSTHV&GSU >jRG!sRGl90H]!s02l1!H]!len10W1Bl% i=W% _p=( _a=(T _b=(T _c=(T _d=(T _e=(T _f=(T _g=(T _h=(T9H!s1l H]3l% _p" _a" T _b" T _c" T _d" T _e" T _f" T _g" T _h" TC LIs 4l DOmsg'Oarg9Ov )IS TTUUVVJUISSC8JU5OmsgLOJGS TSUT RK;s6l KJK*NV JNc   1 Ks9lR,L;s3l;srcCk KS T UKS T US T U1L4s6l+#len0]& HLs.lresC c`n i<H%n7 ili$L;s2lres i& Ls7lres  &-Ms8lres -&MAs7lres &!Mis8lres !&sMs:l&`Ms<lmN- MS T US T UF{"l&f"lNVsil1_ Nns_9lFi1N+$)+5W%iW&(HN+(=<+ i%<+N<+i1O>tblACvL)mem2Wmax@Welt 1COp+D+D#]+D.HFH2N:PNKLNVuONcOS @S T Uw2-$Qf---S-Q7--!PSPPST PSJUPSIQST JUQ)S  JUIST 2ESFFFF&F2SF<SF= NRHQNNnNR9NN ~ N{RNN#NNS T URSTU0V1W0S T U SRS T U SlS3$SS T U JUSS 28TfCO[ N-!TJ S V&SSU2 U!- N-!T S V&SSU2cV&nz N-!U S #o'I~1B41BH} : ; 9 I8 IH} !I 1RBUX!YW  H} 4:!;9 I : ; 9 I : ; 9 I 8  U :!; 9!I!84:!;9 IB( :!;9 IB4:!;9 IB1RBX!YW .?:!;9 'I@z$ >  : ; 9 : ; 9 I:!;9 IB41 : ; 9 I8 1RBUX!YW :!;9 I.?: ; 9 'I<4: ; 9 I !I/ !:!;9 I"4:!;9 I# 1U$I% &.: ; 9 'I '<(&I) :!;9 I8 *1RBX!Y W +: ; 9 I, : ; 9 I8-4: ; 9 I?<..?: ; 9 '</4:!;9 I04:!;9 I1.: ; 9 ' 2.1@z3.?: ;9 'I<41RBUX!Y!W! 5>! !I: ; 9 6'I78.:!;9 'I@z9.:!;9! ' !: :!;9 ;:!; 9 IB<4: ; 9 I= :!; 9 I>:!;9 I?: ; 9 I @.?: ;9 '<A.?: ; 9!'<B.?:!;9!' !C.:!;9 '@zD E UF.: ; 9 'I G'H>! !I: ; 9!I !!: ; 9!J.?:!; 9!'<K.?:!;9!'@zL1RBUX!Y W MH}N.:!;9! '@zO 1PH}Q1R.:!; 9! '@zS 1UT% U$ > V WGIX : ; 9 Y : ; 9 Z&[5I\  : ; 9 ] : ; 9 I 8^ : ; 9 _I ` : ; 9 I 8 a : ;9 b4G: ;9 c.?: ;9 '<d.?: ; 9 '<e.?: ;9 '<f.?: ;9 '@zg.: ;9 'I h1RBX Y W i1RBUX Y W j.: ;9 ' k: ; 9 IBl.: ; 9 'I@zm.?: ; 9 '@zn 1o.?<n: ; )^^S^^o^^S^^S^_o^^SXXSXYSYYSYYSYYSYYSXXTXXoXYTYYTYYTYYTYYTXXnVWSWWSWWSWWSWWSWXSVWTWWoWWTWWTWWTWWTWXTWWnUV1VV0VV1UVVVUVXUVYVVxVVyxUVVVUVYVVxVVyxVVUVyVVxUVyVVx#UVyVVx#UVyVVx# UVyVVx# UVyVVx# UVyVVx#TT1UU1TTUUTTZSSSSS1TT1SSTTSSZRRSRR1SS1RRSSRRZQQZQQZQQSPPZPPZPP&yH$y8$"y@$"y"PP0zH$z#8$"z#@$"z#"OOZOOZOOy8$y"OOz8$z#"NNZNNZNNSMMYMMYLLYLLYSVSHHSHJoJJSJJoJJSJKoKKSKKSKKoHHTJKTKK8KKTKKTIJWJJ JJDKKWIJYJJSJJYKK vHISJJSJJSKKSHHSHH&vH$v8$"v@$"v"HHSIIKKIISKKSIIvIIxIIZIIxKKvII vII xIIzy!IIYKK vII0KK0IISIIYIISJJSJJ&xH$x@$"x8$"x"JJSJJ&vH$v8$"v@$"v"JJ&xH$x8$"x@$"x"FFSFFmFFTFGSGGSGGmGGSGGSFFTFGnGGTGGTGGnGGTGGTGGnFGoGGoDDSEESEE0EESEFSDDTEETEE8EETEFTDEo56S66n66S67n56T66U66o66T67o56T66U66o56 56S66n66U67U7766T67T77 66n67nDDSDDSDDTDDT@ASCCSCCq#0@ATAAmACTCCmCCTCDmDDTACjCCCCjDDjAC0DD0ACoCCoDDoBCSBBUCCUCCBBTCCTCCBBoCCoBBiBB BBo@@S@@S>>S?@S@@q#0>?m????0??n??0??P??S99S9<n<<S<=n==S==n==S==S=>n::S<<S==S>>S;;S;<m<=m==m>>S>>m9<o<=o=>o==m==::o::)H$~8$"~@$"~";;j;; ;;o;<U<<U<=;<T<<T<=;<o<=o==oSoSoSSoTSTTTTSTUnUnUUn0W0SuuSSxZxxYYY00SYSSoxZxYY0SYooxZxYY0oYo0ozzz z0oo oyXyZZ0oZoS0sH$s#@$"s#8$"s#"S&zH$z8$"z@$"z"0sH$s#8$"s#@$"s#"S&yH$y8$"y@$"y"0sH$s#8$"s#@$"s#"S&yH$y@$"y8$"y"S&xH$z~8$"z}@$"z"S&yH$y8$"y@$"y"0sH$s#8$"s#@$"s#"SmSSmTTq#8o08SS%m%%`%%S%1m11S15mT%h%%T%1h11T15hU%n%1n11U15n g!!g"#g&&g&')*g+,g,,,,g,--/g//g///0g0022g22g33g34g45g55g k#$k//k//k g!!3%!!U!"3%""3%#$g%%g%%&&g&'g'(Z*+S--g//g//g23Z33g44S44S!"k&&S&'g'(Z,,g--g..S//k00k23Z""Z"" l!"S""l##l$$S$$l%%S%&l&&S&&l''S''l'(Y()l**S*+l,,S--l--l--l..l00l00l11l22Y23l33S33l44l-.l//S//l//l01k33l55k//S// )*S*+k22S22k22S22k44k45S55k11lo h!!h!!o$$k%%k&&T&&t&&o&&S&&S--S..T..t11t11o11S11T11o11S33t34o44S44T44S11S55S*+g22S44g**3%#**U*+3%#443%#)+f22f22f45f++0440++1441++l44l++44 m""U""k""S""l""m$%m$%m''''g'(Z23Z''S''l'(Y()l22Y23l')m23m''S''l''m'(0((1((0((1()0))1))0))1))0))1))0))1230331((Y((yx22Y23l33Y((y((yx22y23((y((yy22y23((y((yz22y23((y((y{22y23 ((y((y|22y23 ((y((y}22y23 ((y((y~22y23((y33,,g,,S,,m,,8,,S,,m,,S,,s,,s,,s,,s,,s ,,s ,,s,,s,,m,-m,,&yH$y8$"y@$"y",-&H$8$"@$""--m--l--m..m..&yH$y8$"y@$"y"//m//l//m//&yH$y8$"y@$"y"//&H$8$"@$""//m//m//&yH$y8$"y@$"y"//&H$8$"@$""/0m/0&yH$y8$"y@$"y"000H$#8$"#@$"#"00m00m00y8$y"008$"00m00&yH$y8$"y@$"y"00@00S00m01k00S01g01SSnSSnSSnTmTTmTTmUoUUoUUoVlVVlVVl0SYxSY1UmSnSnTTooHHSm0S#0n S n T T U U V V S oSTSTUTSoSoo0\S\oSSoS0\T\xmxSTmS0\U\|n|S#UnS#S$YSoSSS o S S S oT k T T kU n U U U nS m  S m S mS S S k S S kSkSk T o  T T TToT U j U U jUjUj t  o T1 t T1otT1 # i  0# i YY nn YY o T1 T1 # i i 0  T"  T"  T"YZSZZSZZSZZSZZSZZSYZTZZoZZTZZTZZTZZTZZTYZnZ[S[[S[[S[[S[[S[\SZ[T[[o[[T[[T[[T[\T\\T[[n\\S\]S]]S]]S]^S^^S\\T]]T]]T]^T^^T\]n\\o\]Y]]yx]]Y\]S]]sx]]S\]Y]]yx\]\\]Z\]X]]P]]W]]V]]U]][,/,            """"""')23''''''''')23((((((((()))))))))2233)+222245++44,,,,....000000000000011155555666679999999999==::::::;<<=AAAAAACCBBCCBBBBBBBBDDDDDDEEFFFFFFFFGGHHHHKKHHHHHHHHHHIIIIKKHHIIIIIIIIIIIIIIJJJJJJJJKKKLLLLLLLLLLMMMMMMMNNNNNNNNNNOOOOOPOOOOPPPPPQPPPPQQQQRRQQQQRRRRRRSSRRRRSSSSSSSSTTSSSSTTTTTTUUTTTTUUUUUVVVUUUUVVUVVVVVVWWWWWXXXXXXYYYYYYYYZZZZZ[[[[\\\\\]^\]]]^^^^^_- runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesintern.cdomain.hmemory.hmajor_gc.hshared_heap.hminor_gc.hstddef.htypes.hstdio.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfail.hstdatomic.haddress_class.hsetjmp.hstruct___jmp_buf_tag.hplatform.hcodefrag.hcustom.hsetjmp.hio.hintext.hmemprof.hstring.hcallback.hsignals.halloc.hstdlib.h   w  !t!Y$==!!. Jx    \2J/.t="! X/ /.tL:0`"x"xD "o<60/q   !"! j!  .!..X",!<fg //0 //0p  0 l// ~!! J X z$4 z.l z B!J/2A  "./!%J. +!wJ //uJ !{ M  1.! ! t"  t  < t  .MXJ .  % J}/  .  ~   ~ !     ~!!!  ~.< /" .# <\/(@. q.X  ~!K" .. }J!  tJ    J X f! X /h!! -!00 p..<. rJ  02}""  } ""!""!%<|.} ..  !!.!2f jX   L}X. !=!!/!..0L"#0 ...x.  XX0{ "{  # ! !tz  z .!/ {G   . 9 !#$:C>  C  = !$ & ! {G   . 9 !#$:C>  C  = !$  {  ! {G   . 9 !#$,C>  C  = !$  {  ! {G  .9KC.= 4 {G . 9 !#$:C>  C  = !$  {  { !!<ff !-!!{=. !, ! !.%.. QJ!. Q !!{ # !.,  !{ -# !0{0={ #!3${J.. . |J0=0/$00!-3/0 /0.!/ /1N  /0$!$, !..)q<rY/Xu tu  <u  <u  f 0#..<    J# !f  /  <"}   . !/0 ! "  / f !~<  " 0nD  1!G"w. .<0 ."! . = !  /+ / + / ! !} " !} !}==.p$  k. Y  !  / - 1 - 1  "  #    <X. | // ~!! fX  ~<0.< X .." # ! "<J M <  6 ..   =r Y  !  / - 1 - 1  ! }#   =  ."t(J.<(  $(.(J $  ( f(X $( $( $(.$.  =  2 $!J !. >  !,   8 != !.. ! ! u  2  / - 1 - 1  ! &<.X Z"{    /! >  "!!! ! !   Y  !  / - 1 - 1  ! }  /<  J   |.    | # !  !  J & } #/  . !# .   !'|.  " $  .! !/ /   !  ="B > 0 | |. #! .! ! ! !<J ~ < /  ! !s  =x |!/  ! | # !   ! ! | .   !k | # !  ! | # !  !K |.  < !"| ! !  . ! | #1% y!% |  !|// %/ $  $  . |  1  K  "   . . M    J .! !.  i/' X =JX(}  (J $  u , I.Z   . . &2 . aJ{. J. g !J / ~f~J/X  {.JK =J {JJ.J~f/!<. >-/ .LHtdf.t"zz< z. z. z. 1,. <1g " 0!zz   z #! tX1!z K1 J3K !!X {.JK =f \J|JJ.J.z.   J3Y y<.=aJ*J.<=!-/!. /"0!/!J""/ =!/ .. x<.XX  @=/==!.y  yX ="y !/-/K)   ) . 1 {.J     " XK< JJ {<J.J. <  X6 t  f"yy<<y. 1,.=g =JX<yX.f"yy< y .y. 1:.=!Y .0 =J J y<."xx JK .""y  !y #!y<y  ! yG  9 !# $HC >  C  = !$ &  'y.!.fy .y!%)%  !  !i<y # y !!  !. B) )   Y ?7 ! <  ;)=.'JwJ1.<.<"ww JZ  4!<w<1c_stack_linksize_tallocated_words_resumedmark_stack__kindcaml_deserialize_block_1memory_order_acquiredependent_sizecaml_channel_binary_modeint32_tbacktrace_slotephe_infoDEBUG_clear__pthread_list_tmemprofuncompressed_data_lencaml_alloc_sprintfcaml_process_pending_actionsintern_cleanupnum_objectscaml_raise_out_of_memorycaml_intern_decompress_inputcaml_marshal_data_size__next__data__prevget_intern_statecaml__roots_strcaml_fatal_errorshared_heapruntime/intern.creserved_t__pthread_internal_listvchanintern_stack_overflowcaml_stat_alloc__ownerinit_intern_staterequested_major_slicecaml_ref_tableUNMARKEDcaml_failwith_valuecaml_deserialize_block_2whsizecaml_deserialize_block_4caml_deserialize_block_8dom_stcaml_input_value_from_bytesintern_obj_tableephedata_lenCAML_MEMPROF_NUM_SOURCE_KINDSslice_targetheader_treadvlqresultcaml_minor_heaps_endcaml_custom_tablesp_offsetcaml_input_valcaml_ephe_infostat_promoted_wordscaml_marking_startedread8ulong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatheader_len__saved_maskintern_resolve_code_pointercaml_plat_mutexcaml_intern_statestat_blocks_markedopcode_tcaml__roots_rescaml_final_infomemprof_domain_sdataintern_dest__nuserscompare_unorderedcaml_minor_tablesntablessigned chartrap_sp_offcaml_deserialize_sint_1caml_deserialize_sint_2caml_deserialize_sint_4DIGEST_LATERcaml_deserialize_sint_8digest__pthread_mutex_sunsigned char__spins__int128 unsignedbacktrace_last_exncaml_custom_elt__atomic_load_ptrcaml_statefinal_infocaml_named_valuedirectPhase_mark_finalheaderintern_stack_init_Boolcaml_input_value_from_blockvaluechancaml_gc_policycharserializecaml_realloc_custom_tableintern_itemcodeptrcaml_ephe_ref_tableintern_bad_code_pointer__uint16_tcustom_operationscaml_stat_alloc_noexccode_endextra_paramshlenintern_decompress_inputCAML_MEMPROF_SRC_MAP_FILEfun_name__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicesflagsPhase_sweep_and_mark_mainextern_statecaml_find_code_fragment_by_digest__jmp_buf_tagyoung_startcaml_stat_calloc_noexccaml_raise_end_of_fileinputcomparereadblocksweeping_donecaml_deserialize_uint_2tablesreservecaml__dummy_strnewstackcaml_exception_contextcaml_global_heap_statecaml_bad_caml_state__lockread64uCAML_FROM_CAMLintern_stackcaml_atomintern_free_stackoo_next_id_localminor_heap_wsz__uint64_tdigest_statuscode_fragmentlong unsigned intfinalizeselfstatusread32scaml_alloc_small_flagscaml__dummy_vchandependent_allocatedcaml_deserialize_float_4channelcaml_deserialize_float_8slice_budgetexn_bucketcaml__roots_vchanread16sread16ulongjmp_buffercurrcaml_update_major_allocated_wordscaml_free_intern_state__mask_was_saveduintptr_t__sizeread_sharedfile_offsetyoung_endcaml_find_custom_operationsexternal_raisec_stacksigjmp_bufcaml_shared_try_allocsnprintfintern_resize_stackcaml_set_oo_idgc_regs__uint32_twosizeGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecode_ttrap_barrier_blockintern_srcGARBAGEcaml_parse_headeroverflowextra_heap_resourcesmemory_order_consumeintern_alloc_objmemory_order_seq_cstdoublerefcountcaml_minor_heaps_startgc_phase_tcaml_really_getblockintern_inputcaml_allocation_statusreadfloatmutexcaml_extern_statememory_order_releasebuffinit_intern_stackfloatswept_wordsthresholdintern_endcaml__temp_resultunsigned intcaml__roots_blockDIGEST_IGNOREDIGEST_NOWpthread_mutex_tintptr_tcaml_input_value_from_mallocgc_regs_bucketsrequested_external_interruptcompare_extPhase_sweep_ephecurrent_ramp_up_allocated_words_diffCAML_MEMPROF_SRC_NORMALMARKEDoffsetCAML_DO_TRACKblock__jmpbufcaml__frame__count__jmp_bufoff_tnitemsallocated_wordsOShiftintern_cleanup_failwith3nextyoung_limitcaml_input_valueexpected_sizelong doublePhase_sweep_maincaml_channel_unlockcaml_input_val_from_bytesread_stringcaml_deserialize_block_float_8caml__dummy_resunique_idallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listcaml_alloc_small_dispatchfragnumuint16_tread_double_arrayOReadItemsread_blockofs_indread32uallocated_words_suspendedtemp_sizedeserializeephe_refinside_stw_handlerfixed_lengthadd_to_custom_tablecaml_channel_lock__int16_tcaml_failed_assertintern_alloc_storageintern_initchar_osdestCAML_FROM_C__int128caml_deserialize_uint_1malloc__aligncaml_deserialize_uint_4__off64_tcaml_deserialize_uint_8backtrace_activecodestat_major_wordsmemprof_young_triggerintern_failwith2requested_minor_gcyoung_triggergc_policycaml_string_lengthnamecaml_heap_statecaml_check_gc_interruptcaml_gc_messageglobal_heap_state__atomic_load_tmpcurrent_stackatomic_uintnatshort intuint64_tOFreshOIDrequested_global_major_sliceint16_twords__elisionextra_params_areatag_t__valexn_handlermagicbsize_32function_placeholder__int64_textra_heap_resources_minorcode_startintern_recmemcpyyoung_ptrcaml_local_roots_ptrintern_stack_limitasize_tdls_rootmlsize_tstack_infoinput_val_from_blockCAML_MEMPROF_SRC_MARSHALstat_minor_wordsread8suint32_tlockedDIGEST_PROVIDEDcaml_stat_freeobj_countercaml_memprof_sample_blockfreenewsizeshort unsigned intmarshal_headerCAML_DONT_TRACKbasecaml_input_value_to_outside_heapmajor_refreadfloatsintern_statecaml_deserialize_error/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatbsize_64custom_fixed_lengthcaml_domain_statestack_cachehashcaml_stat_blockminor_tablescaml_ephe_ref_elt__sigset_tcompressedcaml_gc_phaseCAML_MEMPROF_SRC_CUSTOMprevidentifiercaml_failwithcaml_alloc_point_hereretcodemajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA $L,,ABCK CD A AFA~EAE AFA~EAC AFA~EBAC|8GpA~IA~0D AEA~R EAD IFA$C ACA~ZDA4 $B ADGA~^ HAA DLC AEA~dCCC AAABACBA~lAAAAAAH BB D AFA~DABA~HAA ABA~GCACA~XAA AFA~DAAA~BAAAA@C ACFA~W JAC h HAD ,\C AGA~T EAA HlCB ADA~D A ACA~QAA BD C [B C ADA~0I AEA~] HAA H C ADN A~F MAAFA ,XC ACDA~V EAC @BBI ABA~IAABAA~LAA AFA~EA0LA~Y HAC ,C AFA~d EAB 08DC AKA~ IAB $HA~T DAD (IA~[ EAC `AGu ACA~D A ABA~FAB AD I AB A ABA~DAAA AAAA~EAD ACA~,LtApK D A AAA~B A ACA~,|ApK H A AAA~B A ACA~,ApK H A AAA~B A ACA~,ApK H A AAA~B A ACA~, ApK H A AAA~B A ACA~,<ApK H A AAA~B A ACA~,ltApK D A AAA~B A ACA~,tApK D A AAA~B A ACA~,AQ B A AAA~B A ACA~,AT C A AAA~B A ACA~$,HA~M FAA $THA~N FAD $|HA~N FAD $HA~N FAD @AGD_AACA AAAAA~BAA ABBA~,xAG AACA~FAA AAAA~Agnu $,08/HG``xo$Ll 8 P   %8K_hvx3If}1BhYh3Fb(@tXp #;Stkt0H`x8xOintern.cread64uintern_initintern_failwith2intern_bad_code_pointerinit_intern_state.part.0intern_cleanupintern_decompress_input.part.0intern_cleanup_failwith3intern_alloc_storage.part.0intern_alloc_objintern_endcaml_parse_headerintern_resize_stackintern_recinput_val_from_blockcaml_failed_assertcaml_alloc_sprintfcaml_failwith_valuesnprintfcaml_failwithcaml_stat_alloccaml_stat_freecaml_raise_out_of_memorycaml_alloc_point_herecaml_stat_alloc_noexccaml_alloc_small_dispatchcaml_gc_phasecaml_global_heap_statecaml_memprof_sample_blockcaml_shared_try_alloccaml_process_pending_actionscaml_stat_calloc_noexcmemcpycaml_gc_messagecaml_minor_heaps_endcaml_minor_heaps_startcaml_atomcaml_set_oo_idcaml_find_custom_operationscaml_realloc_custom_tablecaml_find_code_fragment_by_digestcaml_named_valuecaml_free_intern_statecaml_input_valcaml_channel_binary_modecaml_really_getblockcaml_bad_caml_statecaml_raise_end_of_filecaml_input_valuecaml_channel_lockcaml_channel_unlockcaml_input_value_to_outside_heapcaml_input_val_from_bytescaml_string_lengthcaml_input_value_from_bytescaml_input_value_from_malloccaml_input_value_from_blockcaml_marshal_data_sizecaml_deserialize_uint_1caml_fatal_errorcaml_deserialize_sint_1caml_deserialize_uint_2caml_deserialize_sint_2caml_deserialize_uint_4caml_deserialize_sint_4caml_deserialize_uint_8caml_deserialize_sint_8caml_deserialize_float_4caml_deserialize_float_8caml_deserialize_block_1caml_deserialize_block_2caml_deserialize_block_4caml_deserialize_block_8caml_deserialize_block_float_8caml_deserialize_errorcaml_intern_decompress_input2200! 22 00 ! 228008$! n2Xr0X|" # 2`0`8$ D% r&Zv&Xx&C' 2200! d( ) ) 2@,* x(  x20 0(  x20 0 x+ "2 &0 0" @ xH# &Z&X&C, 22p00p! 202H000H!  - X. r2v2~00! 228008!  x+ |1 2 2 @ *2 .@ T1 2 2 0 0 !  x + &Z &X &C P x T3 2 2 0 0 ! 2 0  0 $ 8 D 20  04 5 ) 2(0(6  x + >&ZN&X\&C<9 :  45 Z2^@ l) L  `  p  5 ;  2@2 @ <        t= 20>     2200!  ( x.2608 0N2(^0(` 22x00x! 22`00`! 22P00P!      22x&0*0x,! :2PJ0PL R2V2^0b0d! r20  x H x20 020 , < 8H ~228008! &Z&X&C&C) "2&2.0204! V2Z2b0f0l! &Z&X&CA B XB n2@v0@ * B     8 n2r28z0~08! 220000!  `C ( 20% D 20% + >&ZF&XH&CF @ G 2 2 0 0 ! 0E N&Z Z&X h&C 2P 0P     J !  !L !\ 8!h !2!28!0!08!! ! `!2!2!0!0!! "2h" 0h" % "$I "N&Z"R&X"T&C" "2"0" " P" `"C #&Z#&&X#(&C#d #j2#r0#x # P# `#C #2#0#% $&Z$ &X$ &C$2$0%% %  % `%C %20%00%% %&Z%&X%&C&8C &F2P&J0P&PP &v&Z&z&X&|&C&C &2P&0P&P '&Z' &X' &C'XC 'f2P'j0P'pP '&Z'&X'&C'C '2P'0P(P (&&Z(*&X(,&C(xC (2P(0P(P (&Z(&X(&C)C )2P)0P) P )F&Z)J&X)L&C)C )2P)0P)P )&Z)&X)&C*C *2P*0P* P *F&Z*J&X*L&C*C *2P*0P*P *&Z*&X*&C+8C +F2P+J0P+PP +~&Z+&X+&C+5 +C +2P+0P+P ,&Z,"&X,$&C,X5 ,C ,2P,0P,P ,&Z,&X,&C-5 -@C -J2P-N0P-PP -~&Z-&X-&C-5 -C -2P-0P.P .&&Z.*&X.,&C.C .2P/0P/ P /&&Z/*&X/,&C/X x/`% /tC /~2P/0P/P &3&0 30&`83H&P3`&`h3x&@3&3&3&`3&3& 3& 3 & (38& @3P&X3h&p3&3&03& 03& @3&" 3&"@3&#3(&$03@&%H3X&&p`3p&'x3&'3&( 3&(3&)@3&)3&*@3&* 30&+p83H&,P3`&,h3x&-p3&. 3&/ 3/&0&&t7& 8&  &*/ = DBWco v({a "  53 P 9".:kF=R ^Aj7z -!;"/7<IVmx -u W  {R*@VLXdu kuCK "D G) W7wEcS ao,} ^@0 / %.3VAWOi]ky tU~s, &}   l# /I; aGS_kwmP4 r H~\ &3@GM`,jwp 9  ~  J  'i4 KBbP^r ne#Q   *  !  -n 9k Ft ` z d       t   *d 7 J W  t   d      d  " ( < D) a= l z J s   "    & S     x <Q I VH i+ v     ;  c U _ b    @    x p   (cT+  z  tP ^Uly?"/`&*2I jnW <  ,;9Q Xh =+ 5;"9n@ 5`p{&/  ?=&/   &/|&&/7&PB&/\O&/hdo 9Dgm&,SG&,&,&,&P&,`>#&+p:EIY(]keocx&+p&+&+&P&+ H&*&*s m)-2;?HLUYb&*lx&+@&+X&P 62NJfb~z   '&&*@K&*@Ufaenrwf&*@v&*&*&P &) &)A  $-!16A?<C:L&)VV^&*k&*(|&P?&)@FD&)@RNgc&)@1&)#&)4&PBpM&(mqz&(&)&)(&P&(&(  )&( 3?&(L&(]&Pl&(HvX&'%#&'&'&( &P&'%1/5-:C;G7OZ&'zr~p&'&'`&'x&P&'(|z@ &&p)-6&&p@L&&Y&&j&Py&&&%&%z&&@&&X&P&&+/6=&T_cx&@&`&LW q&$. 9=M:Q0Vb?mjqbv"&$&%&%&$H &$p%59C&$M$]%a!jBn>s$|[Q&$9I&$Y &% d  " 'd 0 4 ?&%P Io YB ]@ bo kN oJ v&% & &%$ &% &0  &#    !!I!#E!,&#!6!B!L&#!Y&#!h&#h!&#|!&!&#!&#!&!F!&"@""b""X"2"6"Q"U"^&"@"h"t"~&""&""&""&""&"&""#&###'#5#9#Q&#[J#k %#o #x =#| ;# R# N#&#& #U# g# a# # ~# # #U#&0$&$(&8$5&$H&@$l&L$$&" $ $ $ $ $&"($$& @% %  %0 %4 %9M%E%P H%T @%Y%i%t k%x g% % |%&!`% % % %&!l%& %&&&!&"&!&,&< &@ &I &M &V &Z &_&n&!$&&!&&8&&&&!<&& & & & & & &&!P'& '6& 'Z&!'g&!`'&!'&'&'&"'&h'y'& 0((  ( (& 4(,(7&0(N(Y 4(] .(bM(n(y R(} N( y( ( e( c(( p( n((( z( x(&) )  ) )&)/&)G&)_& )p&)}&))&)) ) ) ) )b)* * * Q* K*i*& k** g*B&*L`*X`*b&*o&*&** ~* |** * *&*&* * * * * + +&++&+5+E +I +R +V +_ +c +h+w&+&+&8+&+&+&+ 0+ .+&, &,/&`,S&,w&,&,&,&,& -&-(&0-5&-F&-^&-s&-}& -&-&-&$-n-.  .& .3 F.7 8.<.G .K {.Y .] .b.k .v.z.& ..0...& ..>.8.^.Z..u.m...// & /& /0/4/>/G/K/T& P/^/g/k/x& /////// //%/!/6/4/& /& /A0?0 0K0I0!& 0+04U08S0E& 0O 0__0c]0lk0pi0u 0~y0s00000& 0& 000000& 0$111& D1& D181<1E1I1R1V1_1c1l1p1y& D1& D1"1 1& `1& `1& `1,1*1& t2/26242B2#@2(/21P25J2>l2Bh2K}2O{2X& t2b& t2}22?222& 2O222& 2& 22223& 3& 3,30393=3G& 3Q& 3mZ3qX3zf3~b3& 3Z333Z333& 3e333e33 3& 4&4 & (48& <4P& H4h&4&4& 44=4;44I4E4 4& 44555 M55"5&5+5;5F 5J5O& \5d 5o5s5y& T5& \5& 5&5&515& 545&56w6 k666 6%h60646D6H6Md6X6\6l6p6u666366 66b6C6?66l6Z66677 77&07(7/&78 7?&7H7O&x7X?7a7l7p7u&7&7&7&77777177778 8 &88$38(/81H85D8>]8BY8Kp8Ol8T8^&8w&l8&8&8&8& 8&H9&9&d9:&(9J&49_&x9l&9}&P9&P9&9&9&9&:: :&0:p:.:2:;:?:H:L:Q&<:p&`:z&`:::&t:&t:::&t:&::;; ;; ;;%9;)5;2&;<;QL;UH;^];b[;g&;;;e;;;;*;";S;K;|;t;;;;;;< << E<A<&,<'&,|>z>"& >,><>@>E>N>R>]&>g&>>>>>&>&>>>>>&>&?:? 8?&?&?9D?=B?FP?JL?T&?^&?z?~???& ?& ???&(?&(?&?$?2@.@ &D@@$e@(c@-@6o@:m@E&`@O$@_@c@l@p@y@}@&t@/@@@@@/@@@&|@&D@&A&A>&Ak&PA&dA&tA&A&B&B0&BH&B`&Bx&B&B&B&B&B&B&,C&<C,&C6&CK&xCX&Ci&C~&`C&C&C&PC&C&C&D&D&D4&D? DJ&DjDnD| AD 1D D D D D D!*D!D&DlD![D!YD!fD!dD!pD!nE& EwE& E)E2&E[&E~& \E& E&E&E& E& EFF/F' F>FL FW& Fw!F{!xF!F!F:F!F!FF!F!FF!F!F&F&F"F"G&G&(G&& G>&GL&Gi&G&GGGGhHc nHxHhHWH&I"I!"I&I1"1I5"-IE"GII"CIY"]I]"YIk"sIo"oIt&8I& I&DI&PII&`II"J"J"J"J&J0&XJH&JV J[&@Jz"J~"J&JJ"J"J&J&J"J"J&J&lJ&K bKK#&0KB"KF"KU#=KY#-K^Ki#Km#wKr&K&K&K&K& K&K&,K&8K&LLL5_Lp'L 4L&L#L#L LM MB MjMM M&M&M&<M&M&M&tN&N&N.N;CNW No WN|NgN NNNuNN2NpO? OL OXOdJOqO&`O#O#O&O O#O#O&O& O&P&P&P4$P8#PA$APE$7PN$tPR$hP["Ph$Pl$Pu$Py$P~&4P&`P&P&P&P&Q&Q&Q*&Q8&QE&Q\&Qk&`Q% Q$Q%gQ%SQ%Q%Q&'Q&Q&Q&Q-Q&QGQGQ&R&R &R#&R'&R0&R4&R:&RM&RWRRg'Rk&Rt''Rx'!RRR'JR'BR&R&HR&0R&`R&S&S&S &S5&pSB&SS&Sm&S&8S&S&S&S&,S'S'}S'S'S(T(T &,TT"&-HT/&-XT@&PTK&-Tk&-pT(T(T(^T(PT(T(T&-pTT&-T&.T&PT&-U &. U'(U+(U4(U8(UA)UE)UN))UR)!U[)NU_)HUh&. UrU~&.U&/U&PUU)jU)fU)}U){U)U)U)U)U)U)U)U)V)V)V)V)V)V )V'<V+<<(4nz,u8u D& &P &@&&00``@Hh``    \04 0H @" "@#$P%&p''( @(p)@)*@*0+pX,,-p. / .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @/ @#+&/,/6/1@N;23O9h(J@V@xY9V2T@V eTx)s@ 0@@00A-@p0A0   8<@ot ! lHints.bd.o/ 0 0 0 644 110736 ` ELF@@9 &#, -A@i)+9@ })4DU)~|cJ9 %#, 0L #9)U*>( 6M =BJy)}*J})R})N `@ `@ `9 9@ 8c&9 D%#, 0L K`9 8c%N 9@9 8cD%N ``9@9 8cD%N ``9@9 8cD%N ```C d }*P|cPPy)xc|cHP|cN c N ```C$yH}'v|Hy#}9}Gv})Pi |c9hc|cHP|cN ``#}#v|cJxxc N #}#v}*v|cRx|cJxN ```|a|{x|#x|+x!aH`|xxH`}?9)()Ax|~x;dxxH`}H9JUJ>( "A= y)a)})T6y)} @Pxx}CxH`9@8!}#W>Ia|N ?|N ``||x!H`8!|ix8`?|N ``||+x|#x!cH`9 8!>?|N ``||x!H`,A0,@LH`8!8`|N H`8!8`|N ( @9_UJ>( @9_UJ>( AW>;|;@x^UI>, _A`9 U>( @d9 U>(@9JUJ>( AP9)|H@D}G,*@ })J|)@A ;KW>;Kt9)|HAxH`|>@ԁ!p, AdAx;9 })6, A|?H@@8!xa|N ``9)K@``,@A9 })6|)@@P!x, @8!|a|N `W>;K|?H@@cxH``xiD(xc"}#xN `Ti<.xc"}#xxc8cN ```|vxj}# x}JA|hv|iJ|iAhc|cPPxc8cN ```|<88?!H8!pxc8c|N ||#x<8!a;pxH8cTc>( AH= a) y)a)})6q)A,{BxH`8!|N txH`8!|N ```||xPiBPiF>}#N ||ix9)xi"PjBPjF>U#>Q#BQ#F>yCN ||ix9 9 ( @9_UJ>( @9_UJ>( AW>;|;@^UI>, _A`9 U>( @d9 U>(@9JUJ>( AP9)|H@D}G,*@(})J|)@A;KW>;Kt9)|HAxH`|>@܁!pAx, A`, A,?A;K9 y)|?H@@xi"PjBPjF>U#>Q#BQ#F>yCN ||ix9 9 *     . *]    )?int*<,J-.@]d  WJZ.lm 3]M4.RA ;>*w5 Z6  *6@ r 0 D c # w($ 00%%|8*+0 Z Z+D Z55^ Z ^ ^*I+*w h,Z,[,\  ") B+ ) 7 ) 7 -2 . C /-^ /$ 4Z 5C j$ 8Z  * f f- /$ / M Q. d 8 Q $ :Z+ D8pfB Z. bS CZdsC/ZE S #T8U0V1;}SST@U ;Z`fmt;,Zarg;7Z==P 93SST US5Z v15-Z v257Z0 i10. i209-Z v-.Z*ZXv*.Z+ S #T8U0V1'Z v'.Z$5 x$/!ZXv!.Z" S #T8U0V1 x/5Z v,ZZXNv,Z S #T8U0V1Zhv+Z 0S #T8U0V1Z v)ZZ\ v1:Zv2DZ S #T8U0V1Z\ Qv11Zv2;Z S #T8U0V1Z\ v10Zv2:Z S #T8U0V1Z\ v1)Zv23Z S #T8U0V1Z\ Uv1(Zv22Z S #T8U0V1Z\ v1)Zv23Z S #T8U0V1ZSv1)Zv23Z   S #T8U0V1$ ES #T8U0V1Z>v1)Zv23Z  0 0S #T8U0V1Z\v1)Zv23Z S #T8U0V1Z\v1)Zv23Z S #T8U0V1Z\Bv1)Zv23Z S #T8U0V1ZXv)Z S #T8U0V1Z i-res Z%*zdst-C^2S 9>v'Z&4^&+^l  "S1 S ")S2NS%$v$Zn E  v1 Z v2*Zi1 i2 |Z4>vi|/Z~ 0'IiwZXvdw/Zdy t'&y &%&/S #@T8U0V1m5T im1(oIdo5ioho(Tuo0"3d4.c  dc15(ede5iehe(Tue0~>Zs>+Zp@resA ABXB TBPdB:cJ ]=ZL =k)=Z=k=ZF=k)=Z=k&` 0&%&/ {S #@T8U0V1S #@T8U0V1 =uSTTUPVX +SBS 6Z`fmt6(Zarg63Z8=P 93SST US1Z v11)Z v213Z, i1,+ i2,7)ZXv).Z* S #T8U0V1&ZXv&.Z&' &%&/S #@T8U0V1#Z9 v#*Z ZXv *Z&! &%&/S #@T8U0V1Z v*Z5 x,ZXv*Z& &%&/S #@T8U0V1  x,5Z v(ZZXjv(Z& &%&/S #@T8U0V1Zh v'Zx & &%&/S #@T8U0V1Z& v%Z1ZA x ZZ\v16Zv2@Z& &%&/S #@T8U0V1Z\v1-Zv27Z& &%&/S #@T8U0V1Z\Bv1,Zv26Z& &%&/S #@T8U0V1Z\v1%Zv2/Z& &%&/S #@T8U0V1Z\ v1$Zv2.Z& &%&/S #@T8U0V1Z\!Cv1%Zv2/Z& &%&/S #@T8U0V1Z"v1%Zv2/Z  & "&%&/S #@T8U0V1&$ "&%&/S #@T8U0V1Z#}v1%Zv2/Z  &0 #o&%&/S #@T8U0V1Z\$(v1%Zv2/Z& &%&/S #@T8U0V1Z\$v1%Zv2/Z& &%&/S #@T8U0V1Z\%~v1%Zv2/Z& &%&/S #@T8U0V1ZX&v%Z& &%&/S #@T8U0V1Z&< i*res Z%*H&dst)^9X&v#Z&0^&'^N% 'Rv Zx lo hi1| ' v1|Z v2|&Zi1~ i2 iZ4( vii/Z(k '(') idZd(vdd/Z)f (q)$')K6f 67S T4U0V1]5) i]1(_) f_Ci_u_!(V )V dV15(X)KfXCiXuX!).QZd*sQ+Z6S )67S T4U0V1;}SST U IZ`*fmtI(ZargI3ZK=P 93*SST USDZ4+/v1D)Z;v2D3ZT<+/F+J+??+V i1?+ i2?7<ZD+v<*Zi!pJ595 +;x9,S6Zd,iv6*Z67 67S T4U0V13 $,x3,50Z,v0(Z-ZX-hv-(Z6. 67S T4U0V1*Z\-v*'Z6+ 067S T4U0V1'Z .*v'%Z1.E x$Z\.v16Zv2@Z6 67S T4U0V1Z\/v1-Zv27Z6 67S T4U0V1Z\0@v1,Zv26Z6 67S T4U0V1Z\0v1%Zv2/Z6 67S T4U0V1Z\1v1$Zv2.Z6 67S T4U0V1 Z\2;v1 %Zv2 /Z6 67S T4U0V1Z3v1%Zv2/Z  6 367S T4U0V16$ 63y67S T4U0V1Z4j v1%Z v2/Z  F60 4\67S T4U0V1Z\5 v1%Z v2/Z#6 67S T4U0V1Z\5 v1%Z v2/Z#6 67S T4U0V1Z\6Y v1%Z v2/Z#6 67S T4U0V1ZX6 v%Z#6 67S T4U0V1GZ7=i*Hres Z *H7T dst)I X7 v#Z!0^!'^ 7 v Z 08O v1ZJv2&ZTi1 i2 Z93 fmt&Z arg1Z"=P]res Z 938SST U 9ST1%ST1& ] :e fmt Z!'!p ]len ff +9S :S :+STU :ITUS Z@: s)Z;}SST?U ZD; v1'Z v21Z{Z$;J v{#Zx} uZ;} xu!Z M=Z sM"Z!M)!M<pOresP *P*"QH"Q D"Q@dQ:<cX ]#=ZZ =k)=Z=kK=ZU==k)=Z=k =u=-STDU@VH +=ESBSL< =u=c<] != p!62"=T2#=U2$=V'RH>'b'mT'x'6T>{67S T4U0V1+/$>+?+J) >)$!)K(?(S) &T?t&%&/S #@T8U0V1 0?? ?! @ S8@CiX@.6$ 67S T4U0V1<ALAmT<,3dAt!ASIMTS #T8U0V1I~:!;9 IB1BH}41B.?:!;9 'I@z U1RB UX!YW :!;9 I I :!; 9 IB H} $ > .?:!;9 'I !H}.1@z: ; 9 I !I4:!;9 IB4:!;9 I :! ; 9 I8  :!;9 I.?:!; 9 'I@z4:!; 9 IB1RB UX!YW 4:!;9 IB4:!;9 I1.?:!;9 'I1RB X!YW 4:!; 9 IB .:!; 9 'I@z!:!; 9 IB"4:!; 9 I#1RB UX!Y W $.?: ; 9 'I<%.:!;9 'I@z&:!;9 IB'41( :!;9!)1RB X!Y!% ?$ > @ A&B4G: ; 9 C.?: ; 9 '<DE.: ;9 'IF1RB X Y W G.?: ; 9 'I H4: ; 9 II.: ; 9 '@zJ: ; 9 IK1RB UX Y W L.: ; 9 'I M.1@zUUSUUSUUoUUSTTSTUSTTTTTnTUTQQSQRYRRSRRoRRSPPSPPSPP?PPSOOSOOoOOSOO1&OOoOOSNNSNNxxNNSNNSMMSMMSMMTMMTMMoMMSLLSLLSLLTLLTLLoLLSKKSKLSKKTKLTKLoKLSJKSKKSJKTKKTKKoKKSJJSJJSJJTJJTJJoJJSIISIISIITIITIIoIISGHSHHSHHSHISIISIISGHTHHTHHTHITIITIITGHZHHZIIZGHYHHYIIYHHoHHSHI0IISFGSGGSGGSGGSFGTGGTGGTGGTFGYGGYFGZGGZGGoGGSEFSFFSEFTFFTFFoFFSEESEESEETEETEEoEESDDSDESDDTDETDDoDDSCCSCDSDDoDDS S o S o S o S S S S T n T T n T U o U U o U m mSSYBBSBBSBBsAASABYBBSAAsAAyABoBBS<=S=?m??S??m?@S@@m@AS==S=>n>>S>?n?@n@@S@@n=>o>>o>?o?@o@@o=? .w.?? .w.@@ .w.==o>>Y>>o>>Y??Y@@o=>Z>>z>>>>>>Z>???Z>>Z>>z>>>>Z??Z>>Z>>z>>==o>>o@@o==o??S@@S<<S<<S<<T<<n<<T::S::Y::S::o::S99S99Y9:S99o99S88S88Y88S88o88S66S67S66?66S55S55o55S551&55o55S44S44xx45S44o44S33S33S33T33T33o33S22S23S22T23T23o23S12S22S11T12T22o22S11S11S11T11T11o11S00S00S00T00T00o00S//S/0S//T/0T/0o/0S..S..S./S//S//S//S..T..T./T//T//T//T..Z./Z//Z..Y./Y//Y..o..S./0//S,-S--S--S--S,-T--T--T--T,-Y--Y,-Z--Z--o--S,,S,,S,,T,,T,,o,,S++S+,S++T+,T++o++S**S*+S**T*+T++o++S)*S**S**o**S S o S S S T o T U n USSYYy &((S()S((s'(S((S''s(( 5C<(( ((o((S&&S&'S&&o&&S%%S%&S%%T%&n&&T%%S%%S%%t%%s$$S$$S##S##S##o##S""!""!5""S""S!!S!!o!"S!!1&!"S1&""S !S!!yx!!S!!S S S S S T T o SSSTToSSSTToSSSTToSSSTToSSSTToSSSSSSSTTTTTTZZZYYYoS0SSSSSTTTTYYZZoSSSTToSSSTToSSSTToSSSoSSoSS ST o TU n USSSSsZtSSToToTSsSSSkSkTlTlUmUmXYyoySoUoSnSSSSSTTSS s1& $ & S1& $ &SSSmSmSmSTlTlTlTUkUkUkSnSnnSnoooSoso .w. .w. .w.oYoYYoZzZZZzZZZzoooo,S,SsSs~Ss~Ss~Ss~SSSZYtSoSS$$S$%S$$T$%T'' !5C<''S))S))o))s))S44S44S66S66S77S77S88S89Y99S99o99S;;S;;S;;T;;T;;S;<S;;Y;;ZAA!AASBCSCCoCCsCCS,*    !!!!!!!!!"""!!!!!"""########&&&&&&&&&&&&&&'''(((''(((((()***********++++++++++++,,,,,,,,....///////0000000001111111111222222222222233333333344444455555555555555666666888888899999999999::::::==>>@@=>>>?@>>>>??????@@@@@@AAAAAAABBBCCCDDDDDDDDDDDDDEEEEEEEEEFFFFFFFHHHHIIIIIIIIJJJJJJJJJJKKKKKKKKKKKKKLLLLLLLLLMMMMMMMMNNNNNNOOOOOOOOOOOOOOPPPPPPQRRRRRUUUUUUUUUUUUUU* runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/camlints.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmlvalues.hcustom.hintext.halloc.hfail.hstring.h $ / ? ! !//=Xz?  $ !  ! X    v   &   $ ,>  %   # +>  %   # +t.    ![ t ! !<  . .!w !2 !!X $   ${y .! /   0../!"6/$X#&!!". u. 5tY0"!.wtu /! !. tZ6x (x '.ptu /! !. t Y.P2s  <s./ s  <+`t?#  # =" / / < !! ! !. wJ /B !! ! !.  [X { . ! ! ! g >  8 =   !  " != b >  8 / 0=  ".$w (j  i  .< 1>'! -/  .%!.< NJ <:.%.1%=%!.< L<   l. t!!i .0 t.= !; /! -!f  O  3=  KJ* KJ+= I//!.z.B .z  Bx +!+w. . .w.   u /:x !:t. . .t.   r /: u !: q.. .q.   o /:r !:  "!1</ .e  <K!<.) .R "! 1</  \ < $ Z./! $/r[ <= !6! .DX.(. .X.  ( V /:'Y !:&U.+. .U.  + S /:*V !:)R... .R.  . P /:-S !:,+.O <1 .O  1 M /90P !9/+.L <4 .L  4 J /93M !925.I <72.I 27 G /C6J !C5 $< MJ J</6 !6< J$ ./2  2  " i  <.< ..   </5 !5<[ <4t ./y <O!M 1= K<i$/;$/ $< ./   0i!w p .< t.!  </ !r  === I/0x '.s. < .s   <q + u '+p.. .p.   n 0:r ':m.. .m.   k 0:o ': j.. .j.   h 0:l ':  "!1</ .^  <L'y<.) .R "! 1<1  S < - Q.0'y ,qS <> ' " . <O.1. .O.  1 M 0:/Q ':(L.4. .L.  4 J 0:2N ':+I.7. .I.  7 G 0:5K ':.+.F <: .F  : D 098H '91+.C <= .C  = A 09;E '949.@ <5.@ 5  0G>B 'G7XxX JZ0 '< J% .04 '4  - i .< . 6<  '6<[ <5J< J . 05 '5}< J .} /5} !5< J . 09 '9< ~J . /8~ !8~ t /i  y  Jy!iM 1= K<i yK!! { >  8 =   "! # != { >  8 / 0=  ".w {  {  .< 1"0/  &~v~ '<{< <.~X!~0~ '<{X   kJ =[ =[ k<~ J n $~0~ 'o  === I//!.z.B .z  Bx 3!3w. . .w.   u /Fx !Ft. . .t.   r /F u !F q.. .q.   o /Fr !F  "!1#</ .e  <K!<.) .R "! 1#<1  Z < & X./! &qZ <= ! " . <V.*. .V.  * T /F)W !F(S.-. .S.  - Q /F,T !F+P.0. .P.  0 N /F/Q !F.3.M <3 .M  3 K /A2N !A13.J <6 .J  6 H /A5K !A4<.G <99.G 99 E /J8H !J7  X JX/ !< J  ./, !, .< . 8<  !8 < J . /- !-w M 1= K<i /; /  < ./ !caml_int32_xorbsize_32size_tcaml_int64_of_floatuintptr_tfinalizecaml_int64_shift_right_unsigneduint64_tint64_deserializecaml_nativeint_mulcaml_nativeint_to_int32caml_nativeint_to_float_unboxedcaml_int64_of_nativeintcustom_operationslong long unsigned intcaml_int64_formatcaml_nativeint_divcaml_bswap16_directcaml_copy_doublecaml_int64_orintptr_tcaml_copy_int32caml_int32_modlong long intsigned charcaml_int64_to_floatcaml_int64_float_of_bitscaml_int32_add__int64_tcaml_raise_zero_divideint64_tcaml_int32_negcaml_swap64long intcaml_int32_shift_rightruntime/ints.ccaml_nativeint_direct_bswapconvparse_sign_and_baseidentifiercaml_int64_bits_of_float_unboxedcaml_int32_comparecaml_int64_shift_rightcaml_int64_of_stringcaml_nativeint_modcaml_int32_of_stringnativeint_deserializecaml_alloc_sprintfdividendcaml_int32_shift_leftcaml_nativeint_of_float__uint32_tcaml_nativeint_andcaml_nativeint_xorcaml_int32_float_of_bitscaml_deserialize_errorcaml_int64_of_int32nbitshashcaml_int64_compare_unboxedcaml_int32_bswapcaml_serialize_int_8unsigned int__int128caml_int32_of_float_unboxedlong unsigned intserializeparse_intnatmlsize_tcaml_int64_to_float_unboxedGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_nativeint_bswapintnatcaml_int32_bits_of_floatlastlettercaml_swap32caml_int64_bits_of_floatcaml_int64_neguintnatstrlencaml_nativeint_of_float_unboxedcaml_int64_comparecaml_copy_int64caml_serialize_int_1caml_int64_bswapcaml_deserialize_uint_1caml_serialize_int_4len_suffix__int32_tcompare_extcaml_int32_of_intint64_lengthparse_digitcaml_int32_to_intcaml_int32_orcaml_int32_formatcaml_nativeint_to_floatbsize_64int64_serializelong doublecaml_nativeint_opsint32_serializedivisorcaml_int64_to_nativeintcomparecaml_int_comparenativeint_serializeformat_stringcaml_nativeint_formatnativeint_hashdeserializecaml_bswap16nativeint_cmp__uint64_tint32_deserializecaml_int64_subcaml_nativeint_shift_rightsignednesscaml_int64_addint32_lengthcaml_int64_to_intcaml_invalid_argument__int128 unsignedcaml_nativeint_to_intthresholdcaml_int64_direct_bswap_Boolint32_tunsigned charcaml_int32_float_of_bits_unboxedshort intcaml_int32_subcaml_int64_shift_leftnativeint_lengthcaml_int64_opscaml_int64_mulcaml_int64_float_of_bits_unboxedcaml_nativeint_orvaluecaml_int64_of_float_unboxedparse_formatcaml_int64_to_int32caml_nativeint_shift_right_unsignedcaml_int_of_stringcaml_int32_compare_unboxedcaml_int64_of_intcaml_int32_mulfloatcharcaml_nativeint_of_int32caml_nativeint_of_intcaml_int64_divcaml_int32_opscaml_int32_direct_bswapbasecaml_copy_nativeintcaml_int32_andcaml_int32_to_floatcaml_string_lengtherrmsgcaml_int32_shift_right_unsignedshort unsigned intcaml_int32_of_floatcaml_int32_divcaml_nativeint_comparefixed_lengthuint32_tcaml_int32_bits_of_float_unboxedcustom_fixed_lengthint32_hashint32_cmpmemmovecaml_int64_modcaml_nativeint_negcaml_deserialize_sint_4signcaml_failwithcaml_deserialize_sint_8caml_nativeint_compare_unboxedsuffix/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_int64_andcaml_int64_xorcaml_nativeint_subcaml_format_intint64_cmpcaml_nativeint_shift_leftcaml_nativeint_addint64_hashdoublecaml_nativeint_of_stringcaml_int32_to_float_unboxedcaml_alloc_customGCC: (Debian 13.2.0-18) 13.2.0zRxA ,0@THh |$4 C ADDA~e KAA $HB ACA~CFA$XC ADA~EFA$HB ACA~CFA$@XC ADA~EFA0hB ACA~I EAA C EAA 4H AEA~M GAC IGAH@C ADDA~N HAC N HAB ,@$TDh@FpA~BDA0C AEA~S DAA EDA$TB AHA~CDA XGA~GDA \FA~IDA ,\FA~IDA P\FA~IDA4tAJ AAGA~EAAA A A AAAA~,A AACA~HLB AAD K \FA~IDA \FA~IDA $\FA~IDA H\HA~GDA l\HA~GDA \HA~GDA \KA~DDA$XB AIA~CDA($ <dGA~JDA` tDCA~HBA$4$`C AEA~HDA dGA~JDA  0dGA~JDAT4CpA~DBA$tTB AHA~CDA XGA~GDA \FA~IDA \FA~IDA \FA~IDA4,AJ AAGA~EAAA A A AAAA~,dA AACA~HLB AAD K \FA~IDA \FA~IDA \FA~IDA \HA~GDA $\HA~GDA H\HA~GDAl0 hLA~FDA$XB AIA~CDA XGA~FEA   ,8CpA~EBA LXJA~DDA pXJA~DDA XJA~DDA XJA~DDA < L$ `C AEA~HDA8 ,C ADA~R FAA O FAC  h | XJA~DDA 4CpA~DBA$ TB AHA~CDA XGA~GDA \FA~IDA D\FA~IDA h\FA~IDA4 AJ AAGA~EAAA A A AAAA~, A AACA~HLB AAD K \FA~IDA \FA~IDA <\FA~IDA `\HA~GDA \HA~GDA \HA~GDA 0 hLA~FDA$ XB AIA~CDA , @ TXGA~FEA x  8CpA~EBA XJA~DDA XJA~DDA <L$`C AEA~HDA DdGA~JDAAgnu0&01HH;` Fx$ U bHtXHX 8HP       )08Nf{h$D,@?ObTrX\(\@\Xp\\\!\7\N\n 0\HX`x$d D,$G4Z`l d8 Phd4TX\#\2\AP(_@\nX\|p\\\\0hX%0 AHXU` qx8XXXX<L  `82PShtX4TX\\\(@,X\?p\Q\d\~\\0 h X  0  H : `X R x r 8  X  X  <  L  `  d  @ 2 @@ A @ints.cparse_sign_and_baseint32_cmpint32_hashint64_cmpint64_hashnativeint_hashparse_formatint32_deserializeint32_serializeint64_deserializeint64_serializenativeint_deserializenativeint_serializenativeint_cmpparse_intnatnativeint_lengthint64_lengthint32_lengthcaml_string_lengthstrlenmemmovecaml_invalid_argumentcaml_deserialize_sint_4caml_serialize_int_4caml_deserialize_sint_8caml_serialize_int_8caml_deserialize_uint_1caml_deserialize_errorcaml_serialize_int_1caml_failwithcaml_bswap16_directcaml_bswap16caml_int_comparecaml_int_of_stringcaml_format_intcaml_alloc_sprintfcaml_copy_int32caml_alloc_customcaml_int32_negcaml_int32_addcaml_int32_subcaml_int32_mulcaml_int32_divcaml_raise_zero_dividecaml_int32_modcaml_int32_andcaml_int32_orcaml_int32_xorcaml_int32_shift_leftcaml_int32_shift_rightcaml_int32_shift_right_unsignedcaml_int32_direct_bswapcaml_int32_bswapcaml_int32_of_intcaml_int32_to_intcaml_int32_of_float_unboxedcaml_int32_of_floatcaml_int32_to_float_unboxedcaml_int32_to_floatcaml_copy_doublecaml_int32_compare_unboxedcaml_int32_comparecaml_int32_formatcaml_int32_of_stringcaml_int32_bits_of_float_unboxedcaml_int32_float_of_bits_unboxedcaml_int32_bits_of_floatcaml_int32_float_of_bitscaml_copy_int64caml_int64_negcaml_int64_addcaml_int64_subcaml_int64_mulcaml_int64_divcaml_int64_modcaml_int64_andcaml_int64_orcaml_int64_xorcaml_int64_shift_leftcaml_int64_shift_rightcaml_int64_shift_right_unsignedcaml_int64_direct_bswapcaml_int64_bswapcaml_int64_of_intcaml_int64_to_intcaml_int64_of_float_unboxedcaml_int64_of_floatcaml_int64_to_float_unboxedcaml_int64_to_floatcaml_int64_of_int32caml_int64_to_int32caml_int64_of_nativeintcaml_int64_to_nativeintcaml_int64_compare_unboxedcaml_int64_comparecaml_int64_formatcaml_int64_of_stringcaml_int64_bits_of_float_unboxedcaml_int64_float_of_bits_unboxedcaml_int64_bits_of_floatcaml_int64_float_of_bitscaml_copy_nativeintcaml_nativeint_negcaml_nativeint_addcaml_nativeint_subcaml_nativeint_mulcaml_nativeint_divcaml_nativeint_modcaml_nativeint_andcaml_nativeint_orcaml_nativeint_xorcaml_nativeint_shift_leftcaml_nativeint_shift_rightcaml_nativeint_shift_right_unsignedcaml_nativeint_direct_bswapcaml_nativeint_bswapcaml_nativeint_of_intcaml_nativeint_to_intcaml_nativeint_of_float_unboxedcaml_nativeint_of_floatcaml_nativeint_to_float_unboxedcaml_nativeint_to_floatcaml_nativeint_of_int32caml_nativeint_to_int32caml_nativeint_compare_unboxedcaml_nativeint_comparecaml_nativeint_formatcaml_nativeint_of_stringcaml_nativeint_opscaml_int64_opscaml_int32_opsV2Z@& ,' X( (  2 0) * p+ ,  - t. , *  2  0 / 80 D+ 0 - X @& (1 2H 0H  P 2 2X 6 0X H 7 7 2 0 9 b2 f0 h9 2 0 9 "2 *0 09 2 0 9 2 0 9 8? 2 0 9 2 0 9 ? 22:0@9 209 209 V2Z0`9 209 20 9 209 209 209 0O  2` 0` 7 : 2h> 0hL Pb2f0h9 209 `O 2@0@9 2@0@9 r2@z0@9 2@0@9 22@:0@@9 2@0@9 ? :2@J0@T9 2@0@9 ? 2@0@9 B2@J0@P9 2@0@9 2@ 0@9 f2@j0@p9 2@0@9 F2@V0@l9 2@0@9 b2@f0@h9 O 2@0@,9 n2~09 2@0@9 .2>0L9 " 2x& 0x8 D7  & 2@0@9 2@ 0@ 9 n 2 r 0 t1 2@ 0@ 9 !@O !~2!0!9 !2!0!9 "R2"Z0"`9 "2"0"9 #2#0# 9 #2#0#9 #? $2$*0$49 $b2$r0$t9 $? $2$0$9 %"2%*0%09 %2%0%9 %2%0%9 &F2&J0&P9 &2&0&9 '&2'60'L9 '2'0'9 (B2(F0(H9 (O (2(0) 9 )N2)^0)l9 *B 2X*F 0X*X *d7 * 2* 0* P*2*0*9 &p&3& 30&083H&PP3`&h3x&3&3&3&P3&3&3&`3 &(38&@3P& X3h& @p3& `3& 3& 3& 3& 3& @3& 3(& 03@& `H3X& `3p& Px3&3&p3&3&03&3&3&P 30&p83H&P3`&0h3x&P3&3&3&3&`3&3&3 &0(38&@3P&X3h&p3&P3&3&3&P3&3&3&p3(&03@&H3X& `3p&x3&3&@3&3&3&03&3& 30& 83H&@P3`&h3x&3&3&`3&3& 3&3&3 &(38&p@3P& X3h& p3& 3&!03&!p3&!3&"03&"3&"3(&#P03@&#H3X&$`3p&%x3&%`3&%3&& 3&&3&&3 &' 3 &' 3 0&' 83 H&( P3 `&( h3 x&( 3 &( 3 &( 3 &)@ 3 &) 3 &) 3 &*0 3 &* (3 &&&0 &(&8& @ &P&HX&``&h&x& &&8&x& && ""G" p&*!1"q8" B?"?F" KM"'R"`" Ql"s" 0z"" "m"~""""""" "f"e"3"^+"9"V"[" g"" """""="`""""w " }"" " D"L"}"H& &"&&" 3 &&#"3"D"5O"*_" 2j"F"" ~"M" " "g""4," C" $T" I_&* &* $" .,&*&&* &"#&*0E:I6YR]Lb"q&*\ &X&*l" f" J"" V&&(FqJkS&) \ hlq z~&)&"""f&( !&(X* 6:? HLQ&(Pb&""" n&'&' a q&'0&O"IZ&'z~ &'L Q Q,*&'T&"V" && &8 *4 9N =J F&& O < [b _` d < ml qj v&& & " && x t   &&P '    '   "&&X 3& R" ]&% ~    &%       &% & " &%` * . = A J&% S  _" c h  q, u* z&% & " &% 8 4 N J &%0  b `   l !j &&%8 7& V" a&$ x t   &$       &$ & " &# . 2 A E J"G U: Y4 ^"@ iV mP v&$4   n l  x v &$< & &$` &$`&$|)&F&$T"_&#P"G"@&#&#&#&1&#?"J&"k)o%~?;&#  SQ ][&#(&" &"ie*.{7&"@ LPU ^bg&"x&" $&"0&"`   &"h$&C" N&!nr{&" t t&"&" " &`/38&|E&R&_&p & {"y&TL"w"&@&L&*&?"J&jn|""&!0($&!0&!0"<&:1&!H?"J& kKoEx&  Yhd Y&  d{y d&!& " be""&p  "JD" ." =".UY^ pt}& /& & 60& VP&&nl &) ?: ?CzGvL&a&|& (&&&& | &" &59IMR"a&<} &x&L"""H& (&L1 =AF OSX&Ti&"&&      &&" :"E&e *i $r&,{  E C  O M&4&"""&@2 [6 W?&xH T oX m] f zj xo&p&" "U" *&   & ! % * 3 7 <&M&k"$v&0  &l      &t& "'"B"FM&n r   & u % # u / -&&"&@ ; 7, Q0 M9&pB `N eR cW `` od mi&xz&" & { w  & K   K   &%&C" N&o s   & 6   6  &&"W&   -  1 :&P C ! O % S # X ! a / e - j&X {& " &  ;  7  Q  M &   e  c!  !  o! m!&!&&!D" !O&!p !t w! ! !"G! ! !"@! ! !&T! ! 1! /! ! ;! 9!&\!&"&"'&"C E"G C"P P"T N"Y&"j&"&"" "&p" `" X" " ""G" " ""@" " #&#&#- #1 #: #> #C&#T&#p&#~" S#&# # # # #&@# # # # # # #&H$ &$)"$4&$U ,$Y ($h B$l >$u&$~ $ V$ T$ $ `$ ^$&$&$"9$&P% l% h% % ~% &%) %5 %9 %> %G %K %P&%a&%"%&% % %&$% % % % % % %& %&&"&="o&H&&j &n &s&&"&&& & &"& &&"&,&&&&(&" 7&&'I'E'#]''['6g':e'Iq'Mo'S" '"'&P''~'&P'&P'''&h( "e(&(7(;(D&(M (](a(f (v&( ((( (((& (&(")" )W" )b&0)))&h) c))) s)))&p)&)&P* &h*"*#&*E*I*Y6*]0*b"*q&* &`*& *"*&*S*O*&+&+g+e+%r+)p+0" +W" +b&++{+&8+" b+&+" C+&,,, &, N,",&,+ N,4,8,=&,N&,j"U,u&P,,,",&0,,,",&,-- &- )-! -% -* 9-3'-7%-<&-M&-i"-t&p-5-/-&- - -R-P-&-&-" .&P.!^.%Z.+".F" .Q&.rt.vp...& . ... ...&(.&."0.&///./2/;&/D /P/T/Y /b/f/k&/|&/"P/&0/// //&`/ //0 0 (0&0&h0%&0A"0L&0m40q00J0F0&0 0^0\0 0h0f0&0&0"0&p1t1p1)1-16&1? 1K1O1T 1]1a1f&1w&1" 1&11111&@1 111 22 2&H2 &2<"~2G& P2h2l2{<202"G2v2p2"@222& 2 222 222& 2&3& 3& 393=3F3J3O& 3`&3z&3" W3& 33333"G3+3'3"@3>3:3& 4& 4O4 M4)Y4-W42& 4C&4]& @4k" <4u& `4e4a4{4w4& 4 {444 {444& 4&5" 5& 5:5>5L5P5Y& 05b f5m5q5v f555& 85&5"5& 55555& 6 Q66 6 Q6$6(6-& 6>&6Z" 6d& @6%6!6& t6 <69676 <6C6A6& p6&6"n7"7&7>Q7BK7G&7U"07\&P7{n7j7"777"777&x7" 7&0777" 7&8884888F8J8P" 8Z& 8{ 8 8)88"8"r8W8S8m8i8& L8 &X8& 9& 94" 9>&9_9c|9h" i9r9v9{"99999"~99909&9"b9\9V9&$9&4:&`:,&:J&:[ &:f" :p& :v:r:& : &H:"h:& :::;;";& `;0;4;A;E;K"2;U& @;t;x;~";& ;;;";_;Q;" ;;;;;%;;"<`<Z< " <" <)".> >$> > & >;:>?4>HU>LS>Q& >b&>&`>a>]>w>s>&>>>&? ? ?&?2?6???C?H&?Y&?y&???&???& ?&@&@-@1@6&@H&`@c@g@p&@y @4@2@ @>@<@&@&@&@J@F@`@\A&A"vA&rA6&A?&AVAZAcAgAr& AAA& AAA&!pAAAAB&!B&&9&& y&@&'&( &(Q&*00D0XPlPDl` 0 @D `X l    @  0 T `x  Pp(L0pPp0,P@dx`0  4XPxP 0ph (@Lp0 @  0 P t`      0p l   !0 !p ! $"0 H" l" #P # $ % @%` d% & & & ' ' 0' D( X( |( ( ( )@ ) ) *0H*.symtab.strtab.shstrtab.rela.text.data.bss.rela.toc.rela.opd.rodata.str1.8.rodata.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @*@&+4,+46+81@@+@ 8;@ pE25xT680a6h\@p y7(B.t@ } yV9~k0@0f@ 0. 0ɾ d@ 8oDX(&  P io.bd.o/ 0 0 0 644 214360 ` ELF=@@C$8`|*H@A8`@8`|cN ```cN ```!q?hq)A|px?, A ?x,)AH`,@? ;,)A ?;xH`,@0??`}j9)H,)?`9*(@ ,A@jx^H`,@px|8!N ?X,)AP,( PA ?X(X9 jx?P?X^H`,@`8(H`xH`?, ApH`xH`KX`_?p|*HA?x,)AH`,@;K```=")|?H@@)P=B,)*A}^j9J X9JK`=")x<8iH`K4```=")jI9JK<?;;:;H`P,?AX?hq)A,? ,)@?`8`;9)?`H`,#At|~xP,?@Zj#x:9):H`,@X,=9 ?B!;ZA`888CxH`|dx8`H`xa}#KxH`7@a|A8! !a|N ``8~xxH`K<Ax9@9!p8>ApAx;(xH`,A,@d=")})jI9JI=-9@9),Al_pH` =B=9J9}ISx,'_pA?? H`cH`|xH`,A="x)})jI9JIH`,@=-9@9)8!8`Ia|N `xH`K} CxKP``<hq)@ljcx_9J_H`,@=-9@9)8!8`Ia|N ``8xH,#@8xH,#AKp`cx?H`K,``<=-9)@!; a{9`H,exH`=})=QZJ@h|>Hx|"@;x}xP|AxH`=8x=HQZJA!a=hq)@pj~óx89)8H`,@=-9@9)8!8`IA|N 8xH,#@8xH,#AKl`~óx?H`K``<=-9)JiZ@:!z`H4DxxH`;xZ});Q@h|>x@~x{xP|ADx%xxH`;8cxZ;HQA!j~óx89)8H`,@=-9@9)8`IA8!a|N ~óx?AH`K`<A9!p8A889>px;}(cxH`,A,@?}_j*9)*=-j9)x|tH_cx9J_H`,@=-9@9)8!8`Ia|N `cx?H`Kl``<A9!p8A889>px;}(cxH`,A,@?}_j*9)*A=-j9)xH_cx9J_H`,@=-9@9)8!8`Ia|N `cx?H`Kl``<1kW   "C#C  32 5#2 6#2   7 (  X < X <  X " Q # Q $7X( C 2EC2F2G w"#C' H _WwZClm&Y> TZOXJ3N+t32392;2[>>?< "#C?\" AhAA"A%A (K(+0.282U@6ZH9AP=AXA`ChF>pI>xL>P>T>[>`2r>tw>y{}222>>>>h X(U0 8]idX@XHP X `>h>p2x22  #>>>2>X22 ] gA  F P KEF {G 8H p _ @ 2 2 U       @ ]jmpA 0BC ( b4&122 l ?   2 2+ @ =  V j # ($ V0%% 8+ 5X V   B52 j  [?  > o5> 4* "w #C?@   A! XA"^  #C4F @. 0_buf/  B<0 rh`!X+. @fd/X0 end1 2 max3 4 r(5 EP5 EX6 >`7Xh8 p9 x+ B<< o1~ E85 5 end5 5 ptr5 5 5U(5U0 A7 8 9 : 8< < end< < ptr< < <U(<U0 > ? mem@ maxA 8C*C*endC*C*ptrC*C* CU(CU0 :"Ae#CKLhM N > QR S 2T 2UdimV  e"2aCCF u CU) E b oj cn r \! dD ED e Z X X 6     E F I &p  8C C >   =& X_ _ &^ X  FeXGi  X X X X6b !/ O ( X X X X6" H#% , X7"H$1X6"T 8qf f r&%f X XIe  X 8j f7 f%V X X7Gf8S = a= U Z=* U&C XA _EW X& Xn _I f_@_) SwS.UwUUUXV EresW 2\rVYr` rYrrkr rrUrrAS WSnSr@[/rJ rl_rwrrrAS *SeGSS T U U HSH(JwJJJXposK L EPPSrVMMr` rYrr7r rr!rrAS WSnSfN ufr@O#rJ rl_rwr rrAS *SS T U J<:<%>w>>>Xpos? @ EErVAr` rYrrr rrrrAS WSnSfB 8fr@CrJ rl_rwrrrAS *SS T U >  CS111)pos193w333X4 E9rV6r` rYrrr rrrrAS WSnSr@8rJ rl_rwrrrAS *SfSS T U 3& &&pos&6(w(((X) E.rV+r` rYrrr rr~rrAS WSnSr@- XrJ rl_rwr BrrAS *Sf pSS T U (#-=-9wX Epos 2len 2n 2!#rV"r` rYrr"r rr"rrAS WSnSr@!#mrJ rl_rwr#WrrAS *Sh#SUS T U ,'$4@$wX E 2len2nX XX-%rV&r` rYrr%r rr%rrAS WSnSr@&rJ rl_rwr&rrAS *S   qY&S' U'!U'9U'QU'S T U S1*I(wX Ei 2(VrV)Sr` rYrr)=r rr)'rrAS WSnSr@*rJ rl_rwr)rrAS *Sie*SS T U ,)wX Ec.+rV,r` rYrr+r rr+rrAS WSnSr@,rJ rl_rwr,rrAS *Si,SS T U /)wXpos  E-SrV.r` rYrr.r rr.rrAS WSnSk- .k=r@/rJ rl_rwr/rrAS *SS T U 2&wXpos  E0rV1r` rYrr1xr rr1brrAS WSnSk- 1k=r@2drJ rl_rwr2NrrAS *S2S T U   CS15k*pos:wX E3xrV4ur` rYrr4_r rr4IrrAS WSnSr@5#rJ rl_rwr5 rrAS *SkK5;SS T U 8'pos7wX E6+rV7(r` rYrr7r rr6rrAS WSnSr@7rJ rl_rwr7rrAS *SkK7SS T U <4.>.:w~X Epos 2len 29.rV:+r` rYrr:r rr9rrAS WSnSk~;Vkkk k!kakkk k klW;llST1;8TUTUr@<rJ rl_rwr;rrAS *SS T U <%5A%9<SSTTUUVV|AF|+|;|G}%w~X Epos 2len 2> X!kkkk k klW>|llST1>UU $ &>rV?r` rYrr?r rr?rrAS WSnSlQ@hl\.lj0%lu!l) ll@LST1lST1r@ArJ rl_rwrArrAS *SS T U pDp)wp9rwrrrXs EByrVuCr` rYrrBr rrBrrAS WSnSlQwCl\.lj0%lu!l) llCST1lST1r@xDKrJ rl_rwrD5rrAS *SlDcSS T U rd(H d*chd:fwfffXg EERmrViFOr` rYrrF9r rrF#rrAS WSnSlQkFl\.lj0%lu!l) llFST1lST1r@lGrJ rl_rwrGrrAS *SljGllST1S T U f^4HU^*`HU @NKqN+N;PwPPPXQ EI[rVRJr` rYrrJr rrIrrAS WSnSr@ZJrJ rl_rwrJrrAS *Sglj0XKA%lu!l) llK&ST1lST1S T U PCNC$EwEEEXF ELKrVHMr` rYrrMr rrLrrAS WSnSr@JMrJ rl_rwrMrrAS *SlMST0S T U E74N{7-$m9 mhO[.>wXO+4S T U 4O.P<OSS dP<+ P<PSS  CS1: R*wX E  P rV Qr` rYrrQr rrQrrAS WSnSr@ RrJ rl_rwrRrrAS *S nS T U U,wXXfdX ESrVTr` rYrrTr rrTrrAS WSnSr@UbrJ rl_rwrULrrAS *S  kUS US T U CS1XVR.fdX  CS1Y1whres~X. W EWmS@WSTU S XLib  X'b b)ST8U0V1X>S0 XjrXrrXrrAS HSrlYrwrYmrrAS *YS*SS T U \/?wX EZrV[r` rYrr[qr rr[[rrAS WSnSr@\5rJ rl_rwr\rrAS *S     S T U \fd29\SS1&T0~t_tfd~;X~CX Eo]p ppSSr^1rr^rrAS HSq'^q1S T Url_rwr^rrAS *S!b  b b)S T8U0V1z_fdz19_SS1&T0odb fdo:XoBXq Ert`rr`rrAS HSq'uaq1S T Urlvarwra|rrAS *Sb w ab b)S T8U0V1pSS'gb7g5 E(resi :W2bnW":P X4bP"iP0TRHUSHUJ$e$"& E'Xr?crrcrrAS HS;rl0EdKrw;rd6rr*SqHdqS T UrlIe-rwrerrAS *S TeRS(  eS deT "S T1U*2f- Ep nX-qYfXS    S1' f4 EJgc. EC res g5TU0  CS12h8 EpDnN2k 2rXhSTUXie. Ep=lenG2nX XX-   qYhShSUiSUi3SUiQSUS1'i2 E(res j(i X.0i5 Eki.j6 EnX-  qYj]S jS1 |Xk-fd|Xp| n|0<r~X  ST0UV'u kKu5 E)gk~g/ EgD (resi )\k\6 Ep]2len]<2_X'GXlG. EpGClenGM2(nIXI X)=l,=. Ew=@)8lQ8, Ech89X),lj,: E)'l', E' Xl 3 El am/+ E/9a,X,XKm5V  qYmZSmS T U   mS1mU T $ &S1LXn*9 EM oD/: E, Nend NfdXKqYnS nST0U1nST0U2o STU0   CS1Oo/4 E kToS(  oSS T UL EpPfd:Xm EM Eqnfd9X, Ep~SpS@<$ pST0U1 pS(qS <q'*, E<q=*+ EoXqYPfd2X<vqo*v+ EOcr@,e E r@frJ rl_rwrr0rrAS  *Q]rV*]5 EQWrl*W3 E0rm4f0rm?fpXrm5f(rX0rm;f0s(err4XqYhuqcRqYv tEqc rVr` rYrrt.r rrtrrAS WSnSRr@trJ rl_rwrtrrAS *S( 7 1 1rVvr` rYrrvr rrurrAS WSnSr@xvrJ rl_rwrvrrAS *SS#(o4wp ppSSm w=ml4wllSST1ljdwlu$l ) llST1lQTx}l\.lj%lu$l ) llST1l,xl7lD!l:llT1l{ll m? yFml,AylDl7!l:llT1l,Bz.lDl7$l :llST1l,CzlDl7$l :llST1l,D{(lDl7$l :llST1$l=ll S k|Pkkk k klW|llST1|5UU $ &k~ }bkkk k!kakk%k k klW}3llST1}KTUkK~kVkc kpljj~lu$l ) llST1;kKg~zkVkc=kp CS1 ~TU0 k-$~k=ieiu=im 0mqie}%iu iri=iiSS f$fb T"b b)S T8U0V1s&I~1BH}1RB UX YW 4:!;9 IB : ; 9 I8 H}:!;9 IB I H} 1RB UX!Y W  !I 41B.?:!;9 'I@z : ; 9 I 8  U :!; 9!I!84:!;9 IB U: ; 9 I4:!;9 I4:!;9 I:!;9 IB.1@z : ; 9 $ > : ;9 I : ; 9 I8 <( : ;9 I .?: ; 9 'I<!1RB UX!YW "I#!I/ $1RB X!YW %1&.?: ;9 'I<'.?:!;9 'I !(4: ;9 I).?:!;9!' !*:!; 9 I+&I,4:!; 9 IB- :!;9!.1X!Y!W!1/:!; 9 IB0.:!;9!' !14: ; 9 I?<2 :! ; 9 I3:!;9 I4: ; 9 I 5'I6.?: ; 9!'<7.?:!$; 9!'<8.?: ; 9 '<9H}:.:!;9 'I@z;1RB X YW <.:!; 9! ' !=41>7I?'@ !!: ; 9!A :!; 9 I8B>! !I: ; 9 C4:!; 9 ID :!;9 I8 E.?: ;!9 '<FG.?:!; 9!'<H.?: ; 9 'I<I.?: ;9!'<J.?:!;9 '@zK :!; 9!L.?:!; 9 'I !M.?:!; 9 'I@zN4:!; 9 IBO.?:!; 9!'@zP:!; 9 IQ.?:!; 9!' !R1RB UX!Y W S% T$ > U V: ; 9 W : ; 9 X : ; 9 YGIZ&[5I\  : ; 9 ] : ; 9 I 8^I _ : ; 9 I 8 `4: ;9 I?<a!Ib4G: ; c4: ; 9 I?d : ;9 e.?: ;9 'I<f.?: ;9 n'I<g1X YW h4: ;9 Ii: ;9 Ij kH}l.: ; 9 'I@zm4: ; 9 In: ; 9 IBo.: ; 9 'I p.: ;9 'I q1UX YW r 1Us.?<n: ; CSSSSq#0llęlė0ę0ȗnXnęؙXؙnSnęؙnؘ1$#ȗnnؙn̗kkؙk̗kؙkؗSؙSSؙS ؙ ؘXęؙXkęؙkSę̙S ęؙ SSq#0mĕЕmؖm0ؖ0ȕooo XЕoXؖoЕSoЕoؖoԔlЕlؖlԔlؖlԔSSĔSSĔ ؖ o XXSllSS  SȒSȒےq#0lllĐ00ooȐnnnԑ1$#SȐnnn̐kkk̐kkؐSSSS  nБnnSkkSS  SSq#0TTq#8ȎlȎЎ܎l؏l0؏0̎m܎m؏m܎1m܎m؏mk܎k؏kk؏kSSȍSSȍ ؏ mmkkSS  Sȋ؋S؋q#0TȋԋTԋq#8ĉlȋllȋ00mȋmm1̊mȋmmkȋkkkkSSSS  ЊmmЊkkSS  ЅSSq#0ЅTTq#8ЅUUq#@ЅVV؅؇j؇jĈj0Ĉ0܇kkĈknn؈nllĈlSnĈ؈nȇ1$#kk؈kii؈ii؈iS؈SȆS؈SȆ ؈ ȇkĈ؈kiĈ؈iSĈ̈S Ĉ؈ ~SSq#0~TTq#8~UUq#@~VVȂkȂЂkk00؂oooiiiiȄi܄i1&Uׁ1&1&ЀUЀh́ÚhhUnhȄh܄hnȁnȁׁ$tnȃnnȄnSăSSh  $ &1$#ooȄ܄ollȄ܄llȄ܄lSȄЄSSȄЄS Ȅ܄ o܄ol܄lS܄S ܄ {{S}}S}~q#0{}l}}}}l~~l|}0~~0||n|}X}}n~~X~~n||S|}n}}  $ &~~n}}  $ &1$#||n}}n~~n||k}}k~~k||k~~k||S~~S||S~~S|| ~~ |}X~~X|}k~~k}}S~~S}} ~~ wxSzzSzzq#0xylyyzzlz{lxz0z{0xynyyXzznzzXz{X{{nyznz{nyz 1$#xynzzn{{nxykzzk{{kxyk{{kxyS{{SxxS{{Sxx {{ yyXz{Xyykz{kyySzzSyy z{ ttSvwSwwq#0tvmvvvvmwwmuv0ww0vvowwouvovv vvXvvowwXwwovvSuuovvowwouulvvlwwluulwwluuSwwSuuSwwSuu ww uvovv vvXwwXvvSvvlwwlvvSwwSvv ww pqSssSssq#0qrlrrsslstlqs0st0rrostoqrnssnstnrr1$#rsSqrnssnttnqqksskttkqqkttkqqSttSqqSttSqq tt rrnrrnssnrrSrrksskrrSssSrr ss mmSopSppq#0mmTopTppq#8moloooolpplno0pp0nomoomppmoo1nnmoomppmnnkookppknnkppknnSppSnnSppSnn pp oomppmookppkooSppSoo pp jjSllSllq#0jjTllTllq#8jllllllllmljl0lm0jlmllmlmmll1jkmllmmmmjkkllkmmkjkkmmkkkSmmSkkSmmSkk mm klmlmmkkklmkkkSllSkk lm deShiSiiq#0deThiTiiq#8deUhiUiiq#@deVhiVehehhhheiieeh0ii0ehkhhkiikefohhoiioefnhhniinhh1efkhhkiikeffhhfiifeffhhfiifefShhSiiSeeSiiSee ii ffnffyfgnggggnffjfgjggjfgkfglggmggoffnggnffjggjffkggkfglgglffmggmggkghkiikghfiifhhSiiShh ii ddSddSddTddTddUddUddVddV^_SccSccq#0^_TccTccq#8^_UccUccq#@^_VccV_bebbbcecde_c0cd0_bmbcmcdm_bjbcjcdj_`n`anccnccn``kaalaao``naan``TaaT``maam``kaak``laalaambb1_`mccmccm_`fccfccf_`fccf_`SccS``SccS`` cc aambcmbbmbcmabmcdmabfcdfbbSccSbb cd Z[S]]S]]q#0Z[T]]T]]q#8[\l\\]]l^^l[]0^^0[\n]]n^^n\]1[\n]]n^^n[\k]]k^^k[\k^^k[\S^^S[[S^^S[[ ^^ \\n]]n]]n]]n\\n^^n\\k^^k\\S^^S\\ ^^ VVSYYSYZq#0VVTYYTYZq#8VXmXXXYmZZmWY0ZZ0WXoXYoZZoXX1WWoYYoZZoWWkYYkZZkWWkZZkWWSZZSWWSZZSWW ZZ XXoXYoXXoYYoXXoZZoXXkZZkXXSZZSXX ZZ YYoUUSUUSUVSVVSUUsUUS#UVsVVS#QRSTUSUUq#0QRTTUTUUq#8RTlTTTTlUUlRT0UU0RToTToUUoST1RSoTToUUoRSkTTkUUkRSkUUkRSSUUSRRSUUSRR UU SSoUUoSSkUUkSSSUUSSS UU TToTToNNSPPSPQq#0NPlPPPPlQQlOP0QQ0OPmPPmQQmPP1OOmPPmQQmOOkPPkQQkOOkQQkOOSQQSOOSQQSOO QQ OPmQQmOPkQQkPPSQQSPP QQ MNSNNSNNSNNSMMsMMSMMSMMSMMSMMTMMTMMyMMyMM0MM0MM1MM1LLSLLSKKSKLSKKSLLSSSq#0lll00mXmXmSmSmmSmmmkkkkkSSSS  XXkkSS  GGSJJSJJq#0GJmJJJJmKKmHJ0KK0IIoKKoHIkJJkKKkHIoIJXJJoKKXKKoKKXJJ1HHoJJoKKoHHlJJlKKlHHlKKlHHSKKSHHSKKSHH KK IJXKKXIJlKKlIJSKKSIJ KK FFSFGSFFSFFyFGS@@S@ESEESEFS@DkDDDEkEFkAE0EF0AB0BCnCCSCDnDDYDDnDEnEE0EEnEEnEF0FF0BCSCC0EE0EESAB0BBmBBBCmDEmEE0EEmEEmEF0FF0ACoDEoEFoCD0DD1EE0CCoCCTDDDDqAA FF AASFFSAA FF CC EE EF CCSEESEFSCC EE EF <<S??S??q#0<<T??T??q#8<>l>>>?l@@l=?0@@0=>m>?m@@m>>1==m>?m@@m==k>?k@@k==k@@k==S@@S==S@@S== @@ >>m@@m>>k@@k>>S@@S>> @@ <<S<<S99S9<S99T99n9;T;<n99S9;o;;s;<o99S99S9: ;< 99S;;S99 ;< ::o;;o:: ;; ::S;;S:: ;; ::o::S88S89S66S68S66T66n68T88n66S67o77s78o67 88 66S88S66 88 77o78o77 88 77S88S77 88 77o77S@DSDTS S 4S4Z4Y`SSlool0ll0l0l  SS   S ooo S 22S23o33S34o44S45o55S22T23n33Y33n34n44n45n23S44 ty44 t44S44S/0S01o11S11S11o/0T01n1111S#11T11n00S11S..S./m//S//m//S//S..T./n//n//T..U./l//U//l//U..U./Y//o//Y//Y//U./S//S//S*+S+,o,,S,-o--S--o--S-.o*+T+,l,,T,,l,-T--l--T-.l*+U+.U++U -(+-U -(--m-.U -(..m..U -(++n+,n,-n--S--n-.n++S--S-.S..m()S))S))S))S''S'(o((S((o''S'(S((S&&S&&l&'S&&T&&m&'T&&U&'n''U&&S&&o&&S&'o''S S o S o T m T m n n n S S S Y TSoSoS SooSnSnnSoSSoSnSnoSoS S s(SSS  SoSo  ooooonnnnSSSS  o o(S( (SS   S o  o  o n nn nn SS SS  SsXSs(SS#(S#(SS  SSSSSSSSoSoSoSoSoSTnTSoSoSSoSS STnTTnT T TSmmSSoSollSooommooonnoooS S T S !n!!S!!n!"S T !T!!T!"T U "U U !m!!o!!S!!U!!m o s!!o!"S!!S!!n""S"#k#$S""T""j"#j##j""U""l""y"#l###$l""m##n#$o""l"#l""T""j"#j""m##m""n##n##S##k$$S$%o%%S%%o$$T$%n%%%%S#%%n$%S%%S$$S$$o$$o%%o%%n%%S%%S))S)*n**S**n**S**n))S))o))o11S12S55S55o55s55S,M@             !!!!"""""""#######$$$$))))))**666666666788668866667777888888777788888877887777999999999999::::;;99;;9:::::::;;;;;;::::;;;;;;::;;::::====????@@====??@@====@@==@@>>>>>>>>@@>>>>@@>>@@>>>>@AAAAAAAAAAAFFAAFFAAAAABBCDEEFCCEEFFCCEEFFCCCDCCCCCCDDDDHHHHHHHHJJKKHHJJKKHHKKHHKKIJJJJJKKIJKKIJKKJJJJMMMMOOPPQQOOPPQQOOQQOOQQOPPPPPQQOPQQPPQQPPPPRSSSSSSSTUUURSTUUURSUURRUUSSSSSSUUSSUUSSUUSSSSTTTTWWWWWWWWYYYYYYZZWWWWYYZZWWWWZZWWZZXXXYXXYYXXXXXXZZXXZZXXZZXXXXYYYY[\\\\\\\]]^^[\]]^^[\^^[[^^\\]]]]]]\\\\\\^^\\^^\\^^\\\\_```cccc_`cccc_`cc``cc`````aaa````aaaaaaaaaabcbbbcabbbbbcdabcdbbcdbbbbefffffhiiiefhiiiefiieeiifffgffffggggggggghhhhhiighiihhiihhhhjkkkkkkkllmmjkllmmjkmmkkmmkkkkkllllmkkkklmkklmkkllnnnnnnnnopppnnopppnnppnnppnnooooooppnnooppooppooooqqrrrrrrssttqqssttqqttqqttqrrrrrrrrrrrrrrrrrssssrrrrrrssssrrssrrrruuuuuuuuvvwwuuvvwwuuwwuuwwuuuuuvuuuuvvvvvwwwuuuuvvvwwwvvwwvvvvxxxyyyyyzzzzzz{{xxxyzz{{xxxy{{xx{{yyyyyyz{yyz{yyz{yyyyyy||||||}}~~||}}~~||~~||~~|||||}}}}}~~|||||}~~}}~~}}}}}}Ȅ܄Ȅ܄Ȅ܄Ȅ܄܄܄܄؈؈؈Ȇ؈ćȇĈ؈Ĉ؈Ĉ؈ćȇȇȊ̊ЋЋЊЊ̏̏̏ȍ̏Ȑ̐̐đȑБԑܑؑԔЕܕ̖ԔЕܕ̖Ԕ̖Ĕ̖Ԕܕܕȗؙؙؙؙ̗̗ĘȘ̘ԘؘęؙęؙęؙĘȘИԘؘؘB runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/typesio.cplatform.htypes.hfcntl.hstddef.hstruct_FILE.hFILE.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hstdio.hcustom.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hio.hpthread.hbigarray.hosdeps.halloc.hstring.hsys.herrno.hsignals.hunistd.h !! 6.  ! Kt/! h <'<$.2y '.pX.  .   . 2!!T...<.z  | 4"!!  =4 " !} ! !T..==<=aX J<.1|X./8 !!!&}  &}  <hXJ}8u< X.}tY.4 0/ 1 0 1$!" !!<*x.>.f J/   @~~ 2. .; !#XG<   $ 2 2* N B 3 > '! '! >/  .o</! //Y m.! .. pXu q !  m  .. y.!!"!!!! =#/o J. S! =#/,y . X #  # r h/ L #!  $ . /. -.z & N)Z/  /   /2./ Y  2/+!"v. "" s. /5 "t   y !.  b<= !""#!! $  ! !  $l  .  r<  ..< Bx (. t > H 0/!.~f./"!~ =~p.. }.}. < |!/$! !} ~!T..p u s ! X|<t } .. W.<.50 x|~f. |.!  | !!~ =~p.. }.}. < |!/$! !} ~!T..a ud !X|Xt } .. W.<.61 x=/!//. /!{ p =1f. ~ Y}</J~. #{=T..}.{  {. < ~fJ{.</J/o  X ~..<.=/-/ .!~ ~f ~. .Y~p.< ~..~ <> tJ I0 0>"//  "!t .~!=V.  ==  .   X ! ! / > !+z<6X .< eXfq.X.~!V.  <<  + . "  " y=/!/!. 3g"z p =1f.g}z  z  z !!=y !!$ y !&C/K00z!YT..}.z  z. < }JJ$jJ.X }..<.<=! = !H . -   -  = /<< i !  ;/.{   .! ;  t=/!/!. /g"z p =1f.g}<   </z!=T..}.z  z. < }<.X |..<.=/!//. /!z p =1f.g}z   z  z 1/1z!=T..}.z  z. < . {Xw <.w <J}J  X |..<. J! ; x=/!//. /"y p =1f. | Y}y .y  X{ .y!=T..}.y  y. J  {<w <.w <JJy< y . { < { J  X |..<.=/!//. /"y p =1f.g}$y  y  y !{ .y!=T..}.y  y. <  {Xw <.w <J  X |..<.=//KK..! !!  1/!y p =1f.g}y <  { \==  "!! {-  { - {   ! .!6 #/ L 4.!I  6  "! .%{ .y!=T..}.y  y. ...  {Jw <.w <J   J |..f.JX  A=//=K..! !!  1/!y p =1f<g}){ } .y {   k jK n./  !f  '! '! >/  .n<1 ! ! != .!/ ={.  xYT..}.x  x !< ...o. " =/{<J!!"!!!! K#d! K#a<   J,. {<.<.t=//=K..! !!  1/!x p =1f.g}&x  |  x< {. !x/T..}.x  x J {f   J {..<.=/!//. /"x p =1f.g}x  |  x. !x!/T..}.x  x. < {J  X {..<.=/!//. /"x p =1f.g}x  |  x. !x!/T..}.x  x. < {J  X {..<.=/!/!. 0g!x p =1f.K}.|  |   | { xT..}x  x  x .! ! < {XB.X z..<. ,  ,  z..=/-/!. 0g!x p =1f.K}.|  |   | { xT..}<x . < {.B.X z..<.=/!/!. /g!w p =1f.g} |   x  {   !x/T..}.x  x < {J.X z..<. =./ -!c_stack_linksize_tallocated_words_resumedmark_stackstart__kinddependent_sizecaml_ml_channel_size_64caml_channel_binary_mode_IO_codecvtbacktrace_slotephe_infoCHANNEL_FLAG_MANAGED_BY_GCcaml_write_fd__pthread_list_tmemprof_IO_save_endcaml_process_pending_actionscaml_input_scan_linecaml_ml_set_channel_namecaml_raise_out_of_memorypthread_mutex_unlock__next__data_IO_write_base__prevcaml_putword_lockcaml_pos_incaml_fatal_errorshared_heapCHANNEL_FLAG_UNBUFFEREDcaml_heap_state__pthread_internal_listblockvchan_IO_save_basecaml_stat_alloc__ownerrequested_major_slicecaml_ref_tablecaml_ml_inputcheck_pending_chaincaml__dummy_vchannelephe_cur_columnslice_targethash_channelvlencaml_ml_input_bigarrayresultcaml_custom_tablecaml_ephe_infostat_promoted_wordscaml_ml_outputcaml_leave_blocking_sectioncheck_errcaml_ml_open_descriptor_out_with_flagslong intlocal_rootsmemmovetrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_failed_assertruntime/io.ccaml_num_rows_fd_IO_markercaml_plat_mutexcaml_intern_statestat_blocks_markedcaml__roots_rescaml__roots_vchannellengtherrorcaml_ml_pos_outcaml_flush_partialPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_s__nuserscompare_unorderedavailml_channel_sizecaml_sys_io_errorcaml_minor_tablesntablescaml_plat_lock_blockingsigned char_IO_FILEtrap_sp_off_IO_wide_datacaml_failwithcaml_flush__pthread_mutex_sunsigned char__spins_freeres_listbacktrace_last_exncaml_ml_output_bigarraycaml_custom_eltcaml_statefinal_infocaml_ml_pos_out_64caml_alloc_channelcaml_raise_end_of_file_Boolcaml_lockdepthvposvaluechancaml_gc_policycharserializecaml_ephe_ref_table_IO_lock_tcustom_operationscaml_stat_alloc_noexcextra_params__errno_locationmajor_work_done_between_slicescaml_plat_lock_non_blocking_actualflagscaml_ml_set_buffered_IO_read_ptr__jmp_buf_tagyoung_startcaml_runtime_warnings_activecaml_stat_stringextern_statecaml_ml_output_int_markerscomparecaml_ml_flushsweeping_donevnametablescaml_ml_output_bytesreservepthread_mutex_trylockcaml_exception_contextcaml_plat_mutex_initPTHREAD_MUTEX_ERRORCHECK__lock_offsetcaml_enter_blocking_section_no_pendingoo_next_id_localminor_heap_wszCHANNEL_TEXT_MODE__builtin_fwriteunlink_channelcaml_all_opened_channelscaml__framelong unsigned intfinalizevstartcaml_alloc_custom_flags2dependent_allocatedcaml_read_fdchannel_IO_read_baseslice_budgetexn_bucketcaml_ml_out_channels_listflush_partial_unused2longjmp_buffercurrcaml_copy_int64tail__mask_was_saveduintptr_t__sizefile_offsetyoung_end_old_offsetexternal_raisec_stacksigjmp_bufcaml_putchgc_regs__uint32_tcaml_channel_cleanup_on_raiseGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecaml_ml_open_descriptor_outcaml_seek_intrap_barrier_blockatomic_uintnatextra_heap_resourcesdoublerefcountcaml_close_channelchannel_operations_IO_write_endcaml_ml_input_scan_linecaml_plat_mutex_freecaml_really_getblockcaml_all_opened_channels_mutexmutexcaml_extern_statebuffswept_wordscaml_stat_strdupthreshold_IO_buf_basecaml_ml_pos_in_64caml__temp_resultcaml_ml_pos_inunsigned intcaml__roots_blockpthread_mutex_tintptr_tgc_regs_buckets__pad5requested_external_interruptnum_channelscompare_extcaml_channel_descriptor__int128 unsignedcaml_ba_arraycurrent_ramp_up_allocated_words_diffcaml_ml_seek_out_64caml__dummy_rescaml_ml_input_char_flagslseek64offsetexn_if_closed__saved_mask_modevchannel__jmpbufagaincaml_alloc_2_codecvt__count__jmp_bufoff_tcaml_plat_lock_non_blockingvchan1vbufnitemsallocated_wordscaml_ml_input_intcompare_channelnextyoung_limitlong doublelseektowritecaml_channel_unlockcaml_plat_try_lockFILEcaml_ml_is_bufferednum_dimscaml_ml_is_binary_modevchan2unique_idcaml_ml_open_descriptor_in_with_flagsallocated_words_directaction_pendingbacktrace_posPTHREAD_MUTEX_RECURSIVE_NPsizebacktrace_bufferlong long unsigned intcustom__listnreadcaml_stat_blockcaml_really_putblock__off_tdummy_buffallocated_words_suspended_freeres_bufdeserializeephe_refinside_stw_handlercaml_refillfixed_lengthlink_channelherecaml_ba_proxycaml_channel_lockcaml_ml_open_descriptor_in_IO_backup_base_shortbuflast_channel_lockedchar_osdestcaml_getblock__int128caml_ml_channel_size__align__off64_tbacktrace_activestat_major_wordsmemprof_young_triggercaml_open_descriptor_inrequested_minor_gcyoung_triggergc_policycaml_ml_seek_outcaml_finalize_channel_IO_buf_endcaml_getchPTHREAD_MUTEX_ERRORCHECK_NPcaml_string_lengthnamefprintfPTHREAD_MUTEX_NORMALcaml_plat_unlockcaml_ml_seek_inPTHREAD_MUTEX_ADAPTIVE_NPcurrent_stackstderrshort intmoderequested_global_major_slicecaml_seek_outcaml_channel_sizepthread_mutex_lockcaml_getword_vtable_offset__elisionchannel_listcaml_terminfo_rowsCHANNEL_FLAG_FROM_SOCKETextra_params_areatag_tPTHREAD_MUTEX_DEFAULT__valexn_handlerbsize_32caml_pos_out__int64_tcaml_ml_output_charextra_heap_resources_minoryoung_ptrwrittenunitcaml_local_roots_ptr_IO_read_endasize_tdls_rootmlsize_tstack_infostat_minor_wordsuint32_tlocked_filenonotflushedcaml_sys_errorcaml_stat_freeaction_wide_datacl_tmpfreeproxyshort unsigned intcaml_check_pending_actionscaml_putblockbasemajor_ref_IO_write_ptrcaml_ml_close_channelintern_statechan1chan2vlengthcaml_ml_seek_in_64/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tcaml_ml_set_binary_modeintnatbsize_64caml_do_readcustom_fixed_lengthcaml_domain_statestack_cachehashcaml_plat_fatal_errorminor_tablescaml_ephe_ref_elt__sigset_tdatacloseprevidentifierfwritePTHREAD_MUTEX_RECURSIVEcaml_open_descriptor_outmajor_slice_epochdescriptor_is_in_binary_modecaml_flush_if_unbufferedGCC: (Debian 13.2.0-18) 13.2.0zRxA 4,D@BE AAAAAA~kAAAAAAAA~DhB ACA~M CAC ARACAAA~XIC,C AEA~i FAA 4C AEA~H LAD D GAA 8xGpA~K CAA XLpA~K CAA (xC ADA~^ JAA 4CpA~CCA$B ACA~S CAA ,C ADA~b FAA 0C AHA~r IAB P d4DpA~BCA$dB ACA~MCA$TE ACA~FCA0BCF DA A ABA~DAAE8GA~f HAC h IAA 4DF ADA~N HAD JFAH| ABB AABAACABAA~jAAAAAAAAAA(C ADA~U DAA $,C ADCA~QGA$8B ACA~Y JAA `0,tC ACCA~O FAB \G AFA~b IAD AJAGAAA~Q GAD KHABB AAABCA~QAAAAAABA~CA@PBCJ AAA~SAABBEDAA~$<C ACA~k EAB Q EAB IEA$TB AHA~CDA0dC AGA~m GAB D0XtC AGA~o GAD 0C AHA~| IAD C AGA~\K ACAGAAABAFAC A~FII A AAAB DA AAAEC ABAAxXKpA~4C AHA~N IAB dCpA~F DAA 4CpA~DBAhPpA~CCA(40<C AHA~s IAA 0pC AHA~| IAD 40(C AHA~~ IAB 0C AHA~y IAC ` C A K A~qBAfAAQ LAA ` ABB CAB  C A J A~fO BAAhAAAPAIAA A~C E L ABAABC ABA0 $C AHA~v IAB 0 XC AHA~v IAB 0 C AHA~t IAD 0 C AGA~s FAA 0 C AHA~u JAB 0 (C AHA~q KAA < \,C AKA~g NAA 8 C AJA~C LAD 0 C AHA~v IAB 0 C AHA~v IAB 0 @C AHA~t IAD 0 tC AGA~s FAA 0 C AHA~q JAB  @CpA~EDA4#Hh1 Q`  E0 P @ cj00Kh~xx6F\4(38 LP4_hdjT $(@ $X0/p<J_l$xTd0Ht`6xObsXd4h. 4E8SPhh4|((@'X:pL,Zq0@((io.ccompare_channelhash_channelcheck_pendinglast_channel_lockeddummy_buffchannel_operationsstderrcaml_finalize_channelcaml_runtime_warnings_activepthread_mutex_lockcaml_lockdepthpthread_mutex_unlockcaml_plat_mutex_freecaml_stat_freefprintffwritecaml_failed_assertcaml_plat_fatal_errorcaml_check_pending_actionscaml_process_pending_actionspthread_mutex_trylockcaml_plat_lock_non_blocking_actualcaml_write_fd__errno_locationcaml_sys_io_errormemmovecaml_channel_lockcaml_channel_unlockcaml_channel_cleanup_on_raisecaml_open_descriptor_incaml_stat_alloccaml_stat_alloc_noexccaml_enter_blocking_section_no_pendinglseek64caml_leave_blocking_sectioncaml_plat_mutex_initcaml_raise_out_of_memorycaml_open_descriptor_outcaml_close_channelclosecaml_channel_sizecaml_sys_errorcaml_statecaml_channel_binary_modecaml_flush_partialcaml_flushcaml_flush_if_unbufferedcaml_putchcaml_putwordcaml_failwithcaml_putblockcaml_really_putblockcaml_seek_outcaml_pos_outcaml_do_readcaml_read_fdcaml_refillcaml_raise_end_of_filecaml_getchcaml_getwordcaml_getblockcaml_really_getblockcaml_seek_incaml_pos_incaml_input_scan_linecaml_alloc_channelcaml_alloc_customcaml_ml_open_descriptor_in_with_flagscaml_ml_open_descriptor_incaml_ml_open_descriptor_out_with_flagscaml_ml_open_descriptor_outcaml_ml_set_channel_namecaml_string_lengthcaml_stat_strdupcaml_ml_out_channels_listcaml_alloc_2caml_fatal_errorcaml_channel_descriptorcaml_ml_close_channelcaml_ml_channel_sizecaml_ml_channel_size_64caml_copy_int64caml_ml_set_binary_modecaml_ml_is_binary_modecaml_ml_flushcaml_ml_set_bufferedcaml_ml_is_bufferedcaml_ml_output_charcaml_ml_output_intcaml_ml_output_bytescaml_ml_outputcaml_ml_output_bigarraycaml_ml_seek_outcaml_ml_seek_out_64caml_ml_pos_outcaml_ml_pos_out_64caml_ml_input_charcaml_ml_input_intcaml_ml_inputcaml_ml_input_bigarraycaml_ml_seek_incaml_ml_seek_in_64caml_ml_pos_incaml_ml_pos_in_64caml_ml_input_scan_linecaml_terminfo_rowscaml_num_rows_fdcaml_all_opened_channels_mutexcaml_all_opened_channels 20 ZXCC xC ! " " "  "2(&@(62(>@(DCb 2f @n2r0x#  2 @2@0@$ C2200% 2(@(2x0x& 2p0p& D' `( ) ZXC H FZXC  H& F,( T* f2j0l& z2x0x& + ,   H2262>0B0D% , - . - p) ZXC H F*  H F2 0 & &Z*X0CH Z Hb F~2x0x&  H FZXC  H F2x0x& L3 \4 t5 6 7 8 " 9 2 t< ! " " " 2 2 0 0 %  H 5 86 X6 x6 7 5 7 > ?Z ?X ?C `) zZ ~X C H C F = H F Z * "X 22 62 >0 B0 D% Z2x ^0x `& n2 r0 t&  ` ( `  `  `8 `d ` ` `2(0(F p. .  `X. .  `H `T5 h6 7 7 > 0, TL ,  HL H- PN M $M .2P20P4F L ,  H. T. . . ,- Q 05 D6 \7 7 > , HhL . P, h- 20W 20(2 L ^Zf2(j@(nXpC2(C@( 20W 22x00x% "2(&@(62x:0x<& J2pN0pP& |X 202  Z2(@(XC22(4C>@(D V2f0hW 22x00x% 2(@(2x0x& 2p0p& Z >?ZJ?XP?C) ZXC H F" ] C( : HF FZ* X H F" ] ^ 2200% 2x 0x & 2 "0 $& N?Z Z?X \?C ~2 0  Z 2( @( X C! 2!2!"0!&0!h4 !C! !2!0!W "` "" "|% "2"2"0"0"% " "2"0"a #2x#0x#& #"2p#.0p#<& #|, #> #?Z#?X#?C$ ) $:Z$>X$@C$V H$^ F$t" $20$21$00$01$5 $< $7 $Z$X$C$ % H% F%D* %b2%f2%n0%r0%t% %2x%0x%& %2%0%& %> %  &, & > &L  &Pf &?Z&?X&?C&2&2&0&0&% '>?Z'J?X'P?C') 'Z'X'C' H' F' `'C( ( H(" F(VZ(X* (bX(r2(v2(~0(0(% (2x(0x(& (2(0(& (?Z(?X(?C)P) )jZ)nX)pC) H) F)C) ) H) F*( `*< `*fZ*h* *rX*2*2*0*0*% *2x*0x*& *2*0*& +.?Z+:?X+@?C+) +Z+X+C+ H+ F, C, ,2 H,> F,x `, `,Z,* ,X, H, F, `,2,2,0-0-% -2x-0x- & -.2-20-4& -^?Z-j?X-p?C-) -Z-X-C. H. F.E .(C.< .N H.Z F. `. `.Z.* .X.2.2.0.0.% / 2/0/& /2x/"0x/$& /N?Z/Z?X/d?C/) 0Z0X0C0* H0. F0T. 0. 0 `0C1 1 H1& F1h `1| `1Z1* 1X121210101% 12101& 12x20x2 & 2 n 2>?Z2J?X2T?C2) 2Z3X3C3 H3" F3X. 3. 3 `3C4 4 H4& F4fZ4nX4p* 424240404% 42404& 42x40x4& 5?Z5?X5 ?C5) 5Z5X5C5 H5C5 F5I 5 5 H5 F66Z68* 6BX6R26V26^06b06d% 6z2x6~0x6& 62606& 6?Z6?X6?C70) 7JZ7NX7PC7f H7hC7n F7|I 7 7 H7 F7Z7* 7X828280808% 8*2x8.0x80& 8>28B08D& 8n?Z8z?X8?C8) 8Z8X8C9 H9C9 F9$ 9: H9B F9* 9Z9X9C929290909% 92x90x9& 9, :> :2:"0:$& :N?Z:Z?X:\?C:) :Z:X:C: H:C: F; ; H; F;$f ;T* ;^Z;bX;dC;2;2;0;0;% ;2x;0x;& ;2;0;& ;?Z;?X<?C ) >:Z>>X>@C>R H>TC>Z F>dP >| > H> F>Z>* >X>2>2>0?0?% ?2x?0x? & ?.2?20?4& ?^?Z?j?X?t?C?) @Z@X@C@& H@. F@`L @p, @ H@. @Z@X@CA A HA FAt. A* A. B. B2B2B&0B*0B,% B@- BN2BR0BT& Bb2xBf0xBh& B?ZB?XB?CC0) CJZCNXCPCCf HChCCn FCQ C C HC FDZD* DXD"2D&2D.0D20D4% DJ2xDN0xDP& D^2Db0Dd& D?ZD?XD?CE) EZEXE CE6 HE8CE> FELS E` Er HE~ FEZE* EXE2E2E0E0E% E2xE0xF& F2F0F& F>?ZFJ?XFP?CF) FZFXFCF HFCF FFS G G" HG. FGfZGh* GrXG2G2G0G0G% G2xG0xG& G2G0G& G?ZG?XH?CHP) HjZHnXHpCH HHCH FH H HH FI* IZI"XI$CIB2IF2IN0IR0IT% Ij2xIn0xIp& Ix, I> I2I0I& I?ZI?XI?CJ,) JFZJJXJLCJb HJdCJj FJ J HJ FJf J* JZJXJCK2K2K0K0K% K*2xK.0xK0& K>2KB0KD& Kn?ZKz?XK?CK) KZKXKCL HLCL FLU L, L> HLJ FLZL* LXL2L2L0L0L% L2xL0xL& L2L0L& M &3&@ 30&`83H&0P3`&h3x&P3& 3&3&03& 3& P3& 3 & (38& @3P& X3h& p3& `3& 3&P3& 3&3& 3&3(&03@&H3X&p`3p&x3&P3&@3&3&3&3&3& 30&p83H&P3`&h3x&03& @3&#P3&#3&%3&&@3&&3 &&(38&'0@3P&(X3h&*p3&+ 3&-P3&/@3&2 3&203&53&63(&8`03@&:@H3X&;`3p&=x3&?P3&B3&D3&F03&G3&I3&K` 30&M83&&&&&  &*18? F 1MLT` lzTv X ]h  [' 4 A7N[hu e N[,[+ .80E S/_g m %q8DQ^dk;x=j"x 1  B  ' '3/?VudXi uJ}r<x D+9GUc iqr  , Pg   '5CQ_m{C 5!o-}9 E!QD] miu 7a  Z)5GQ`mQz, ,    h % )? C P c m` z L  6    C  ~   # _ 0 l j ?   #  q  B H NN T Z ` fk l s ^  8     b    B & z 3} W ] c i p |Y L    !      ,L F ` m z!    L  !2e9 >/Jfs  HB \ &06 N1&: CG&P ]&ftt  N j SI;eA {!28#DU lV2C++\BX)o&M6 &M &K`6,&S %TLZ+6:{? JN^bgp {&K; &K_,&&KuLHuc_ &K$z(v15:&LK&V&Kl&L&L &L &L4&L&x&L40&LH&LY&f&} &I6.(S %VNZ}  ,( 37<&JU&J$^Yos |&J(1+&J(QMhd&J<{&KL&"&J48&JR&J|[lpz&J&J&J3/&K8&x&J$&K5&B&T _&Gv6^XS %~Z J  &HH!i2"6?&HLHSDW>`&HLizd~`{w&H`&I&&HX&I&H/3=&HFW[d&Hmx|&H;.*&Ix&x&H&I\& &&I'&I;F&F0]6hYlS|yS %Z Z   &F&&F/:>>8G&FPa^eZjsuwq&F&G&&F&Gp&G#&G,57;D&GMK^bko t&G&x&G&G&G&&&D6<6/b3\8SD %OSXZhsw|  &D &D& ! &D< A =<& X* T3&E<KM oQ kZ ^ c&Ft&&E&E&EPZ  &EP~  &Eh     " '&F 8&x C&Eh Y&EP q&E & &  &B 6       E  ? m  k  e !  ! !S! %!* !. !3Z!C!N !R !W !b !f !v !z ! 4! .! V! P! ! ! t! r!&C(! /! ! !&C,! Z" " "&C," p") "- "2 p"; "? "H&C@"Q "b "f "o "s "x&Dl"&"&C8"&D"&C" " :" 6"&C" " Q# M# &C# #& h#* d#3 #7 {#<&DX#M&x#X&C#n&C#&D<#&#&#h#&?P#6# # # z# $ $ L$ $ $$% $) $.S$: %$E -$I %$NZ$^$i W$m S$r $} q$ k$7$ $ $ $ $"$$$$}$)$$$H$&@$ % % %%&?%" t%3%7%@&?%I %T>%X8%a&?%j %{]%Y% %s%o%&@% %%%%%&B\%&%&?%&A&&@& &0&4&=&@&F &Q&U&^&A&g &x&|&& &&Bp&&x&&A&&@h&&@x&&@&&@' &A|'"&A':&B 'R&B4'g&'t&'&BH''&='6'9'3'S' %'['S'Z'( ~(z( (("(0(4(9 d(B (M(Q([&>(d (u (y(&>( (&( (&>( (@(<( (S(O(&>0( (f(b)y)u) &?<)&)(&>()>&>)X&>p)a %)r)v)&>p) D)))&>) Y)))))&?()&x)&>*&>h*&? *+&*8&*J *U&;*l6*w*{*S* %*$**Z**G*C* *d*X*** * *++ & .G.K.T&:.] .n.r.{..&;.&.&:.&;\.&:. ...&;/ ///&;/( !/3?/79/@&;/I ;/ZY/^U/gl/kh/p&;/&x/&;/&;/&/&/|/&8`/6/00S0 %00#0(Z080C0G0W0[0` 0k0o0t 0} 000&80 07010&80 0S0M0&80 .0m0i1 .1 1|1&81  911151>1B1G&:,1X&1c&81y&91&9 1 D111&9$1 T111&9$1 }112&9,2  22!2*2.23&92D&x2O&9,2e&92z&2&2&:2&:2 2&6262>282^2X3S3 %33x3#Z333>3B3G 3R3V3[ 3d 3o3s3}&7(3 z333&7,3 333&7,3 333 3*3&3&7@4 4=494%P4)L4.&8L4?&4J&784`&74z&74 4u4q4&74 444&74 44444&885&x5&75$&75<&85M&5Z&5l5w&55655555S5 %555Z55:565 6Q6 K6 o6 6"i6&g60&5x696Jx6Nr6W&5|6` 6k6o6x&5|6 $666 $666&56 /66666&66&6&57&6@7-&576 :7G 7K7T&57] T7h7l7u&57~ d727.7E7A7&67&x7&57&57&6l8&8 &88*&208A68Ll8Pf8U8`8d8im8t8x8}888S8 %888Z8888 8887819S9 M99 9%k9)i93&29<T9Mz9Qt9Z&29cn9n9r9{&29~999~999&2999999&49&:&2:&4x:0&30:9:J&:N:WZ:[T:dr:hp:m:v:zz:&3:::::::::::::&3:::;&3;&3`;9&3;[&3;d;u;y;&3;;;;&4;;);%;<;8;&4;&x;&4<&4<&<#&<5#<@&2 > >>>>&>*>3->7)>@&0>I>Z>>^<>c&0>}&0\>&0>I> >H>F>&/>>W>Q>&/??s?m?&/?%?6?:???H?L?U&0?^?o?s?|??&1?&?&/?&1?&0????&1`@&1`@@'@+@0&1l@M&1@m&0@v@ @ @&0@3@ $@ @&1@>@ 7@ 3@ J@ F@&2@&xA&1A&1A(&A5&AGAR&-PAi6At qAx kA A ASA %A A AZAA A A A A AA A!A!B &-BB#!B'!B0&-B9&BD!0BH!*BQ&-BZ6Bk!JBo!FBt6B}!]B!YB&-BAB!pB!lB!B!B&/B&B&-B&.C&.CLC !C$!C-&.CG&.CPWC\!C`!Ce&.C&.C&.(CbC!C!C&.(CwC!C!C&.DCD!D!D"D"D&/,D+&xD6&.DDL&.Dd&.Du&D&D D&+ D6D".D"(D"ND"HDSD %D"pD"hDZE E"E"E! E,"E0"E5E> EI"EM"EW&+E`WEq"Eu"E~&+EE"E"E&+EE#E#EE#E#E&+EE#-E#)E#@F#<F&-<F&F$&+F:&,FT&,F]Fn#eFr#aF{&,pF&,pFF#xF#tF&,|F&,F&, FG #G#G&, G G+#G/#G8&,(GAGR#GV#G_#Gc#Gh&-(Gy&xG&,(G&,GG#G#G&,G&- G&G&H 4H&*H-6H8#H<#HA HL$"HP$H[HHf&(H}6H$OH$IHH$oH$iHSH %H$H$HZHH$H$H H$H$HAI I$I$I&)HI(I9$I=$IF&)LIOIZ%I^%Ig&)LIpI%(I%$II%;I%7I&)`I I%NI%JI%aI%]I&*I&I&)XJ&*pJ&)J%J6%J:%JC&)JL+JW%J[%Jd&)Jm6J~%J%J%J%J&*J&xJ&)J&* J&* JLK%K%K &*,K'&*@KB&*KS&K`&KrK}&'0K6K%K%KSK %K&K&KZKK&>K&:K K&UK&OLL  L&mL&kL"&'L+eL<&|L@&vLI&'LRuL]&La&Lj&'LsL&L&LL&L&L&'LL&L&L&L&L&(L&L&'M&(`M&'M(M9'M=' MF&'MOMZ'#M^'Mg&( MpM'6M'2M'IM'EM&(M&xM&( M&'M&(M&N&NQN!&&N86NC'rNG'jNP&&NY&&Nq'Nu'N|N&&N6N'N'NN'N'NSN'N'N %N'N'NZNO'O 'OZO O"(O&(O,&&O=&OJ&O\SOg&&@O~6O((O($O&&PO&&XOnO&%O6O(>O(:OO(TO(PP&%P&&P)&&(P=PH& P_6Pj(iPn(cPsSP %P(P(PZPP(P(P P(P(PP(P(PP P)P)Q& XQ eQ)/Q))Q(& \Q1Q<)KQ@)EQI& \QRQc)eQg)aQlQu)xQy)tQ& pQQ)Q)Q)Q)Q& |Q&Q& hQ& Q& RR)R)R%& R.R9)R=)RF& ROR`)Rd)Rm*Rq)Rv& hR&xR& R& R& LR&R&RiR&#S6S*'S*!SSS' %S2*IS6*AS;ZSKSV*lSZ*hS_Sj*Sn*}S}*S*S S*S*SOS S*S*S&$SS*S*S&$SS+S+T&$T T+0T"+,T'T0+CT4+?T=&$0TFTW+VT[+RTd+iTh+eTm&%T~&T&$(T&%LT&$T$T+T+T&$T9T+T+U&$U DU+U+U(+U,+U1&%UB&xUM&$Uc&$|Up&$U}&$U&$U&%|U&U&U&%U kU&#PV 6V+V+V),V-,V2&#V?&#VS V^& @VuNV,'V,VSV %V,RV,JV VxVJV V,uV,qVtW ,W ,WW,W!,W& RW1-2W5-W:zWC WN-WR-WW&!pWn&"W&"W&WW-W-W&!WW-W-WW-W-X&!X(&" X?&"$XMXV Xa-Xe-Xo& XxKX-X-X& XoX.X. X.!X.X&#DX&pX& X&!YY.HY.BY"&!Y+Y<.Y@.yYI.YM.YR&#Yc&xYn&!Y&"Y&"Y&Y&Y*Y&0Y6Y.Y.ZZ .Z.ZSZ! %Z,/Z0/ Z5ZZEZP/7ZT/3ZY Zd/NZh/HZm@Zv Z/fZ/dZ&ZZ/uZ/oZ&ZZ/Z/Z&ZZ/Z/Z[/[/[&[[*/[./[7/[;/[@& ,[Q&[\&[r&[&[ [0 [0[&[%[0[0[&0[5[0/[0+[0B[0>\& \&x\ &0\6&\C&\P&\]&\j&\w&\&\&\ ]\&\0g\0c\& \X]&]%0}])0y].B]90]=0]Bx]M0]Q0]Z&]c3]t0]x0]}3]0]0]&]&]C]0]0]&]b]1]1]10]1,^&^&p^&^6& ^?m^P1U^T1Q^Y&^j&x^w&^&@^^1h^1d^&L^^1^1^1^1^&^&x^&L_&T_!_-1_11_6_?1_C1_H&p_Y&_u_&p_1_1_&_y_&_1_1_B`2 ` 2`x`21`2)`(&L`1`B2S`F2O`O&T`X`i2x`m2t`v2`z2`&X`&p`&T`&``2`2`&`&x`&a &aa$2a(2a1&a:aK2aO2aX2a\2aa&Dar&xa}&a&a(a3a3a(a3(a3&a&a&a&,b .bxb8bC&@bZbe34bi30bobz&bb3Fb3Bbhbb3Vb3Tbb3^b3\b!b&`bc3hc 3dcxc3}c3yc#c.3c23c;&cD cU3cY3cb&ck&c|3c3c4 c4c& c&pc&c&c&c4,c4*c&(d&(d 4?d$4=d-4Id14Gd7&(dP&PdY1dj4`dn4Zds&d&d&d&dPd4xd4vd&dtd4d4d4d4d& e&xe&e.&e;&eS&e`&em&e&e&e&e&e&@ee&e f4f 4f4f4f)59f-5/f2Hf8&(fA&0fY&pff&fs&Xf&pff f yf&f f5zf5pfRf5f5g5g5g &8g&Lg6&dgC&gP&gd .go&@gxg5g5g65g6-g6\g6Rg6g6g6g6g&hWh&Ph% h06h46hB78hF7(hV7~hZ7zhh7hl7hqh|8h8 h)h8Jh8BhHh&h&h&h&h&h&\i&i4&iR&4ifNiv iCi&pi i8oi8gi&ii&j j8j8j!8j%8j*Hj0&j9&jF&j^&jk&Pj&Xj?j&j8j8j8j8j9j9j9=j93j&8k&\k.k> kLkW kdRk?k kFk>k kl l l- |l8 lREl] lklv ll l l&l l9il9all9l9ll9l9lFm9m 9mHm&m&m6&mC&m[&Lmp&m}&m&m&m&m& mkm n)n& n% n/:n39n8nB:8nF:0nU:]nY:Wng:wnk:snpvnu& n~& n& (n& @n& `n& o & o& o$& o1& oE oJ& Poa ok:oo:ot& |o& o& o& o& o& o&o&op p p*&0pK:pO:pT p^:pb:pg&Tp&dp&|p&p&p&p&q& qq q(q2 q>(qZvqd qp qu&qxq:q:q&q+q;q;q&qEq;7q;3q&qZq;Lr;Hr ;_r;[r& r&&xr1&rArKxrWraxrmr|rr4rNrs&0s ;s$;s-&s6sE;sI;sR&s[sf;sj;ss&s|s;s;s&ss<s;ss<s<s&ss<&s<"s<9s<5s&tt&t&t/&\tJ&tStb<^tf!v>v>5v>3v& w& w4>Aw8>=wB& w]>Wwa>Swf& w& w>ow>iw& w& w>w>w& ,w& `x>x>x& x8& xA& xY>x]>xb& x& x>x>x>x>x& xx>x>x&x&Py ?y ? y?ny?^y#&Py,y=?yA?yK&yT ye?yi?yr?yv?y&0y$y?y?y&<y&y/y@y?y@y@y&\y&\z @-z@+z&hz3&z<DzM@9zQ@5zZ@Lz^@Hzg&zp&z@]z@[z&z&zOz@iz@ez@|z@xz&z&{@{ @{&{-&{6&{N@{R@{[@{_@{d&{u&({& {@{@{@{@{A{A{A9{A-{Al{Ad{&{d{A{A|&|&x|6&|U&|pA|tA|}A|A|A|A|B.|B(|&||o|BH|BD|B]|BW|o|Bw|Bs|B|B|&}}B}B}&}4&`}L&}g& }B}B}B}B}C }C}&4}}C}C}&@}&@}C/}C-}&L~&~"&~?C9~CC7~LCC~PCA~Z&~g&~{&\~&p~&~&~CO~CK~&~Cm~Ca &'C+C5GPCTC]g&(~&<&P&CC&CCCC& &#'&& &x&x N&& N<&xN&x&&7&xI&x&&&x,&x & & &x &x & ,& &x &x&&&x)&x&&&x&x7&G&&x&x= N&& Ns&x&x&&&x.&xW&g&&x&x&&L&x\&x&&C&xS&x&& Q&x a&x!&!&"&x"&x#G&#W&#&x#&x%h&%x&%&x%&x&&'&'P&x'`&x)&)&*&x*&x+p&+&+&x+&x-&.&.(&p.8&p.O&._&.o&.&x.&x.&x/&/&0I&x0Y&x0&1&17&p1G&p1o&1&1&x1&x2Z&2j&2&p2&p2&2&3&x3&x3&3&4&p4 &p43&4P&x4&4&x; N;* N;f&x;v&x; N<@&&x>&x&&0@D`0P< \|0  P   T h   `  PH   <dpxP@THp\0 @|#P#%&@ &,&@'0t(*+ -P $/@ 2 20 (5 \6 8` :@ ; ,= `?P B D F0 DG xI K` M.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.tbss.rela.data.rel.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @M@ @Z&M,M16MH1@ x ;2SOUJ@TU_U@Z@ ` tV.o@ 6C@) 8!0@6H0!3B@6x0v^0 , @6H( 0 X)<lexing.bd.o/ 0 0 0 644 14512 ` ELF2@@|t,| A%(9@|#xE8% %0#U<||J}FH'})tU)@.})R, A9`HE@,*A8C } JU)<})}R|PL}JtUJ@.}J:| @A#}FJ}&H }tU@.}J,A,@e@#U<||J}FH'})tU)@.})R, AC(}R|PL}JtUJ@.}J, A}J0yJ9JE8|$8@$E|t8| P(} JU),@(HP`yh}*} **U(>,A0 y)h9JU>,@|**U(>,@|%(x8%08K```C@} R}IP(U)@.})R, A,P})H(}I@})BUH>,@,K``yh}*} *IUH>,A yJh9)U>,@*Kx#(HP|J}GH%U)@.})R})}IB})@U(>,A`8H,```yh}0*} 1**U(>,A0 y)h9JU>,@|1**U(>,@8!})y)8iN x8!}`|cxc8cN | 4:!; 9 IB1B:!; 9 IB41B: ; 9 I !I 4:!; 9 IB :!; 9 I 4:!; 9 I U 1U :!; 9!1RBUX!Y W H}I~.:!; 9! ' ! % $ > &I.?: ; 9 '<I.?: ; 9 'I@z1RBX Y W : ; 9 I.?: ; 9 'I@zSS S S S ST T U U U USS S S S S U U U UT\V\V \ V \ Voo o o y  o oV VPP P P\\ \ \ u8$u" ws("#8$ws("" V Z z z~ Z z Z z~ Z z Y Y Y X W X W 8$" n Z z z~ Z z Z z~ Z z Y Y Y X P X P8$"ws("#8$ws("" ws("#8$ws(""Y Y n o Y y y~ Y y Y y~ Z Z X W XSSSSSSTTUUUSSSSSSUUU(T(XXXXLxYYYZpPP,                 q runtime/usr/includeruntime/camllexing.cstdint.hconfig.hmlvalues.hfail.h  ! z :"!-2 !  !'6- e.  ?( .1J ." . .-Y   !0$" X!/!!!  #6 / !#  /. J$/ !!  !S - S. -.dJ <  J <J 3 z :"!-2 !  !fJ- .Z  ?( 1 f" . "! <"< X 1X! 4 .- F  !.' f!$1 D / !# / f$/ !! <.O<%! ! <%! R. !`  t !> # !> w ! /)!$!! !X "X#  /' ..'   n  t !> # !>..-!% ! <%! Z. !A M  t !> # !> w ! /"6J 6.J 6 X (.X ( X (. k  <.caml_new_lex_enginepstateshort intintptr_tcurr_poslex_eof_reachedvaluelex_last_poslex_base_coderefill_buffuintptr_tlex_default_codelong long intlong long unsigned intlex_baseintnatcaml_failwithpc_offlexing_tablelong doublecaml_lex_enginelex_last_actionlex_transunsigned charGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslex_checklex_buffer_lensigned charuintnatrun_memunsigned intstart_statelex_memvlexbufshort unsigned intlex_backtrkruntime/lexing.ccharrun_taglong intlex_check_codelexer_bufferlex_start_pos_Boollex_curr_plong unsigned intlex_backtrk_codedoublelex_abs_poslex_curr_poslex_start_pstatelex_trans_codelexbufbacktrkbase_codevtbllex_bufferbaselex_default/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-belex_codeGCC: (Debian 13.2.0-18) 13.2.0zRxA  tpA~DAP8|CUAq AAAC PAfEAA AAEA A ACA~     (|lexing.ccaml_lex_enginecaml_failwithcaml_new_lex_engine20 ~20 &3& 3 * 1 1&* 1 8 OF M T [ b i p | B % t     G  g h    t ) M4 ? 7J U ` l w  % %   Z  ~  X   & % / 3  8 B PF LK  U jY bh l q {         X J         g   & &# +' )0 E4 3= wF J S W _  h r v &      ' W Q u m <      &H L   % ) 2 *6 ? WH hL dU }Y wa&r& G  . &! + / 4 > B G  Q U d h m w H{ B  j `         &&&&< .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@!&,12E0@@!`O(J@"`[ i~0y@1`0 =@100Z |@10  <1/0 0 0 0 644 35160 ` ELF@@|+xC|#x, A}IyD 9I9)|PPy($x$```}%@*| H@L,y)}I@*| P@L,qGyJAd````}*@*| H@L,q'}CSxy*@}ISxC|*0@@D}I@*|ex| P@L,qGyJ@}#Kx}ISxC|*0@A```9|( @@H,+M N ,+8`@N ``|#x;;9`8}, *| H@L,y)}I *| P@L,qHyH}*KxA0```|"} Cx``|}8|(P@ } 9@L,@|9( }@H,*@ }`I@L,@p9C|0@L,||0@L,| ||P|&(@ }Q@L,|&TA,AG| P@L,yJ}* *| H@L,q(y)@$ |(@@8}LSx}I *| P@L,qHyH}*Kx@} Cx |(@A}!*}_!*8($ @j|cx|ctxcтN `|;|x8`!qH`,#A??| ?;8`H`,#A9 #??| ??|?9@9 (}I8``_| } I*_| |I*9)B8!|N A #>8!8`xc|N `|||x|+x|#x|3x!a8pH#|)A<ap|)AT,>A #>,?A #?8!8`xc|N ``8!8`xc|N ```|A|#y!|yx|+x!!A,:A;:p~xxDx#xH,|x@a=@=9aJ ̀|}'Q9)bU|@(|8@ } A-@L,@U(=@|P@<````U):xU*;| 8A,;;{$ADxH`|{yA,[9 ; AT9?9hy) 9[(q'8@$y)B})9(89 | )| *9GB!Ap|9)(}H|(P@ `I@L,@,@tx;"(~x```V ;>|} |(P@ i@L,@`;|@9|)@A`a8!8`!A|N `9p,'p9[0| (@K8`a8!!A|N `8`0H`|{yA9 [:;; K8<V|} |(P@tiAlK ) S/*eLLH+e,- a{~. sk8^^|^n  ^/^YcH sk1 key=~}^HH^vHtmp^ $  ^0tmp   ^tmp^ H(!^ytmp^ STUV STUV^1ALH m skL1 keyL=LJM~N} X HY^Z^^ m^ f Hh^8oo^qHr r ^(  ^ 0H ^ STUV n r  r 2!f 2<3G OH4S *Xc5op{ /S T UWe Se S0Q S  S STUV/ =S T U P /S T U Q3H < sk35 k3A key3M <4* <5^P6^7 STUP&H sk&/ key&;&I <' SSTU0 ^(skCkey7D^^^H H   r   ^[tmp^tmp   ^^ Hsk.key://^^^6H^ H tmp   ^^ Hk ^^ho+c`^6^0^ ^tmp   ^7]!sk]0R^ r8^j} H~~^^eSeS QS 9@ H:rA BH! H;o H H! L  L 4:!;9 IBI~4:!; 9 IB  U$ >  U !I :!;9 IB H} :!; 9 I8 4:!; 9 I : ; 9 I 41B( IH}4:!;9!I4:!;9 IB4:!;9 I:!; 9 IB.?:!;9!'I@z&IGI:!;9 IB:!; 9 IB4:!; 9 IB :!; 9!I4:!; 9 I .:!; 9 'I@z! "% #$ > $ % : ; 9 I8 &!I'> I: ; 9 (: ;9 I).?: ; 9 '<*.?: ;9 '<+.?: ;9 '<,-.?: ; 9 'I<..?: ;9 '@z/H}04: ;9 I1!I/ 21UX YW 3 1U4 15 1U6 : ; 9 7.?: ; 9 '@z84: ; 9 I 9.: ; 9 'I :4: ; 9 I; SmSoSonsS#oo s oS#SoSoSTnTnTYYYYYy10y1y1z1z1SSVvXvX[{z{vYYZzYYy1!WZYVVYy1!ZZZVVZZ S iSiSiSiSi T jTjTjTjTj U mUmUmUmUmUm SSoSSyXYYyXZZ#ym o0 SkSkSkSkSk s s  00000 0 x#3%# x#3%0wZZs(x#(YYSkkkSk1mmkkS#YYS#eS# Y YYY 0 o0o W      WW      YY S l S l S T m T m T U o U o U V n V n V S SS SToT o TUnU n US S4S4SSS T VTU[TUUT0TpYpZSYS040lZYZY040dlz1p1y1z10 $Z$(Y(4y{Z4s4S#sS# $ZZ4pux"PTYdlZZTpyx"yx"dlZZYpzx"sx"YSSTPU(UV(V0\0YZXZYZt"t"#Z0XYYXY@t~3%#t~3%#t~3%#|t"Yz11y1z1ZZyt"yt"ZZ0YYx 1ZV`YVZXZYzt"YSoSosS#0yX3%yX3%#yP3%#y"zy"y"zy"zy"80, 1 TdhlTd                runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/camllf_skiplist.cstddef.htypes.hstdint-uintn.hstdint.hconfig.hlf_skiplist.hmisc.hmemory.hstdatomic.hN N!!  Nr J  g J!J 8: YJ 0 :   )&y < 8:    xX</#c  6~t6y.<< N   , o J! J  =  L <  X    .X  4J+#.<..XX.  J ! <Q / ?Q 2  = I J  =    3  .!7 , ." 4~4=4!4&4z /%0 ""! != ""0 ""/ != '?z &JJ .$ %Xd.OO*KO*="D "< y./ & $< 0i0 ! >   4/ "/ # !< J v  < PP2P!.0\!}<U   " X       !!2+ .&} !&> 0!!!!!" ! t / ! !<4! <4!     JX  !%X  g  !<X 4y ! X  J f  IX ! !! !.4!. 2&. f }X& 0 0!!/" ! _   K    ~X.X . < qX  & O&H \&( x & !  U K      \          & B L& m  q        O  E   }  y &D  &         #  '  ,\ 6  :  ? J  N  S- ^  7 b  + gN r  m v  a { 3   & a   $   &@ a     $    $  (  -42a=  .A  *F$Q  IU  E\Bl  Xp  Vu&a  d  `$  ~  |&0                #\-  1  6@  D  I-S  wW  k\c&HlMq3{    &Pa    $    ]      -  )a  @  < $  ]  Y!m&0  n4  l9DMXb  yf  wlu        &&a    $    &6    #-  1  7&HR  V  [e  i  p&Pa$        &da    $    F& $ )26< D@ <ESd th lm&6    6    &0&l&&"=3IYad$q|n&~&&&&&&& &&00L|   @.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @KH& , 6 1@N;2 O oJ@P`0[ |n$zi@x 3~0~@80 355 @h0@v+0E E@G J @main.bd.o/ 0 0 0 644 4936 ` ELF @@||#x!H`8`H`AintNp $8 @ 808! 0ST S0$ >  !II:!;!9 IBI~% U$ > : ;9 I .?: ; 9 '< .?: ; 9 '< .?: ; 9 'I@z H} H}>S0ST0T,00S runtimeruntime/camlmain.cmisc.hsys.hcallback.h z&z 4/long long intshort unsigned int/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beunsigned intchar_os__int128caml_mainlong unsigned int_Boollong long unsigned intunsigned charmainlong intdouble__int128 unsignedargcGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablessigned charlong doubleshort intcaml_do_exitruntime/main.ccharargvGCC: (Debian 13.2.0-18) 13.2.0zRxA 0DpA~    0main.ccaml_maincaml_do_exit  &3   !  & - 4 B I P W ^ pe l s z   }      &      + '&1&$&,&& &b&.symtab.strtab.shstrtab.text.data.bss.rela.text.startup.rela.opd.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame@!@'@1@0,@0Dp?@0NEI@0ZmBh@ @0 0}@ p0 @ @ 00v ,@   major_gc.bd.o/ 0 0 0 644 279392 ` ELF;`@@ |?|~xj!q,=AHP=|} P})} Q@L,]x|=")| H@L,})PQ@,8!|N ```9 8!=|N ```<A:`BH```((#9 y)^`BA}^Jx@,>ۡHA<5=d`BAL!`B="=B }9Ɋ~HQ22X$$2A`BrˡH^`B?h:@/A`;dA`BA!`BɁf`$a`BɁf$2^`BA<ex88`@^`BH`<%x8`@8H`<~x8`@8H`<Ex8`@8H`<~ųx8`@8H`<~x8`@8H`<~ex8`@8H`<~Ex8`@8H`=" 2LAA^`B<8`@8>"H`<x8`@8H`|4:1~x@x|)@~Ix|9}@@}JJ}@A@L,_|} })R} @L,9 ?|=")| H@L,|=B |@@L,}HP{|)@AD9<()@(|=")| H@L,,7?x8UA$=")( A=By) 9J|H|="i| X@L,|I| P@L,|=")| H@L,|*H@?;@ ?;|=" |@L,~xex&x8cxaxApH`,8@`8!`aˁ!`Ahapx|!AaN {{B})Sx!5=d`B*@y*y)B}JKxA`B*K`{{B})Sx:!`B*K``(9 y)^`BA}EJxK```|=")| H@L,;K{{B})Sx!`Bˁ*K0```dx8`H`$x8`H`~x8`H`~Dx8`H`x8`H`|<| @L,8`H`|<| @L,8`H`x8`H`8`H`K`~~@P||(@L,|<|0@L,<8`@x~hx8H`|} })} @L,K\``y*y)B}JKxA`BɁf`*K8```{{B}JxA`B*K```<b>;@:!A; ;`::s:H,`{I&;Z} JI*(;{|;@@@\{i&|JH*'}?P()})t9JA|?@A(K``@}*9AT;|1@@\{x{{x{$H`~Ґ6@~@#|}x,)@:@(;~IKx|1@=A;{|;@@AH~!Aa{{{$g{>:c{:H`;;|;AsA@4|?H@@="))|?H@Aa|5@A`3Sz${$~|)PAy*&9)8!|xP3}(RQ*a!A|N ```8~x~óxH`K4``<H@,?@}[jCx*9)*H`,@4=")| H@L,,)ACxp!xH`,@{j;9);|=B |@L,|9 *|=B*|@L,?x|*;Cx9);H`,@,8@,9A`;`Hp```>H,)@?P,)A^X,*A*?X>X?,)@H?8,)@xhH`,?A=, @T> ,)A|9]h} P9)} Q@L,,)A~ >H,)A`|9]p} P9)} Q@L,,)A`~HK4`<P?X>XKx`<, @8x,>@\JI< K```<9_9A,*^xJȑ A0{B}I9I9)ȑJJȑ BAK`H,A9 =B*| ,="AtK`||x!A?P,)AT|??;;|} 9)} @L,,)A=")( A? ,)@?H,)@;xH`,@H=")})jI9JI|=H| P@L,_h|Ix9JIH`,@H`||x|} 9I}@@L,,)A|? ,)A\?H,)A8!N ```?,)@?@,)@? ,)@```|=B9J} P9 }Q@L,,)A9 ? ?H,)@||=B9J} P9 }Q@L,,)A9 8!?HN `a?b{?!;!pA;;@ix`8$x!pAxxH`=H|;H@A=")( A!AaK`<?9>>>;z;9j::;::H(```=|)A(A ;=W|)A(=|)@|@L,=W|)@8!a!Aa|N `|cب|?@ } ٭@L,@LsA,>A,y8,3A ~ex88~xH`=8Kx| (@{ ~xH`=||xW|)@```8~x~óxH`K``!A>">B:R:1~Dx~#x83H`,>A="8j~,3A~Dx~#xp83H`p!AK``<, A?W\|*HA$p8!N ``=p,)@W>( A\{ް( {PSxAp8!}hxH```{޲{$P?\W|*H@\Kx`|<"1>~x~x2, @r@LQ2zsU)|*HA\(3@=:9```u|@L,/|#HA49|)Api@9#HX`cpi9#@tC, AhC, A\I, API, ADuT|*A4I|hx, A), AQ(U)|*HAD|3p@:@89@4;P|)As@}Jx, @`~Yx,0;A ,?A;px!Aa)(|8H@<8Ap,)A?c````88xH>,)@H>,)@,?@X>, @>,)@>,)@8!|N ```,?A(px```?, @x,?@?;xH`,@=")})jI9JI|=H| P@L,]^|HIx9JIH`,@\>px, A9 =B9J>|} P9 }Q@L,,)A>, A<, @K<Ww|4@A,>@9,)@H,:@?j?,)AXI|/@}JI@$8! @xxAa!A|} N ```|/@@,yh= }XRa)y)9e)a)|5HArA<, AW|3@A|2@~P@W>:, 88A s08x,})+xAUJ>';( {@H`P~PKx`<, @8```{{$~PK```;@K``|}@8|*@ } 9@L,@}_SxUJ>( ;{A,Hh`!a 9)y*&9}'RP*i}=Pqx})t|)@}JvP8yJ$~=R|1@@ ="=9)ay>!=">9)e::!:aH;|=@@,>A;|?pAs@<&H@@="))|?H@A~5@Aps89?|9|I@@,="))|?H@@a8~xH`|?pA@;{h|=@}8J;AH|;@A,!a ~PK``a8~xH`K(``8|~x~xH`K``<A,="), AL,?@$>p,)@~hxH|yA48!xa|N ```A^h(: |=H@@(!p{&!xAa:}I*} ,*A}\Sx,)(A4 ;|=8@@{&}:|P*y,%@l;|=8@@t,&A {&|P*,&@H;|=8@@Py B}IH ;{&} P*,(@;B@({&} P*,(A|'@@})P*,)A>`>(bs>zs{$fs;jbs:::H;;,@A)6q)A\>h|:AsI@="))|:H@@="))|:H@AV>, A>BRV2|)A`2|0H@t8,)AIV>,99JIA`r~8~x,});xA8(UJ>( @ zPK?B?;Z;CxH`,@d?9\ }j(9)(|} P9)} Q@L,,)A =BJ| P@L,=")| H@L,|*H@A| 9 =BjCx*=9)=H`,@9@;0^p|}@9 }@L,,*AhAKx?>;:x~x89H`: |=H@Ax W>8c?H`=");, AT!A!8! aAa|} } } N `_p,*A(A( A\>, AH`,A >, @?ȁI, @t),)@H,AЁ>, A@A\xEx8xHxH,#@<>, K,``a8B$xH`@``88~óxH`K`` |@L,_ ,(AJ|*@Aȁ>, AH,@8H,@,K```=")iHK```xH`,A|9^h} P9 }Q@L,,)A?p,)@hxH,#A܁>, @XxH`,AD|9^p} P9 }Q@L,,)@ <, @K```-@?p,)A,K``H|cxP{H?p,)@xH|oyAA8` H`KI?,/A```/, @}{x,/@_JI9@?I?I,*A), @h8`H`?),)A`xH|ny@܁>, @_8`,/A>"1}sxH _:,/A,0@xO, @OUJ|'PA}{xH`_90JO_OyJ~ HP_,/@```|ppPH?),)@8`H`?),)@ |9^@} P9 }Q@L,,)@<p| H@L,,)@>| H@L,,)@h>| H@L,,)@P,<pH;apA|H````xExdxxH>H|)AK<H|=HAK=/@x| 9 *`*, K`8`H`_J,*A _p,*AL^ | P@L,|0P@At=}jN,*AJp,*Ap^ | P@L,|0P@Ax:>x~#xH`,|dx@=}jH9JH^ | P@L,|0P@Ah}.j~#xI9JIH`,|dxA| H@L,|*H@@<<AT^*,)@t 9 8`?; ^*^ȑ*^*^* ^*(H`="),)A\?;8xx8xH`8`H`8` H`88xxxH`8` H`>h),)AP=")| H@L,()A\8`H`H(A;88888`H=| H@L,()@8`H`px|8!N ``9@=9 H=B*=")iHK0`|9@9=}H,(@ }@I@L,?;@xxH`| 9 =B*K````<{ 8H`|xK`HK``<,)A p 9@II,$II|*}H2IA8`H`px8!|N `| `KK<,)@(K```||~x8`0!qH`,#~hA |x<`H`~h,?A,9 x9@#>hI~h8cH`h,(A ;,'Axp|;x@,yIB})H,```;{&}HH*,*@;B@8{&}HH*,*A|?8@@}(H*,)Ax```=")?(;, A9 >x>pH`,#~AH`,#~|}xA|9_h} P9)} Q@L,,)A|;p} 9)} @L,,)Ax8`8!|c|N |*9 ,&@;|?8@@K$99 9_0x>p|} P9)} Q@L,,)A|9_} P9)} Q@L,,)@<hiH`~hH`hx8`Kl>hiH`~hH`x8`K@H`h8`K(|?j!,?AH8`88Hh#(C |)P@@DCy)&}*H*,)A<= 0heap_words = %lu allocated_words = %lu allocated_words_direct = %lu allocated_words_suspended = %lu allocated_words_resumed = %lu alloc work-to-do = %ld dependent_words = %lu dependent work-to-do = %ld extra_heap_resources = %luu extra work-to-do = %ld work counter %lu falling behind alloc counter %lu by more than twice a total cycle's work %lu; catching up by %ld Updated major work: [%c] %lu heap_words, %lu allocated, %lu allocated (direct), %lu allocated (suspended), %lu allocated (resumed), %ld alloc_work, %ld dependent_work, %ld extra_work, %lu work counter %s, %lu alloc counter, %lu slice target, %ld slice budgetdomain == Caml_statecaml_atomic_counter_value(&ephe_cycle_info.num_domains_todo) == caml_atomic_counter_value(&ephe_cycle_info.num_domains_done)caml_atomic_counter_value(&num_domains_to_mark) == 0caml_atomic_counter_value(&num_domains_to_sweep) == 0caml_atomic_counter_value(&num_domains_to_ephe_sweep) == 0GC cycle %lu completed (heap cycled)Starting major GC cycle heap_words: %ld not_garbage_words %ld swept_words %ldPrevious cycle's space_overhead: %lfHeap verifiedGrowing mark stack to %luk bytes(large block %luk bytes) No room for growing mark stack. Compressing.. Mark stack size is %lu bytes (> major heap size of this domain %lu bytes / 32). Compressing... runtime/caml/addrmap.ht->entries[i].key != ADDRMAP_INVALID_KEYcaml_addrmap_iter_ok(t, i)Preserved %ld compressed entriesptr == chunk_and_offset_to_ptr(chunk, offset)Compressed %ld mark stack words into %ld mark stack entries and %ld compressed entriesstk->count < stk->sizeoffset <= Wosize_val(block) && offset >= Start_env_closinfo(Closinfo_val(block))Has_status_val(block, caml_global_heap_state.MARKED)!Is_young(block)Tag_val(block) != Infix_tagTag_val(block) < No_scan_tagTag_val(block) != Cont_tagv != Debug_free_majorcaml_marking_started()lockruntime/caml/camlatomic.hold+1 != 0old > 0caml_atomic_counter_value(&ephe_cycle_info.num_domains_done) <= caml_atomic_counter_value(&ephe_cycle_info.num_domains_todo)unlockTag_val(v) == Abstract_tagHas_status_val(v, status)Tag_val(e) == Abstract_tagcaml_gc_phase == Phase_sweep_and_mark_mainmyf->todo_head == NULLcaml_gc_phase == Phase_sweep_main || caml_gc_phase == Phase_sweep_and_mark_main!f->updated_first!f->updated_lastIs_block(cont)Is_block (cont)!Is_young(cont)Tag_val(cont) == Cont_tag!Has_status_hd(hd, caml_global_heap_state.GARBAGE)runtime/caml/mlvalues.hval & 1Continued from cursorDiscarded cursorMark Ephemeron: %s. Ephemeron cycle=%ld examined=%ld trivial_data=%ld marked=%ldcaml_gc_phase != Phase_sweep_mainephe_info->todo == 0ephe_info->must_sweep_ephe == 0ephe_info->live == 0pb->enqueued > pb->dequeuedblock != Debug_free_majorIs_markable(block)!Has_status_hd(hd, heap_state.GARBAGE)budget >= 0child != Debug_free_majorIs_block(v)Is_block (v)!Is_young(v)pb->enqueued < pb->dequeued + PREFETCH_BUFFER_SIZEpb_size(&pb) == 0!Has_status_hd(chd, caml_global_heap_state.GARBAGE)ephe_cycle <= caml_atomic_counter_value(&ephe_cycle_info.ephe_cycle)Caml_state->marking_donedomain_state->ephe_info->must_sweep_ephe == 0caml_gc_phase == Phase_sweep_ephecaml_gc_phase != Phase_sweep_epheMajor slice [%c%c%c]: %ld sweep, % ld mark (%lu blocks)domain->ephe_info->todo == (value) NULLMarking started, %ld entries on mark stackMajor slice interrupted, rescheduling major sliceFinished marking major heap. Marked %lu blocksShrinking mark stack to %luk bytes Mark stack shrinking failedCaml_state->sweeping_done == 0!caml_addrmap_iter_ok(&d->mark_stack->compressed_stack, d->mark_stack->compressed_stack_iter)d->mark_stack->count == 0@YC@?A.SMFEuiocaml_mark_roots_stwcaml_darken_contU@_ip <`int ,5 -*?kBCY j0z1 *H?P@XA *`B 'h A ' F 6F @F J@ "jmpA FBXCY TF N&z,22  "key#   * 5*N* $05 41A? "mem@ )"maxA )8CC"endCC"ptrCC C@(C@0  :01<D*EF FF,H!8kK:j%L% Q%"Q%%%& @%(Q %* *(%+ *0%, *8%- *@%/ *H%0 *P%1 *X%2 *`%3 *h%4 *p%6 *x%7 *%8 *%9 *%: */: ,%=(g L/b, , T 8 9  : *k,6 W0 5@ 5K 5O 5[ 5\ 5n Wp l * * * 01<^/5 5 PF##$ ,*! * * * Xk  9P # Mmend M9 n ;  do ER#OE|# *#OG Z.  .a @HBHW &a O OH'[ #T  ZHt1' ; ' #N> <Z O Z xq ;{ S  O Z(U   [ = J  =  O YG=O.O% % D *OD O Z IOY GO.IO{ .HO .r ; S F   (G  p d }= I A"%9 p d O)P p = Hc Au .  O.)  0 ,   .  @.8 * ;Qk! k ! L p d @ GS 'QC Oo o p  OQ O o. O  *=  Y= e  Q O2 ; d <  @O F$6S T U9S0T0U0 S T U FfS T U IS T U <Z O Bd + : J$c $H$6S T U9@ 5 /P\S T UP@ 6 P\S T UP@  P\S T UP @L  rP\S T UPS0S@<$L|2!i yS T UFP S$!S T U !S$!PS T U !S T U !S TU S TU 2$$#hW"W "k%WJWKWXW*W/W<3p \f"S #S T U #8S S T U o$ ooo#S T@#T@<$S P$!SF$8SF$kS T U $S T U S T U [ZO%&S T U R%z#O  *& &RSTU06 '8 BargF.O>Z$RW&-W*&KW/W<(W %WJWKWX3p&ST0UVP&SL)2' STUV0W'$SL'MST0UV'S T U 'S T U S T U 2v)v)x *(S x)x*)2(SST0U0V0W0)2(T0U0V1(S (S0S T U  Rq)2q7qv =v+w(Ox8Zy:z(O | } }~ * * * OOS* )*+]i+0yS T UF+HT~S+\f~1k O ,J,2STU0~S~ 0 1, 5-:8--tS S 9., <?..tS XS@; //P\S T UP </ </0*S T U <0]S T U 10S T U 30S T U 3S T U :P1 SD01"S19SD1]SD2Ke1S~TU (i%yS T UF48 0 104*   34%^ ?5I 3}%&24JR eZ3S3STU S T U ~4*a"6~D4{STUVSTU0 ,4) +*7=54=3pe3p'3p ,P5) +*7pW5?[&7O @6c C6>0F-7 7i 8yS T UF iL 8yS T UFJp& iL79yS T UF =U9Q=W9-W*9W/W<(W WJ WKWX: ST1U1P:!SK0:9S:PS7:S TWXYA=:ST0UV0:S;S~TU B;5ST0U0A?{;tS0;Se;S0;S0;S;S:P<SE0<S<1SE0sb=bD 6I ?J J$KOLZPOP ?6PO>iVOU>%Ac?SA??P?MSHu?eS?|SHSHt; O:) OA .@'!  1@!  4@!  5A\! ><8-A! ! : OD Bs!  B!  CA!  "C!  #D! ><&-Dh! ! 6 P $OZ 6O *~JOPJPP-P E+PP  FF   F -Q FQQ  G\  G  H>   H   I    I -PJo!P~QQQ -QhpJ)QiQvS JASS TUVJS JS@T cSK0%K}%K%L%Ld% }LS}LSPMS%MSM1S%PMHSGMqST0UVPMSIuMS_,MSMTMS;N S<N"S=N9S>NPS?NgS@N~SINSGqNSNS _>NSTU,OSOHS T U qO`SOS OS T U OS T U PS T U PKS T U P~S T U S T U )^ Q_ ` *?P l) l*?Q smZ n  n n+Pz QR#{#|*}Q- &  .& ) *2 @W O /Z* XkR  O + \WROR)*cRSS1 *S+6 )6 *$Si7 )7 * S:):*9STTS)S*UUkUk*U TW )W *UU# 31ST # )VU_)$)2S T0U0V2W0PUvSJSJ-US T U %uUSSPV S8V8ST0UVW0VOS8PVfS9VST0UVW0VS9VS S T U +0W1</W) Wg?WJ ) *& ) *RWv%8Y hd &  & ) *2\Q\\a[k k* [&hdX)*X )*Y*  ) *( Z stkY  )  *(  YSTU 3ZSTU 3&ZEST0UW0ZxS T U S T U JZeZJ [eZSTU (# 31ST[S T U [S T U \(S TU S TU 0\a1</\Q:gE fit b**`SofsOpMn `o!ooo.uo;;oC]+oH+oU(  ^K%&2J^yeZ-oc^od+oq  _ %&2  _]%+&2_STU _S T U o_STW_SS T U >}}}za:COa4(6STU9S TUOUb!oeCVa46STU9S TUV($H$6S T U9 cZ$6STU9 fMdctS S@ dmP\S T UP d e5e% fftS XSS T U (iyS T UF3pgEfTgS T U S T U :nBstk@4pbme #$ *vGnquMk;) hd3h I) I*(IhO ) O *$h_*)iGS T U 3i%%&2 J:ieZ 7j9%&2 Kj%+&2jS T U *jS T U *Wk SS T U :kewmg~  lkS~TUlS T UlAS T UlnS T~US T~UT ld t~lt* mmES~TU STU | ' m'wh m sn(ssst t6S8 nQHx 8nSTU nS T U S T U ) ostk2='o chd S?oc ) *&  )  * ) o stk   :sBstk8CiOend O ***pv  tpt*STU  q%%&2 %q?5I q%&24JR eZsrZssst t6S r%%&2rS T U s S T U s@S T U ssS T U sS T U S T U )tstk;2MendCM me't6p4Y6a |Bstka4newcd *e *f *tim*menueu *u1S T:%uITS ||8||!|~|||;|yQ}5vh$6STU9;} xs}}z7wjCOwB$6STU9S TUOU8xXoeCVx04 6S TU9S TUVST>l6 4(H4$6S T U9;}&z}'%}2}3(}BM}a}T+}n+}{}}} }z~}zD}}#zj}}zST 3%3$ 3%STU #:^ {J$c $H$6S T U9{S{S TUV|S TS T U [|pS TUS T U f), }Bstk,1 2 * 3 D * D* D6*?}& it4 & k7  v8 & iE*& meF'O}*ptr:M  *  *  * O  'M}9*H*'*}ptr5M' *~ptr .M6  0,  ~&)&* ~S TS T U :@:   *)**c1u:  gWLS T U 6" OO &2 1 $ .   **"*4* *r 4"4*; . ? S T U AH .?r)r*}s)s*pPu v)v*"v)v*S@T WX)*)* )*H)*-)-*)*)*@)*h.# rp%S@T UPS@T U{S@T US@T US@T US@T U'S@T URS@T UwS@T S@T US UVWXYZqqqq"SAT?SBT\SCTySDTSETSFSGSHSIS T U  62 res}y * * **) * *) *^ ) * ) *> 'x1'*x23*':a"b,c6'ca#b-'a#b-6Q xQ&O S T TfU 'myfU 'U% 'gXutS S %?5I %&24JR eZbMtS XSS T U S T U [F-^tS SfbMtS XS@w P\S T UP@{ 6P\S T UP]i S T U S(T(STS T U qRS T U SS T U 'J O? M M& N N '  ,21 f '@ P\S T UP2tS S5tS XSi9 yS T UFiA xyS T UFiE yS T UF %&T*U%1%>%%K!%LSTU0LS T U ,S T U .S T U /2g1  ]S T U  H3tS S( tS XSi <yS T UF^ST0U1S T U S T U S T U 7S T U S T U ) /O v 'e(  '. C v :EE!E1*GOvI I keyI fIIJ hdK L )iL)M NOO OO(Sk } ^ %&2f $%^ ?5C R %%&2$JR eZj <; ST~{$%^ ?5I %&2$JR eZ z2l%&2WgSTU0WgSTU0S T U ]3pQ0S UVWXcS T U MS T U Q)/ //*)# #9 6 JptS S%@ ]P\S T UPi yS T UF + tS XSPS T U S T U [@v'pb-Kv  @pb-v7@pb2@pb3}3pb>3 *Tpb63}ppb33<)O Q< Q"i Q0*Kv S &7 S 7 S A]Ov]#U%hdU.sU9QOJvQ&sQ0MOphdM(sM3zO@<*O)m4 )m;)(err4O'k13k3klocI!{(a UtaDSztS;iT< LtL9iM: @ t@@iAA 6Ot66i6J '1 val1!+@val8&7 )7 *M*i<M>)KoldO *C*<C>)KoldE *;*<;?)&7= )7= *@4<4;)n4L*&76)76*) @Fa @>F h B& BF B LWgLGWrWW+WWgWWWrWJp l%&2JeZ;WW;WW+W(@ gP\S T UP^o^W  %&2S T U S T U L=T=JpeL) )$|)2SST0U0V2W0L%&8%1%>%K!%L@}*I~1B41BH}4:!;9 IBH} : ; 9 I8 1RBUX YW  ( I 4: ;9 I 1RBX!YW   !I 1H}1 U U:!;9 IB : ; 9 I 8 : ; 9 I :!; 9!I!8 : ; 9 I : ; 9 : ;9 I: ;9 I4:!;9 IB.?: ; 9 '<.: ; 9 'I !$ >  4: ;9 I!41" : ; 9 I8 # : ;9 I8 $1RBUX Y W % 1U& '.: ;9 'I (1RBUX!YW ).: ;9 ' *4:!;9 I+41,4: ; 9 I?<- 1..?: ; 9 'I</&I0I1!I/ 2.?:!;9!'@z31RBUX YW 41RBX Y W 54:!; 9 I6.:!;9 '@z74: ; 9 I8>! !I: ; 9 9: ;9 I:.:!;9 'I@z; 1U<: ; 9 I=.?: ;9 '<>1RBX!YW ? @.: ; 9!' !AGIB:!;9 IBC1RBUX Y W D4: ;9 I?<E : ;9!F<G.?: ; 9 'I<H.?: ; 9 '<I1RBX!Y!W! J1RBX!YW K4: ; 9 IL.1@zM :!; 9 IN: ; 9 I O'P !:!;9 Q.?: ;9 'I<R.?:!;9!' !S :!;9 T : ; 9 U !!: ; 9!V :!; 9 I8W4G:!; 9 X>! !I:!;9 YZ.?:!;9!'I@z[.:!;9! ' !\4I4]1UX!YW ^H}_% `$ > a b : ; 9 c'd5Ie  : ; 9 f : ; 9 I 8gI h : ; 9 I 8 i!Ij(k4: ; 9 I?l : ; 9 m : ;9 I8 n4: ;9 Io4G: ;9 p.?: ;9 '<q.: ;9 '@|rH}s.?: ;9 'I t.: ;9 'I u 1v : ;9 w1X YW x1X YW y z.: ; 9 'I {.: ; 9 ' |H}}.?<n: ; T0Ys(s(#(ss#Ys(s(#(SnSn 0ooo ooooo  yy  yy  yy y Y 1  YYoo@<$@<$SSSjSjSjTTTTUoUoUoVnVn˱V˱nkkmkm ȰذYа а1йSкSкߺSߺSĺnĺкyкԻnԻyĺnĺкyкԻnԻySkؓSؓkSkãSãkSkSkSԦkԦSTĖjĖTjĥTĥjTjUlUlĥUĥlŲl̨UlVmVmVm˦V˦ԦmԦVĨmĨVmWeWeĥWĥe˦W˦e0"g"ȓgؓ0ggĥ0ĥg0Ԧg0Ĕkkĥ0k0Ĩk0k̭0̭kccĥcԦc`Ƞ```̭`Ǒ ã  ħmĨmȒԒSԒnS_S_ȝܝSܝ^^S_S^S_ȫ_̬_  $@M$.  $@M$.  $@M$.Ĩ  $@M$.  $@M$.đؑ110YSnȓṋn YSS011̭1S^^ȫ^̬^sS~~ȫ~̬~ĩ`ȫ`̭`ĩԩ ĩ ȫ ̭ ԩܩZ̬Z  ȫ̬  ̭ Z̪  SST  ̪ܪ ̪ ȫ̬ ̭ ܪZȫЫZ ST  ̭ y̭y ̬ ǬZ ̬ ǬYy_0_yȠ__ܜ0ܜ_yȠ00̢  Ģ̢YYНܝSܝ^``S^____W__xZWZYYДYДYԦ Ԧ Ĩ Y  Ĩ Y Ĩ Y Ĩ ̧YĨШY  Ƞ   ̭ `Ƞ```̭` Ĩ YYԚ Yğ Ym X 1KKSKOSKLTLOTKLULLoLMUMMoMMUMOoKLVLLnLMVMMnMMVMOnLL  $@L$)LMU $@L$)MM  $@L$)MMU $@L$)MO  $@L$)LL0LLSLLmMN0NOmLL1MM1MO1NN0NN y#3%NN y3%#OO0MN1OO  $ &MN OO MN OO MN1OO  $ &HH HHYHH HIYHI IIYII IIZIIYIIYJJ JJYJJ JJYJJ JJYJJ JKYJK KKZKKYKKYSoS$oT$TUnU$nVkV$kj$j  $@L$)U $@L$)!  $@L$)0Si0!i11!1n!no!oYn   nnn   nn  00n   nn1   110   000   00n   nnn   nn g  !g !l f !f z !Z #yz"5..@Yz5. y"5..@Yz5. (y"5..@Y5. !;"5..@Y5. "" ! "$ Y""Y "" ! "$ Z""Z "" ! "$ Y"#Y ## ! #$ Y##Y ## ! #$ Y#$Yn1n˲S˲SԶSԶиS˲T˲T׶T׶иT˲ s $@L$)˲S $@L$)Զ s $@L$)ԶиS $@L$)̲0̲Snܶ0Բ1ܶ1 ܶ 0ܶ00ܶ0 ܶ YܶYܶ ܶ1 2 ܷ Y0oطo ܷ ̵  ܷ ̵YYӷY̵  ܷ ̵  ܷ ̵ooطo̵ YYSY[j[[[[S[_j__S_`jZ[l[]l]]S]^l__l_`lZZnZ[n[[n[\n\\o]]n]^o__o_`oZZx]]xZ[n]]n[[n[[ ![\Y[[ [[n\\o ZZn]]n[[nZZ \] ZZ \] ZZl\]lȂSȂoSoSoS܉o܉SoSonnnjj܉j؋jjjm~}m܉m؋mmmmZlԋli؋ičiЍi܏i0m؋mm܏ml؋lЍl܏l؋Ѝ܏j؋jЍj܏ja؋aЍa܏aІddddЍddd̆Іj̆ІxІ܆dd܆dćȇxjxdd  $ &mmmmmmm؋m؋mm̋m̋̋mmmĎmmĎmĎmĎmm܉m܉m܉m  SS   ܌ y܌yԈ ܉ ܌  ܏ ԈZZԈ Ԉ܉ ܌  ܏ YY0 ܉ ܌ ܏ ܉0܌0܏0 ܏ SS ܏ ܉ ܌ ȉ܉ZόZtuSuvivvSvituTuvnvvSvnuu00@uv l_jvw l_jwwljwy l_jyy l_y} l_j}}_j} l_j l_ l_jzzmzzmkzzmaz{mk{}mk}}xk}}mk}}m}mkmmkekmkmzЁmkuubuvbcvbcuvfvfzzkz{a{{a}}awyeyzeeeeewxoyyoyyoyzozzooooyyoxxxYvwhЁhwwewweyyewwxyyxwwoyyowwcwwoyyeyyxyyoozz 0+({{o{}o}}o}o|}o}o|}h}h||h{{m||ouuhkЁkmЁmiЁiZh12S25c55S57c78S88S89c12T25i55T57i78T88T89i34h44m56m77m35j56j77j89j24e57e88e99e22025h57h88089h44o44o56o77o44n22T22tx22e22Z22i22i22x22Y22Z22Y55e89e55o89o55c89c55Y88T88tx88Y$$S$+l++S+,l,,S,/l//S/1l,,S//S$%0%%o%&o++0++o//011o$&n+,n,,n//n11n%&S&&m++S+,m,,m//m11S%%0%%1%%0%%1%&0&&1111%%Y%%y%%Y%%Y%&wp&&w&&Y+,o//o&+l++l,/l/1l&&0,,0,-e---.e01e11e''0''j''')j++j/00''0'(g()g))))g/00''0')i++i/00&&o,-o-...o01o11o&&o,,o..o00o&&h,,h..h00h,,o00o--k11k--y,-o01o,-h01h,-o01o,-h01h01o--o11o--h11h--o11o--h11h11o-.o-.h..o..h..o''0')k++k/00''oa((o((oa((a((oa()oa))xa))a++oa((o()o))x++o((h()h++h((b()b++b((1((0()1++1((S((m))S))m++S++m((o((o*+h//h00h11h** **0**o*+o//o00 11o*+h//h00h11h*+o11o*+h11h*+o11o4S4nSnSSnx YYZSnSnSnSSnzy+( YYZzy  @ zy+(SlSlSlSlSlTgTgTgUhUhUh d Y ddd bbb mmm +(+( y+(+( +(+(+(+(+(+(iiieee ccccccjjjfff>>>kkk SSSSkkknnnnn m mmm XX   m mmm == <.y<.<. <.y<.<.     Y     Xc U V Y  Y  [  Z  Y  P T T m b d X YgWXZXXZXXYXXWXXYXXZXXWXXZWXZXXZXXYXXWXXYXX XXWXX XXWXXZXXY==S=@n@BSBCnCDSDDnDESEEnEFSFFSFGnGGSGHn?BhCChCDhEFhGGhGHhFFyFFn@@i@BoCCoCDoEEoEFiGGoGHi@AnABnCCnCDnEEnGGnAAoAASCCoCCS=?nBCnGGn>?oBCoGGo=> GG =>SGGS=> GG >>  $ &>>o>>o>>x>>Y>>  $ &>>Y>? GG ??SGGS?? GG ?B CF GG GH ??YDDYDE DEY?? GG ??SGGS?? GG @@ GH @@SGHS@@ GH AB EE AByEEyBB EE BByEEyEFnFFyFFnEF0FFnFFyFF0OPSPRlRRSRRSRSlSSSSUlUUSUWlOQoQQSQRoRSoSUoUUSUWoOP UU PPyUUyPP WW PPSWWSPP WW QQ VW QQSVVSQQ VW QQ UU QQYUUYRR VV RRYVVYSS VV SSYVVYST0STknnSnnonoSopopsSssSssostSnonosnstnpppqottoppopprropp0ppopprr0pp tt ppSttSpp tt qq tt qqSttSqq tt qr st qrYssYefSfioiiikokkSkmommSmnoefTfjhjkTkmhmmTmnhefUfjgjkUkmgmmUmngff`fibijnklbgjmklmllmghSllXfj`kl`lm`mm`nn`ffifjiklillimminniggckkcgickkckkcklcllcllcgg2gg^gi~ii~kk^kk~kl2ll~ll2ejkkmkmnkgg1gg zy .gi1ii zy .kk1kk1kk zy .ll1ef0fjlklllm0mm0mn0ef0fijijjkljlm0mm0mn0ef0fifijfklfllllflm0mm0mn0kk0ll0ggbggxggckkcggbkkbggZkkZggbkkbggbkkbggxkkxggYkkYggZkkZggYkkYgg^kk^ghSkkSkkSggekkeghSkkSkkSiiZiixxiiYiiZiiYllsxllY9: << 99S<<S99 << ::0:: :; << <= :;0<<0<=0:: << ::y<<y:: << ::Z<<Z:; :; << <= ;;Y<<Y;; ;; << <= ;;Z<<Z;; <= ;;S<<S;; <= ``S`amaaSabmbbSbcmccScdmddSdem``T`aoabTbbobcTccoccTccoceT``U`cUccUceUaaUacUceUaaoabobbTbcocdoddSdeoaamabmbbSbcmcdmddSdemaanabnbbnbcnccndenaaoaaxaanbbnaanbbnabmbbScdmddSdembbxbbtxbbndd de ddyddybbobbxbcnиSYSYùSùйSSoSn,ip     """"""####!!%%%&++%%%%%%%&&+++,//1&&&&&&,.0111&&&&,,....00,,00,-0111,-------01,-01,,01--------11--------11&'''''')++''''()++''''((()))))))++((((((((((*+//0011*+11*+11+,,,//1122223444564455558988889:<<99<<::::::::<<::<<;;<=;;<==?BCGG=>GG=>GG>?GG??GG??DD????GG??GG@@GH@@GHABEEBBEEFFFFLLMMMMMNNOMNNNOOOONNOOOOOPUUPPWWPPWWQQVWQQVWQQUURRVVSSVVSSTTZ[[^_`ZZZZZZZ[[\\]]^_`ZZZZZZZZZZ\\]^_`\\\\]]]]\\^^^^``\\\\ZZZZ\]]]ZZ[\ZZ[[[[ZZZZ]][[[[ZZZZZZ\\]]ZZ\\aabbbbbccccddeaaaabbbbbccccddeaaaabbbcbbbbbbcccddebbbbbbbbbbdddeeemmfiiiklggggkkkkggggkkkkggkkggggkkkkggkkgggghiiiiiiiiiiipqrrttpprrppttppttqqqqttqqttqqqrstuuwwyyzЁwwwwwwЁwwyyxxxxxxyzxxxxxxyyxxxx{{{|}}}}}{{{{{{||||}}}}~{{||||||Ё܉ă܉܏̋ĎĎ܏ԅ؅Ѝ܏ԅ؅Ѝ܏܆܆܌܏܌܏܏܉܌ģУУВННР̢Р̢ԦШĩȫ̪̭̭ܫ̭ШܰаܰаܰԲܲȶijĸijij̵ййܹĿ̿R runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includemajor_gc.ccamlatomic.hdomain.haddrmap.hmlvalues.hshared_heap.hmajor_gc.hplatform.hweak.hmisc.hstddef.htypes.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdint-uintn.hstdint.hconfig.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfinalise.hfail.hsetjmp.hstruct___jmp_buf_tag.hstdatomic.hpthread.hruntime_events.hsetjmp.hroots.hgc_stats.haddress_class.hstartup_aux.hsignals.hcodefrag.hmemprof.hglobroots.h8 8=8!8!8/ 0[!-/g& f} %Jd*"*"<tf.X?oX?/?=<02* f~^}w ` ..<<}  .}J <&.#. ' y '. y ' v .J.~t kAA / p !$0&#z !!!  ) S 0!%%"#"!x !0# $ /!f7  7<&X.&.7 .  L:$#.'y t "r$#,    < J " "& !  $!0X J 'y / !  J X3! F3$ J)"HL0hhhhhhhz 0i~~ ~ . <vu*4ff~ +  .- 4fy !'y "JJfX-fm   ..Jkt .f.. . .< J  J Cy & f!7 KLKKKf=f=KLE.!XfJD  M    JX.to  Ju .o  o  1(/=>> Kr X X 0r .< /r .< /r .< 0i= <P   <@4"?" .LLLLLLM /#%! $ %s < ==X.< A<  /!;/0< * 0s< s< /=s< sJ s< s< s< s< . ' z< ==Ns @Y" <w 3?" .tcX< ==Nsf </8!#!*!"].."!!".yX%/%#%+0!0"0>><'%  #XJ6t Jur X X <vr X Jur X Jur X Jt{X-@-2-$-2 -! !- ,Bz &/   w< J < /  ). / ,"  / )  . /  )   .Xj x  " !/x.=21 ^< !J 6<! T  J'.# <(  / . !! !$WX"2 &  /Iu  w +t. 'w   +!o o)"/.V #&Z & Z # & (y .tz!1x]  0!XK& =!& ?n,<  !+X<f< 0< p. H" "NL ! ! u ! . J w   /xg!<gh h  x`h g.=/ x  /!Y/& ?n <x./x&  /< f<-d.X ^.w..wxg:<t  t r<1f+xt  xt ,"*: w<+    /XY==@$<"  1f KT  -      < 3 R '0 !L 1   2  O  ! !  /.<  p tu  X0  v  ... \t x   "+x   J y  'j  .   <j  ._.0.x~#+?1!pt.f~~<g ~g/~u/~ X X1!=T.~.p~t vt t  .<.%=%/%/%/ / bpt.t h  /=|+    / 3t!=T.. oX<.~<~p..Jg>f!0~!/T.. 5 .ZA  0  3 ! %?@! Z./ !3={.Y/"={u/~<M! Z.. (.tvJ u= ! m<].<< < u   u   . < t<u   u   X > $ !v !  @/v   @v.   ht   t.  .ow}3 J! w u   Xv.  @/v   @<v.<@  v .  u<:.g@t v A A>A0X. XZJt /+u    2t  t. <..pJ@  1t  t. t  .#  !2 2  Jp   !+u   t . t  Jz    . v  v*t<Y/ "ft f.t %A%A%A% /}K&  3 !.K  .!=+~   !$} s +   !. } ... <K } K . < #!. Z !!!+<E<+=?!w  =   y    . =} s +  <. } ..<   " . 4  .&   /.XJ . $)*!) "<. << }J ..J! -.!% !. J  A#} s +  . } . .. +.~  2 /   =!I   :i3 !.<<! %%sf   N*!}. <!-=/"!D X I?">  .A==<af.dX=   3(pX.ff!!=X( !U/T..</ |  .!|g.dcJ(q.!f|t  .<.<<=<=<- 5<y Y<-=<Y.0<!w =.  . / 2.J".!"/!>3'3 K3- 0r->  !t -   Jt.y'-y !- ./%# !>} s +    2=-"- !% !.-t ! - X s   3'3  C=$  =pu<(  =- 0>> >B- 0< ! #.ByB!  <>$  = # s.f1   ) 3' '  $  Kpu. (J> ~ #p .p. YX1 0 $DP'q<'K%DP'q<'K/~  <. ~f ~ (>_f)>%^X   Jq. X'q.  <@ v. <</ << . "   gVJ Fpt .  zXJ~ |.) ,<t .  >$  @  ?r~ J0 . Z~ J1rJ p  f~~ J4!=V.* T    J}t  r...~ " !~g/} J J.tu t"t . <<}t tf Dx 6x Dx R$ #Q zJhnL./$<=.$e@=t zJ.) ,. z. Lnfv   J J z!-! <wJ  ../! .0.  q <J0 u =!  'u.!  ! & !  ! # ! #  0 .Ju>=v>'[  <X/=s /  f{ Jv}  1+#Kv X . aJtuX#u X''!q.'</'f"tX@=-/X! NJ!.!<m Af.xJ J%t5/!<. <tX !-/ /  !  /Cy5 x.  !   <K;!x..!Yn !.!ng. f.Ot.=Y . .=.//!#/;" A/! !K+n ]  0!Xg& =!& ?n,< J.(#  ./$/!%/!!(nu/nu. =Jn.&  /<!n  !!ng/nu<sJ t t i t J t =! ==!! U. .! == ^.3/! y&#-X#=#;/ 2Km.:.<vJ= ===!!m.X u ==!!ottEV_C_MAJOR_SLICE_BUDGETcall_timing_hookcaml_memprof_scan_rootsmajor_wordssweep_workchunkc_stack_linksize_tallocated_words_resumedmark_stackEV_STW_HANDLERstartpercent_freecaml_verb_gccaml_collect_heap_stats_sample__kindchildEV_C_FORCE_MINOR_ALLOC_SMALLtotal_wordsmemory_order_acquireEV_DOMAIN_RESIZE_HEAP_RESERVATIONcaml_opportunistic_major_work_availabledependent_sizeephemeron_againpb_popcaml_major_collection_sliceWAITINGalloc_workglobal_heap_statecaml_plat_spin_stepcaml__alone_1745num_domains_to_sweepbacktrace_slotmy_alloc_suspended_countephe_infocaml_opportunistic_major_collection_sliceEV_FINALISE_UPDATE_LAST__pthread_list_tEV_MAJOR_EPHE_MARKmemprofscan_endev_runtime_counterfinish_major_cycle_paramscaml_cycle_heapEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLE__func__handle_exncaml_alloc_ephe_infototal_cycle_workpthread_mutex_unlock__next__datahowmuchlocal_heap_bsize__prevstatecaml_sweepEV_MINOR_GLOBAL_ROOTScaml_do_rootscaml_ephe_await_keycaml_init_major_gcshared_heappb_above_waterlinecaml_heap_stateEV_EXPLICIT_GC_FULL_MAJORscanning_action__pthread_internal_listmax_spinsblock__ownerrequested_major_slicecaml_ref_tableUNMARKEDHas_status_hdcaml__b_1872ptr_to_chunk_offsetcontdom_stcaml_atomic_counter_initdarken_scanning_flagsephebarrier_participantsslice_targetcaml_orphan_ephemeronsEV_C_MAJOR_DEPENDENT_WORKalive_datacaml_finish_markingheader_tbarrier_statusminor_wordscaml_minor_heaps_endnew_stk_countcaml_custom_tablecaml_gc_mark_phase_requestedEV_C_MAJOR_HEAP_LARGE_BLOCKScaml_ephe_infostat_promoted_wordscaml_marking_startedold_compressed_entriescaml_addrmap_iter_valueleftprepare_for_ephe_markingcaml_gc_phase_charlong intlocal_rootsprefetch_buffercollection_slice_mode_chartrap_barrier_offblocks_markedlimitcaml_empty_minor_heaps_oncestat_forced_major_collectionsEV_C_MINOR_PROMOTED_WORDSuintnatwork_donetodo_headmark_slice_darken__builtin_memsetvalue_ptrEV_EXPLICIT_GC_MINOREV_EXPLICIT_GC_MAJOR_SLICEcaml_code_fragment_cleanup_from_stw_single__saved_maskcompressed_stack_iterEV_C_REQUEST_MAJOR_ALLOC_SHRinit_percent_freework_statuscaml_global_barrier_release_as_finalcaml_plat_mutexmark_entrycaml_intern_stateWith_status_hdstat_blocks_markednot_garbage_wordsephe_sweepdomainEV_MINOR_EPHE_CLEANcaml_scan_stackalloc_ratioPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_sdataEV_MAJOR_GC_STWcaml__1000_1621caml_cycle_heap_from_stw_single__nuserscompare_unorderedev_runtime_phaseEV_C_MAJOR_SLICE_TARGETnum_domains_to_ephe_sweepEV_EXPLICIT_GC_SETcaml_minor_tablesntablesMARKING__atomic_store_tmpcaml_plat_lock_blockingsigned charmark_againfor_cyclefinaltrap_sp_offNOT_MARKABLEactioncaml__continue_1872__pthread_mutex_snum_domains_to_markstw_try_complete_gc_phaseheap_wordsinit_custom_major_ratiounsigned charinit_minor_heap_wsz__spins__int128 unsignedbacktrace_last_exnrecord_ephe_marking_donemy_dependent_countcaml_custom_elt__atomic_load_ptrcaml_statefinal_infoEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLEtrivial_datacaml_verify_heap_from_stwPhase_mark_finalcommit_major_slice_work_BoolEV_C_MAJOR_WORK_COUNTERatomic_intnatcaml_lockdepthtablevaluehandle_valuealloc_statscaml_gc_policymarkedcharprev_linkpcaml_ephe_ref_tablecaml_paramscaml_plat_spin_back_offcaml__1000_1479caml_stat_alloc_noexccatchupcaml_mark_roots_stwcaml_darken_contextra_paramsenqueuedempty_mark_stackmemory_order_acq_relmajor_work_done_between_slicesdiffmodscan_lenlast_cyclecaml_incoming_interrupts_queuedPhase_sweep_and_mark_mainextern_state__jmp_buf_tagexpected_statusyoung_startcaml_request_major_sliceinit_custom_minor_max_bszpool_max_wordsEV_C_FORCE_MINOR_MEMPROFcaml__alone_1872tempcaml__loc_1621filepb_fullEV_STW_API_BARRIERcaml_final_merge_finalisablesweeping_doneinit_custom_minor_ratiogc_statsupdated_lastamaptablescaml_addrmap_iter_okreserveEV_MAJOR_FINISH_MARKINGcaml_alloc_final_infobuffercaml_final_update_firstcaml_addrmap_insertEV_EMPTY_MINORvolatile_load_uninstrumentedsaved_ephe_cycletrace_levelcaml_exception_contextunusedcaml_global_heap_statePTHREAD_MUTEX_ERRORCHECK__lockephe_cycle_info_tEV_MINOR_FINALIZEDcycle_major_heap_from_stw_singlelarge_max_wordsEV_COMPACT_RELEASEEV_MAJOR_FINISH_CYCLEEV_MINOR_CLEARenv_offsetfunctionlive_wordscaml_major_cycles_completedallocEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKSdependent_workoo_next_id_localminor_heap_wszstw_cycle_all_domains__uint64_tHas_status_valcycle_callback_paramsEV_STW_LEADERlong unsigned intcaml_ephe_lockedcaml_major_slice_begin_hookcaml_addrmap_initdependent_ratiomy_alloc_direct_countstatusforced_major_collectionsrequest_mark_phasetargetdependent_allocatedis_complete_phase_sweep_and_mark_maincheck_errslice_budgetpthread_mutex_lockpb_pushexn_bucketlinecollection_slice_modeheap_sweep_wordscurrent_alloc_countmade_livelongjmp_bufferaddrmapcaml_percent_freeSlice_uninterruptiblepending__mask_was_saveduintptr_tyoung__sizecaml_addrmap_clearcaml_timing_hookSCANNING_ONLY_RECENT_FRAMEScaml_gc_logyoung_endcaml_scan_global_rootsEV_EXPLICIT_GC_COMPACTheap_statemarkcaml__b_1561target_bsizeexternal_raiseheap_statsargsEV_INTERRUPT_REMOTEc_stacksigjmp_bufEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEspinsEV_MAJOR_SWEEPcaml_atomic_counter_valuecds_fileno_orphaned_workEV_C_MINOR_PROMOTEDEV_MAJOR_MEMPROF_ROOTSephe_cyclegc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donelarge_wordscaml_ephe_nonecaml_atomic_counter_incrcountertrap_barrier_blockSlice_interruptibledo_some_markingsection_table_sizeis_complete_phase_mark_finalGARBAGEEV_EXPLICIT_GC_MAJORextra_heap_resourcesmemory_order_consumecaml_ev_endmemory_order_seq_cststack_handlercaml_ev_begindoublestackcaml_minor_heaps_startinit_max_stack_wszchunk_maskmark_stack_bsizefinalisablehandlergc_phase_tlog_eventsupdate_major_slice_workparentcaml_extern_statecaml_compute_gc_statsmemory_order_releaseprefetch_buffer_tfloatpool_live_wordsbacktrace_enabledcountswept_wordsthresholdcaml_ephe_cleanbudgetcaml_memprof_after_major_gcEV_MINORcaml_try_run_on_all_domainsEV_C_MAJOR_HEAP_POOL_LIVE_WORDSorph_ephe_list_livemy_alloc_resumed_countunsigned intcaml__roots_blockadd_addrSCANNING_ONLY_YOUNG_VALUESEV_MINOR_FINALIZERS_OLDIFYcaml_stat_resize_noexcpthread_mutex_tintptr_tEphe_keywaterlinecaml_atomic_counter_decrPtr_valgc_regs_bucketspb_sizecaml_major_slice_end_hookforce_compactionrequested_external_interruptcaml__continue_1561flagEV_C_MAJOR_HEAP_LARGE_WORDS__atomic_compare_exchange_tmpcaml_addrmap_insert_posPhase_sweep_ephecurrent_ramp_up_allocated_words_diffatomic_valuepb_drain_modecleanup_on_exitglobal_roots_statusMARKEDoffsetfirstmust_sweep_ephecaml_ev_counterEV_EXPLICIT_GC_STAT__jmpbufEV_C_MINOR_ALLOCATEDagainexe_namecaml__spins_1479orph_structscaml_global_barrierEV_C_MAJOR_ALLOCATED_WORK__count__jmp_buf__atomic_store_ptrnitemsEV_C_REQUEST_MINOR_REALLOC_REF_TABLEignoredmax3allocated_wordsnew_workcaml__alone_1561new_entrynextproc_self_exeyoung_limitorphaned_locklong doublePhase_sweep_mainephe_lockEV_MAJOR_SLICEworknum_domains_todowords_doneEV_MAJOR_MARK_ROOTScaml_reset_major_pacingruntime_events_log_wsizecaml_darkenruntime_warningsnum_domains_to_final_update_firstunique_idEV_MINOR_MEMPROF_ROOTSstw_finish_major_cycletodo_tail__atomic_compare_exchange_ptrallocated_words_directaction_pendingbacktrace_posPTHREAD_MUTEX_RECURSIVE_NPitemsizebacktrace_bufferlong long unsigned intcustomparamscaml_handle_incoming_interruptsmemory_order_relaxed__listparticipatingcpu_relaxEV_C_MAJOR_ALLOCATED_WORDSlocal_statscaml_stat_blocklivepool_wordsupdated_firstpool_frag_wordshandle_effectaddrmap_entrymax_domainscaml_orphan_finaliserscaml_addrmap_iter_keyEV_C_MAJOR_HEAP_POOL_FRAG_WORDSallocated_words_suspendedEV_COMPACT_FORWARDephe_refinside_stw_handlerephe_cycle_infomay_access_gc_phasecaml_finish_sweepingshrink_mark_stackcaml_final_update_lastpb_fill_modeEV_MINOR_LOCAL_ROOTS_PROMOTEparticipant_countmark_stack_push_rangedomain_statenum_domains_orphaning_finalisersmemsetshrunk_stackheap_sizeparticipating_countprefetch_blockEV_C_MAJOR_HEAP_POOL_WORDScaml_failed_assertEV_MAJORchar_osis_complete_phase_sweep_epheamap_pos__int128EV_MINOR_REMEMBERED_SET_PROMOTE__alignpromoted_wordsmajor_collection_sliceEV_MAJOR_MARKnum_participatingbacktrace_activeephe_todo_list_emptiedcaml_empty_minor_heap_no_major_slice_from_stwstat_major_wordsmemprof_young_triggerEV_COMPACTptr_to_chunkephe_markblocks_marked_beforeEV_MAJOR_FINISH_SWEEPINGEV_MINOR_REMEMBERED_SETrequested_minor_gcyoung_triggergc_policysection_tablecaml_finish_major_cyclePTHREAD_MUTEX_ERRORCHECK_NPaddrmap_iteratortodomy_alloc_countorph_ephe_list_verify_statusextra_workmark_workcaml_collect_gc_stats_sample_stwcaml__b_1745ephe_list_livePTHREAD_MUTEX_NORMALcaml_plat_unlockcaml_gc_messageephe_list_tailPTHREAD_MUTEX_ADAPTIVE_NP__atomic_load_tmpcurrent_stackatomic_uintnatEV_C_MAJOR_EXTRA_WORKshort intEV_MAJOR_EPHE_SWEEPuint64_tmoderequested_global_major_slicenum_domains_in_stwephe_next_cyclecaml_global_barrier_and_check_finalpool_live_blocksEV_MAJOR_GC_CYCLE_DOMAINSforce_alivekeepis_unmarkedcache_bucketruntime/major_gc.cscanning_action_flagstodopverify_heap__elisionEV_MINOR_MEMPROF_CLEANextra_params_areatag_tmark_stack_push_blockEV_C_REQUEST_MAJOR_ADJUST_GC_SPEEDPTHREAD_MUTEX_DEFAULTcaml__spins_1621__valexn_handlermark_stack_large_bsizesaved_major_cyclesaved_major_cycleslive_tailSlice_opportunisticcaml_addrmap_iteratorlarge_blocksmark_stack_pruneephe_completed_marking__int64_tcaml_plat_srclocextra_heap_resources_minoradopt_orphaned_workrealloc_mark_stackwork_counterchunk_and_offset_to_ptrcaml_enter_global_barrieryoung_ptrdequeuedcaml__loc_1479EV_MAJOR_MEMPROF_CLEANmstkasize_tcompressed_entriesdls_rootmlsize_tstack_infoinit_stack_bsizecyclestat_minor_wordsnum_domains_donelockedcaml_mark_stack_is_emptycaml_addrmap_nextcaml_major_slice_epochEV_COMPACT_EVACUATEEV_DOMAIN_CONDITION_WAITcaml_stat_freebitsetmin2EV_MINOR_LOCAL_ROOTScaml__continue_1745num_domains_to_final_update_lastshort unsigned intmagicfinal_todoexception_ptrbasemajor_refEV_C_MINOR_ALLOCATED_WORDSmy_extra_countentriescaml_heap_sizecaml_domain_is_terminatingintern_stateEV_MAJOR_GC_PHASE_CHANGEHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatrunning_finalisation_functionnew_compressed_stackblock_wszevent_tracecaml_teardown_major_gcget_major_slice_workEV_MINOR_FINALIZERS_ADMINcaml_domain_statestack_cachemax2EV_C_MAJOR_HEAP_WORDScaml_plat_fatal_errorcompressed_stackminor_tablesalloc_countercaml_ephe_ref_elt__sigset_tEV_MAJOR_MARK_OPPORTUNISTICcaml_gc_phaseEV_C_MAJOR_ALLOC_COUNTEREV_MINOR_LEAVE_BARRIERprevcaml_compact_heapcursorEV_FINALISE_UPDATE_FIRSTPTHREAD_MUTEX_RECURSIVEEV_C_FORCE_MINOR_MAKE_VECTlastmajor_slice_epochspace_overheadGCC: (Debian 13.2.0-18) 13.2.0zRxA 8 C AGA~] EAD B FAD \T@BDU CB A DC E AAA~FADA~BEAAA AFA~EAC A C VA~ U]MAHA A~TTPC ADDIA~F KAAFA ~ A U CE \C AHA~r AAAA[ A C A CAAAAAAAlAAAAAFAB A~HSGAB A~XB ABAACI wC A K A~iC B A^AAANPAD A~Hh BAAAC MAC (,IA~| EAB XxC AIA~MkAcPK AAAGAC XHAGADA~tINCACCAB@D AHFA~U FAAFD J FAAFC XBBE AAAEA~}AAAG BD gCBA~ACBBS AAAB HAAAJ AAAA XAA AFA~DAB AFA~DAAA~C ABAB CABA d F A L A~y MABB uAZA`AAPxLCCUAMAABCN AADD M AFA~DAAA AFA~DAAA AACB Q AFA~DAH A M A~FTACA C AAA bAAAAAAAOQAAFB A~Fu@D AEA~c DAD DAlA^HhG A D CCDA~G F] NAEFD mAUBBACADtCA^AmD0C ADDA~R GAD AAFABAA A A A A A~}AA aT aH AA P A AAAAAAAAAAAA eC ABA A A A A AAB CABA A A A A AA H A CK A~FJBAAAA A AA AAAAAAAAALACFB U AAAAA A AAA OBAAAA A AAAAMACFA A~F[I 4 C AHDA~n HAC D @ACC ABAAAA~tAAAAAACA~ XT l , GA~T DAA ^EA0 C ACEDA~PGA, BH DB A AFA~EBADX BBI BA A AABCA~Z AACAB TAA AFA~EAAA~D pBBI BA A ACA~c CAB \AA AFA~E AA L B ADA~FKUABDAAA~]ABHABE4 C AEA~k EAD X EAC Agnu  $@90QHg`zxx/h94  I T _ j (u08@Php3x(=(KXy    *7CQmy5U)=Ti&B Z8kPLw '2Me|@T( /F@b{Xp  $ : L a x`  H major_gc.ccommit_major_slice_workget_major_slice_workupdate_major_slice_workstw_cycle_all_domainsrealloc_mark_stackmark_stack_push_blockephe_todo_list_emptiedadopt_orphaned_workis_complete_phase_mark_finalis_complete_phase_sweep_and_mark_mainstw_try_complete_gc_phasestw_finish_major_cycleephe_markdo_some_markingCSWTCH.310CSWTCH.325__func__.1__func__.4work_counteralloc_counterephe_cycle_infonum_domains_to_marknum_domains_to_sweepnum_domains_to_ephe_sweeplast_cycle.0num_domains_to_final_update_firstnum_domains_to_final_update_lastephe_lockorphaned_lockorph_structsnum_domains_orphaning_finalisersglobal_roots_status.3caml__loc_1479.5caml__loc_1621.2caml_statecaml_gc_logcaml_failed_assertcaml_incoming_interrupts_queuedcaml_heap_sizecaml_gc_messagecaml_ev_countercaml_verb_gccaml_paramscaml_ev_begincaml_memprof_after_major_gccaml_ev_endcaml_empty_minor_heap_no_major_slice_from_stwcaml_global_barrier_and_check_finalcaml_cycle_heapcaml_collect_gc_stats_sample_stwcaml_collect_heap_stats_samplecaml_enter_global_barriercaml_cycle_heap_from_stw_singlecaml_code_fragment_cleanup_from_stw_singlecaml_verify_heap_from_stwcaml_compact_heapcaml_global_barrier_release_as_finalcaml_compute_gc_statscaml_addrmap_clearcaml_addrmap_insert_poscaml_stat_resize_noexccaml_addrmap_insertcaml_global_heap_statecaml_minor_heaps_endcaml_minor_heaps_startpthread_mutex_lockcaml_lockdepthpthread_mutex_unlockcaml_plat_fatal_errorcaml_stat_freecaml_final_merge_finalisablecaml_orphan_finaliserscaml_alloc_final_infocaml_try_run_on_all_domainscaml_reset_major_pacingcaml_darken_contcaml_darkencaml_scan_stackcaml_plat_spin_back_offcaml_ephe_lockedcaml_ephe_nonecaml_ephe_await_keycaml_orphan_ephemeronsmemsetcaml_major_slice_begin_hookcaml_major_slice_end_hookcaml_sweepcaml_domain_is_terminatingcaml_final_update_firstcaml_final_update_lastcaml_ephe_cleancaml_mark_roots_stwcaml_do_rootscaml_memprof_scan_rootscaml_scan_global_rootscaml_opportunistic_major_work_availablecaml_opportunistic_major_collection_slicecaml_major_slice_epochcaml_major_collection_slicecaml_request_major_slicecaml_finish_major_cyclecaml_mark_stack_is_emptycaml_finish_markingcaml_empty_minor_heaps_oncecaml_handle_incoming_interruptscaml_finish_sweepingcaml_init_major_gccaml_stat_alloc_noexccaml_addrmap_initcaml_alloc_ephe_infocaml_teardown_major_gccaml_gc_mark_phase_requestedcaml_gc_phasecaml_major_cycles_completedcaml_percent_free9Z9X9C620>00@: N2R0~2@2200; *9Z:9X<9C^2b@< &2*22060<; z9Z9X9C204= F2J@2020R2V2 Z0b0 2"08> B2N0P> Z2f0h> r2~0> 20> 2000> 2H0H> 2`0`> 2(0(202 > *2608> F02@2@2@20*220>2B@V@j2n@2h0h2`0`2@2000: 2 @ h? x? ? ? ? 2 @ ? 2 @ ? ? ? *@ >2 B@ R2 b0 d> 2 2 0 0 ; "2 &2x .0 20x 4; n9Z 9X 9C B C D B 2 @ 2( @( 20 @0 228 6@8 N2@ R@@ |E B F 2 @ G 9C H I ? ? ,? <? L? \? J D D K 2H 2 0 @H: @H20"@H$> . 22 @N28R@8Z20^@0b2f0n2`r@`z2~@2 @ 2(@(2@@@2h@h2p@pL  2 @M 2000: G ,9C0N <H R2V2^0b0d; O M 2000: J P 20: 2P@P*2P2@P62X>@XR2XV@XZ2^2b0f0: 2200; 22@00@; 2@"2(&@(B2F2XN0R0XT; ^20b@02200; 28@82200; 2@@@22H00H; >9ZJ9XP9Ct= 62B0D: tQ 2200pR 20: ; 2@0@: S z2~02X0X; 2X0X; T :2>2(F0J0(L; r2xz0x|: 20: 2200; 22(00( ; .222(60:0(H; |; 22(00(; 2(0(; J 2N @f 2j @z 2 ~ @ 22H00HF 2 J @ ; 220"0$; :2>2F0J0L; b2f2n0r0t; 22(00(; J2N2@V0Z0@`; t `2200; 202x20x0X YZYXYC2(&@(n2(r@(2@YCZ 22`00`; 2200; "2&2.0204; B2F2N0R0T; f2xj0xl[ z2 8~0 8[ 9Z9X9C2200X YZ YX YC"2&@hYC|Z 2@X YC2@@2 @ @ ,Z \ !B2!F2 `!N0!R0 `!T; !b2!f2 @!n0!r0 @!t; !] !\ !] ""2"&2 ".0"20 "4; "B2"F@"2"2"0"0"; "2"2"0"0"; #B2#F2 #N0#R0 #T; #b2#f2#n0#r0#t; #2#2 #0#0 #; #2x#0x#[ #2 8#0 8#[ #2x#0x#[ #2 8$0 8$[ $"2$&0$B2h$F@h$^20$b@0$z2$~@$2($@($2$@$2$@$2$0%28%@8%.20%2@0%J2%N@%f2%j@%z2(%~@(%2%@%2%@&B & F &0 &B2&F0&LO &XD & &2&0&D & &2&0'2@' @@'p '2'0'2@'@@'2'2'0'0(2(0(@X (RYZ(VYX(XYC(n2(r@(@(Z (_ )V2h)Z0h)2p)0p)2H)@H)2)0*` **2*.0*R2*V2 *^0*b0 *d; *2*2*0*0*; *2*2*0*0*; *2*2 8*0*0 8*; *2*2 P*0+0 P+; +2+2+"0+&0+,; +F2+J2+R0+V0+\; +v2 8+0 8+[ +2x+0x+[ +2+2+0+0, 2, @, 2 , @ -9Z-2- 2- @-9X-2 -c2-,2-(9C-.0-20 -:c0->,0.Hd .te .; .2 .2 .0 .0 .; .9Z.9X/9C/ ; /B2/F2/R0/V0/X; /n2/r2 /z0/~0 /; /2/2 /0/0 /; /2/2 h/0/0 h/; /2 x/0 x/; /20200000; 0z 20~ @0 2 0 @ 02000 20 @1P x1r 21v @1212`1010`1; 1212H1010H1; 2b 2202002V22Z22b02f02l; 29Z29X29C22203b 23f @3j 203n @03 2(3 @(52 (50 (52 @5.0 @50: 5h 5c 64c 6>26B2 @6J06N0 @6P; 62 60 626260606; 62606262`6060`6; 72 (70 (7627:07 h7 8>28B08HX 8ZYZ8^YX8`YC8v28z@8@8Z 82@80@9292 9090 9 ; 9B29F2 9N09R0 9T; 9b29f2 9n09r0 9t; 9292 9090 9; 9292 9090 9; 9292 9090 9; 929290909; :2x: 0x: [ :2 8:0 8: [ :j : 2: @:9Z:9X:9C;2;2 P;0;0 P;;  @> 2 > @ >J 2 >N @ >h; >; >; ?2?2H?0?0H?; ?"2?&2 ?.0?20 ?4; ?B2?F2 ?N0?V0 ?\; ?j2 ?r0 ?t; @(b @B2@F2 (@N0@R0 (@T; @b2@f2@n0@r0@t; @2@2 h@0@0 h@; @2@2 @0@0 @; @ `A9ZA9XA 9CA:2A>0Ad B2B2 B9CB0B0 C& 2C* @C: 2 C> @ C^ 2Cb @C2xC2C0xC0CX DYZDYXDYCDB2(DF@(DV2DZ@Dz2(D|YCD@(DZ D2D2(D0D0(D; E2XE0XE; E>2XEJ0XEL; Eb2Ef2En0Er0Et; E~2E0E2E2`E0E0`E; E; E; F62F:2FB0FF0FH; F^2Fb2Fj0Fn0Fp; F~2F2F0F0F; F2F2 @F0F0 @F; F xGb G2G2G&0G*0G,; GF2GJ2(GR0GV0(GX; Gj2xGv0xG[ G2 8G0 8G[ H; H.9ZH>9XHL9CH 0HB H 28H @8I2I&0ID IXm Ih I2I2I0I0I; ID I2I0I2I0I28I2J08J2J 2J2 @J2 J0 J&0J*0J20J60 @JF 2@JJ @@Jz2J~0J< J2J0J2`J0`J2J: J2J0J0Kn K K L L,; LL` L L L 2L @L Lo M( MDp Mz2M~2M0M0M; M M M N N$D NB N N 2N @OHq O OD O2O2O0O0O; P; P<; PT PdB P P hP PD P P2P2P0P0P; QdD Qz2Q~0Q 2Q @Q 0Q2Q0R  0R22R60R R2`R0`R: RB SB S22S62S>0SB0SD; SV2@SZ@@S HT2T 2 T0T0 T; T&2T*2T20T60T8; TF2HTN0HT\` Tv2`Tz@`TD T9ZT9XT9CU X U6YZU:YXU<YCUdYCUxZ U2 8U0 8U[ U2U2U0U0U; U U9CV.2V22V:0V>0V@; VN2VR2 xVZ0V^0 xV`; Vn2Vr2 Vz0V~0 V; V2V2V0V0V; V2xV0xV[ V2V0V2V2V0V0V; V2V2V0V0W; W.9ZW:9XWH9CWz2W~0WE W2W0W2WB W2HW@HW0W XD XB2`XF@`XZ2`Xf@`XpE Xz2X~0X2X2`X0X0`X; X2X2X0X0X; X2X2@X0X0@X; Y2Y0YDF YZ2Yb0Yf2Yj@Yn 2Yr @Yx YO Y9ZY9XY9CY2Y0YB Y2Y@Z c2Zc0Z$s Z0D Z<B ZXt ZdD Zr2Zv0Z|: Z2Z@ZB Z [D [62[>0[B2[F@[J 2[N @[T [c2[c0[u [2[@[,2[,0[e [ [2[2[0\0\; \"2\&2\.0\20\4; \b2\f0\ \ 2H\ @H] ]9Z]"9X]$9C]\ ]`< ]r9Z]v2]z9X]~0]9C]: ]z ]2]2]0]0]; ]2^ 2^0^2H^@H^"0^T` ^9Z^9X^9C^2^2^0^0^; _J9Z_R9X_T9C_9C_B _2_0_2_0_~ ` ` `2`"2`*0`.0`0; `f2X`n0X`t: `S `9C`D a.2(a09Ca60(a8: aN2aR2aZ0a^0a`; av2az2a0a0a; a2a0a: a2a2a0a0a; a2a2 a0a0 a; b9Zb"9Xb$9CbX9Cb`B bm b b2b2b0b0b; bD c9Cc"28c&08cN2cR2cZ0c^0c`; cv2cz2c0c0c; c2c2c0c0c; c2c2c0c9Cc0c; c2d0d; dH dh d eB2eF0eJ2eR0eh_ e| fz2f~2f0f0f; f2f2f0f0f; f2f2f0f0f; f2f2(f0g0(g; g"2g&2g.0g20g4; gD\ gT\ g`\ g\ g\ g\ g9Zg9Xg9Ch 0h62h:2h>0hF0hH; hdQ h\ h\ h2h2(h0h0(h; h2h2 h0h0 h; i\ i\ iB2iF2iN0iR0iT; &3& 30&`83H& PP3`&0h3x&3&3&3&$ 3&$3&%3&'3 &+(38&,@3P&0@X3h&2p3&703&:@3&A3&H 3&W 3&Y3&\P3(&\03@&\H3X&]`3p&^x3&_@3&b3&d03&g3@&A&U&V& W&(f&0g&8k&@l&Hx&&&(&(&0 5z5%I5)&*415F85?5D5kY5`5 Ag5(n5u5 |5$d5&55 5* 5&5+K5?5[55x5&5 35@5M5Z5 g5t5 c5%5555!55155$555*(+5~A5'Y5_5e5k5 q5 w55 l5$?5 5555!5555 5 5*5'65%B5N5_5%55'p5Y5&5"5$15&#555*5 5r.5+<5J5X5"f59t555r55_5"5,55A5 55!5.*5 }85 F5R5^5$j5"v55*555u5'55&5x55=55  5.,5)85'D5<P5"0\5Fh5t55 55[555"A5 }5'5)5 5%<5)'5) F5^S5Ml5+5 65)155V55M5Y5)5+ 5/5%$5m15 H>5K5c^5-k5#=x55.5'5+5 _5(55,5Q5 5 5*/ 5m 75! A5 K5 U51 o5 |5 5 o 5* 5 5+ 5 5z 5)e 5) 5#, 5 55; @5b N5 [5" u5 H {5 5# 5$ 5# 5+ 5f 5% 5 5 5& 5 5! 5 5 5 # 5N !5 '5 -51 35G 95!, ?5 E5 K5P Q5! W5 ]5( c5 i5% o5 u5 {5+ 5u 5 5 5$n 5 5% 5) 5 5+V 5 5 5 5[ 5 5+ 5 5 5 5" 5' 5* 5" 5!l 5 J 5(| 5. 5"W #5(h )5 /5 55 ;5  B5 Z5 `5+ f5 l5 r5< x5k ~5E 5% 5 5 5 5 5 5S 5r 5U 5 5* 5 5 5a 5$N 5 r 5+ 5 5 5); 5d 5 5 -5k X5@ ^5 e5%\ q5K 5* 5 52 5 5 5 5!5 5 :5G5)Z5)g5mt5)5$555575$5 55 5&5 &535!@5AM5w[5Hh5 u5555 C555+r5535S55(Q5 5),#5k=5$J5)W5j5+9w5#5!5(5 5),5k5$5)5 5 5}B5O5),i5k5$5)55!c5 k55p555 55O35 ;5 H5rU5b5"o5|5"5*5%55%x5b5 O5 )505~5j 5G5B%525*l?59W5 m5+y5 5%r5'5&&5&85 &05 &@5S&h$5(0&p95 E&V&_5m5 z5'z555555g5(5& 5&x*5#85 G5T&]5j&s5++&5'1&55n5&u5&555}5 .&75D5 S5`5&Xn5 }5=585 :5d5*5e5'V55 5 5-5#?5+`5r5 )5"55u5>5#5 5Z5)|f5 &|555(55)5 5:50Q58d5v5$5555v5)m5 '5 ,M5Y5cu5*5555!5*x&g5#1'1 0&h:3K1!O1X1S\1Me&h o311y&h&(&&h &hP&& &hl&h'&h4&hI& V&g&i t&i&i\&&5&d011&d3j11&d3j&1 *131m71e@&eJ3V1Z1c1g1p&e$z311&g &(&&e311311 &f&&4&e>3O1+S1'X3a1Te1Pj&f{&&&f431o1k311&g<&&&fT&fT.121;1?1D&fU&b&s&dP&dp&d&ep&e&gL&g\&gh&g&g &g 5 &b ;&c, E3[ V1 Z1 _3[ h1 l1 q&ch & & &bh &b &b &b & &!&b!&c!3&!@&!Q&c!f&!s&!&c!&!&d!&!5!&_@!&_"3 "&_"3 "0&a ":3"K3 "T1"X1"a1 "e1"p&_"1"1"1B"1>"&_"3/"&_"&`"&`"&`8"&# &#&a@#/&(#9&ah#J&#W&#m&`t#w3E#3E#1Y#1U#1p#1l#1#1#&`|#&X#&`#&a#&$ &_$"&`$9&a$N&$[&$l&a$&$&$&a$& $&$5 $5(&$&^$&_%&%&%'5"%25 %?5&X%M5]%Z&^\%{5%&W %5 %1%1%1%1%5 %1%%1%5%1k%1_%5]%1%1&&Wx& 3 &&X@&51&91&B1&F1&P&XP&Z3 &f3 &o1&s1&|1&1&&W&3 &&W&&W&&W'&X'%&Xx'N&X'c&`'p&'&X'&'&'&X'&@'&'5'&\(5( 1$(1(5,( 1W($1O()3 (25 (?5$(J1(N1(T&](&]`(&]h(&](&(&](&](&)&)5K)%5)35!);&H )R5)]1)a1)f5 g)q1s)u1c)z5()1)1)5$)1R)1:)5 )1)1)5 )5M)1B)1*)5#y)1)1)5"y)1 D)1 <)5* 1 s*1 i*5&F*1 *"1 *'5*21 *61 *;5*F1 *J1 *O5*Z1 '*^1 !*c5 *k3 *t5 *5$*1 H*1 F*3 *5*1 T*1 R*5*1 d*1 ^*&Ix*3 *1 *1 *3 *1 *1 +&I+&+&+1&I`+I&Il+^&M+s5+~1 +1 +5+1 +1 +&M+&N+3 8+5&+1 +1 +&P+5+1 +1 +5,1 ., 1 ",&P,3&P,O&T,Y3 N,j1 ,n1 ~,w&T,&T,1 ,1 ,&T,1 ,1 ,1 ,1 ,&U,&U-1 -1 -&U-#1 &-'1 -01 q-41 o-?&U-I3 ]-Z1 -^1 {-g&U0-q3 l-1 -1 -1 -1 -&V-&x-&U(-&UL-&UL-1 -1 .&UL.1 .1."1E.&1A.1&Ud.;&Ud.W1Z.[1X.d&U.n3 .1q.1m.1.1.&U.& 8.&U.&U.3 .1.1.3 .1.1/&V/&/&/4&V/>&V/Z1/^1/g&V/|1/1/1 /1/&V/&V/1/1/&V/1*/1(/1?/1=/&VH0 &0&0+&Vh0@& x0M&0^&V0s& 0&0&V0&0&0&W0&0&0&Pl1 &P1#&P1:&P1G&T1^&U1l3 {1~1O11I1&N<13 11u11m13 11111&PD1&Q(13 21212 3 21212&U2,&29&2L3 2U52b52s&N2}3 B21#2123 B21`21Z2&O02&O021~21|2&O42&O4313 131313!&O43+&O43D13H13Q&O43f13j13s13w13&O83&O8313131313&OP3&P$3&P4 &4&4+&O493 4B5]4R&S4|&Td4&H4&H41414&H41415&Q5 3 5!&Q5+3 59&I5C3 5P&J@5Z3 5g&JD5q&JD51515&JD51515&J53 5&J53 6&ST6&ST6*16.167&ST6L1'6P1#6Y1N6]1L6h&Sp6r&Sp61Z61X6&Sp61q61m61616&S6&S6&S717 171717"&S7717;17D17H17T&L`7^&L`7z17~17&L`71671,71717&L73 )717173 )71717&T@7&8 &8"&MT8,&MT8H1 8L1 8U1 8Y18^&M8o&8|&8&M8&M8&O8&O81,81*81A81?8&P9&9 &9"&Ql9,&Ql9H1M9L1K9V&Tt9`3 9q&Tt91Y91W91n91l9&T93 9&T91z91x91919&H: &H:"&IH::&I:Q&J:^&J:s&`:&K:&K:&K:&L:&L4;&LT;6&L;C&L;P&L;]&L;u&M,;&ML;&M;&N;&N,;&N<&N<&O<2&PX1>5 g>1>1>5>&1>*1>/5>:1J>>1@>C5>N1>R1>W3>`5 >k1>o1>t3>1>1>&&>3>18>14>1T>1P>3>1y>1u>1>1>&&4>&&T?&&?&&?)&'t?7&&?N&&(?f&&`?}&&?5!=?5?&$ ?&$@?&$@?1?1?&$@@&h@1@!1@,&$\@6&$\@R1@V1@_&$\@v&0@1@1@&$x@&$x@1@1@&$x@&@1@1@&$A&$A 1A$1 A-&$AD&(AR1"AV1 Aa&$Ak&$A&$A&A1,A1*A&$A&A16A14A5A&$B&%B&%B71@B;1>BD&%B[&8Bi1SBm1QBx&%,B&%,B1]B1[B&%,B&0B1pB1nB&%HB&%HC1zC 1xC&%HC)&C71C;1CF&%dCP&%dCl1Cp1Cy&%dC&C1C1C&%xC&%xC1C1C&%xC&(D1D 1D&%D&%D6&%DQ&D_1Dc1Dm&%D&D1D1D5D& PD5 D1D1D5D1D1 D5 D1)D1!D5E1QE1IE 5]E1uE1qE 5E+1E/1E45#E?1EC1EH5EX3Ea5(El1Ep1Ey& E3E1E1E1/E1+E&,E1@E1>E&HE&HF1JF1HF 1TF1RF&HF/1iF31eF<1F@1FK&TFU&TFq1Fu1F~1F1F&TF1F1F1F1F&hF1F1F1F1F&tF&tG1.G1,G#18G'16G0&tGE1MGI1IGR1rGV1nGa&Gk&G1G1G1G1G&G1G1G1G1G&G&G1G1H1H 1H&H'1H+1H41 H81HC&HM&Hi13Hm11Hv1>Hz1<H&H1SH1OH1xH1tH&H&H1H1H1H1H&I 1I 1I1I1I%&I/&IK1IO1IX1I\1Ie&Iz1I~1I1$I1 I&I19I13I1YI1WI1eI1aI&PI1xI1tJ1J 1J&J&J*&JB&JS&Jp& J}& J&J&,J&J&J&J& J3K1WK1SK3K1|K1xK&1K*1K5& K?3KP1KT1K]3Kf1Kj1Ks1Kw1K& K3K1K1 K3K16K12K1[K1WK& 0K3K1nK1jK3L1L1L 1L1L& LL&3L71L;1LD3LM1LQ1LZ1L^1Li& Ls& L1&L1$L& L&L3L12L1.L&L& M& M& M2& MI& Mr& M& M& M& M& M& M& $N & 4N#& DN:& TNQ& dNh& N& N&N&N&0N& N&8N&DO&lO+&O8&OI&Oa&Ov&0O&O&O&O& O&@O&O&\O&XP&P&P.&P;&PL&Pa&Pn&P&P&HP&P5P5 P5$P5 P5$Q5 Q5Q!5_Q65 QD5QS5 Q`&PQj5(Qw5,1Q5Q5 XQ5 XQ&YQ5 gQ1JQ1BQ5(Q1}Q1uQ5Q&R 5R5 PR5R5RR(1R,1R15nR<1R@1RE5 RR5)R[3 &Rd5:Ro1:Rs16Rx3 5R5R1SR1OR5 XR1|R1xR&Y|R&YR&[XR3 hR5tR1R1R3 ~S5 S1S1S5$S"1S&1S,&[`SA5SL1SP1SU5oS`1 Sd1Sj&[S5S1 S1 S5 XS1 #S1 !S&[S&ZS5 S1 2S1 .S5$S1 YS1 WT3 T 5& T1 iT1 cT5 T)1 T-1 T25T?,&TH&ZT]5 Th1 Tl1 Tq5$T|1 T1 T&ZT3 T1!T1!T1!ET1!?T1!pT1!jT&ZT3 T&[T,&U&ZU&ZU-1!U11!U6&ZU`&ZUw&[U&YU3 RU&\<U&U&U&YLU&YV &Z,V9&Z8VP&ZDVg&Z`V&ZlV&ZV&V&[V&\ V&V&W5W05 W=5$WL5WY5 XWh56Ws5W5,W5 W5W5 XW5 lW&,W5W1!W1!X5)X 3ZX5X1!X"1!X'5 *X45'XA,&XJ3jX]1")Xa1"Xf3Xo5 Xz1"mX~1"iX5$X1"X1"X&-X5 X5$X1"X1"X3X5X5oX1"X1"X&-Y3Y1"Y1"Y 1"Y$1"Y+3YA&.PYV5Yc5 XYt&.PY~3Y1"Y1"Y&.Y3Y&.Y&/dY3Y&/(Z&.PZF&/`Z[&Zh&Zy&0Z&Z&Z&-lZ3!Z1"Z1"Z&-Z31Z1"Z1"[&.[+&-\[53<[A1"[E1"[N1#[R1#[[1#6[_1#2[h&-\[r3V[{&.|[&/[& [&[&/[& [&[&/\& h\)&/\:& x\g5i\r&A\5\1#]\1#E\5 \1#\1#\3(\5'\1#\1#\1$P\1$<\3U\5X\1$\1$\5(] 1$] 1$]3 =]&1%]*1% ]/3 a]=1%L]A1%D]J&C]T3 ]e1%y]i1%q]r1%]v1%]1%]1%]3 ]1&]1& ]&C]3 ]&E]3 ]1&Q]1&O]&CL]&CL^1&]^1&[^&CL^41&i^81&g^A1&y^E1&u^P&C\^Z3 ^p1&^t1&^~&C^1&^1&^&F,^&F,^1&^1&^&F,^1&^1&^1&_1&_&G_&G_9&G_S1&_W1&_^&E_&F_& @_&_&F_&G _&G4_&` &`!&C `+&C `C1&`G1&`X&E`b3y`s1&`w1&`1'`1'`&E`3`1'"`1'`1'9`1'5`&G`&G`1'R`1'P`&H a&E$a$&Xa?&BaI3aZ1'ba^1'\ag1'ak1'~at&Ba~3a1'a1'a1'a1'a&Ea&Ea1'a1'a&Ea&ETb &Xb&&Bb03 b<1(b@1'bI1("bM1(bV&Bb`3 bl1(=bp1(9by1(Tb}1(Pb&Bb3 .b1(ob1(kb&G`b&(b&b&Ab37b1(b1(c1(c 1(c&Ac3Fc01(c41(c9&Ec_&Cci3 cz&Cc3 $c1(c1(c&Cc3 :c1(c1(c1)c1) c&Gc&xc&Cd&D d3 Id#1)8d'1)4d,3 Id51)ad91)]d>&FxdO&d\&dr&D@d|&D@d1)zd1)xd&D@d1)d1)d1)d1)d&DTd&DTd1)e1)e &DTe1*e"1* e+1*_e/1*[e:&DpeD3 _eU1*teY1*reb1*ef1*eo3 _ex1*e|1*e1*e1*e&De3 ne1*e1*e&De3 e1+#e1+e1+:e1+6e&Ge& 8f &Df&Ff/&f<&fR&Df\3 fh1+cfl1+_fq3 fz1+f~1+f&FPf&f&f&A8f3f&Ahf&E|f&g&g&Eg'&`g4&gF5gQ&:@gs1+gw1+g|5g1+g1+g1,g1+g1,g1,g5^g1-g1-g5g1-g1-g5g&<g3g5h1-h1-h 3h5}h 1. h$1.h31.ah71.Qh<3ZhE5hR5ohc&<hm3oh~1.h1.h3h5h1.h1.h5 Xh&?h5h1.h1.h&;h38h1.i1.i38i1.i1.i&@i)& i6&iL&;iV3Oig1.ik1.it3Oi}1.i1.i1/ i1/ i&;i&;i1/i1/i1/(i1/&i&<i&<j1/2j1/0j &<j"1/<j&1/:j/1/Hj31/Fj>&@jH&@ji&@j1/Rj1/Pj&;j& Pj&j&<|j& 0j&j&@,k &@k& hk*&k<&=hkQ5 k\1/^k`1/\kf3ko5kz1/zk~1/rk&>@k3k1/k1/k1/k1/k&>pk&?k&Hl&l&?<l%& l2&lB&?dlW& lo&?|l& l&>$l3l1/l1/l&=l&=l1/l1/l&>,m3m1/m1/m&>mF&>ml&:mv&:m1/m1/m&<m&?m3m1/m1/m1/m1/m10m10n3n 10)n10'n&@n-&@ n73 nH105nL103nV&@nr&:n&@\n& (n&n&@|n&n&n5o5o"5o<5oI5oV5ooe5or5 Xo5 o5'o5 o5%o&o10Mo10?o5}o10p10p10p10p#10p'10p,5*bp711p;11p@5!pK11DpO11:pT3pf11rpj11jps&$p}&$p11p11p&p& p3p11p11p3p11p11q11q 11q&Tq &Tq<11q@11qI11qM11qV&Tq`&Tqy11q}11q&Tq11q11q11q11q&Xq&Xq11q11q11q11q&q3r12r12r12r!12r*12+r.12'r33r<12<r@12:rE&xr_&ri3rz12Fr~12Dr3r12Pr12Nr12\r12Zr&,r&r&r&Tr&r&s&|s#&s0&sA&sV&(sc&st&hs&@s&s&s&s&s5 ys5t5t75't>&0t`12ttd12dtt12tx12t}5&/t12t12t5t13t13 t5t13Et137t3t13t13wt3t13t13t3}t5{u14u14u &u &@u2&uJ&u[&uj&Lut3 u14u14u3 u14Ju14<u14u14u14u14u14u14u3"u15)u15u&hu3Av 15^v 15Vv15v15{v#&Xv-3`v>15vB15vG&Pvm3kvz15v~15v15v15v&lv3{v15v15v15v15v&lv3v15v15v16v16 v&\w3w16w16w!&wC&wT&Xwo&wy3w16+w16'w16>w16:w&w3w16Qw16Mw16dw16`w&w&w16ux16sx&x&(x1&xB&XxY&xx&x&x16x16}x16x16x&,x&,x16x16x16x16x&0x&0y16y16y &Ty1&(y>&yV3yc16yg16yp3yy16y}16y&Xy3y17_y17Wy17y17~y3y17y17y17y17y17y17y&Xy&Xz18z18z &\z*37z;18"z?18 zI&|zS3Bzk&xz&z&z3Rz182z18*z&z3Rz18]z18O{18{ 18{&l{3g{*18{.18{718{;18{D&t{N3r{_18{c18{h&{y&({&{&|{&{&{&{&x|&(|&(|&&|9&||F&L|[&|q&|&|&|5&|5e|5*M|5|5'|5 }C57}U5^}o5X}|5!}5N}5c}5!Z}5'>}5X}5!}5}5"b~5 T~%&~<5~G19~K18~P5~]&x~r5 ~}197~195~5$~19I~19G~&~&~19S~19Q~19]~19[~&H~&0& &&15*<& S5$^19wb19eg5t51919&X5 19195$1919&p3 19191:1:&p 31:1: (1:,1:6&p@3,Q1:*U1:(^1:7b1:5h&u&D&&5&`51:e1:Q51:1:51:1:5 1;31;)5v1;]"1;W'5#n21;y61;s;5IF1;J1;O5#BZ1<;^1<5c5Zn1$1> 5M& <&x&3`5J1>91>5&5 "1>w&1>q+5$61>:1>@&U5 `1>d1>i5$t1>x1>~& 5 P1>1>& $5 1>1>5$1?1?& 85 1? 1?5$1?/1?-#& l:&Q& f5 q1?9u1?7z5$1?L1?J&5 1?V1?T5$1?i1?g&85 1?u1?q5$1?1? &P 5 +1?/1?45$?1?C1?I&d^5 i1?m1?r5$}1?1?&5 1@1?5$1@%1@#& 5 1@/1@-5$1@B1@@& 5 #1@L'1@J,5$71@_;1@]E&@O3k`1@id1@gm1@sq1@qz1@}~1@{&&1@1@1@1@&3{1@1@&<&@&&&XA&Q&pl&|&&&&&&0&&H(&C&`S&(n&x&@&&&0& p#& @& ]& z& & & & & & &&(5.&+R&+c5On1@r1@w51@1@51@1@&+5 &5$1@1@&+5 & 5$1A1A!&,65A1AE1AJ5oU1A2Y1A0_&,4t51A<1A:5o1AO1AM&,&,1AY1AW1Ac1Aa5 54;5(d5*5' &5I1A1Ak5 51A1A5,1B+1B'1BK1B;1B1B5%1B)1B2&<3M1BQ1BV3_1Cc1Bl&v3/1C1C&3:1CA1C=1CT1CP&#&x&&L&L 1Cw$1Cu-1C11C:&LD&L]1Ca1Cj&L1C1C1C1C&P&P1C1C1C1C&h3E1C1C& 3P1C 1C)1D -1D2&#C& 8N&c&!\x& `&&!|& @&&3[&1D21D* 1Dw1Ds&"@/1D31D<1D@1DK&U3ff1Dj1Ds&}3v1D1D1D1D&#&x&& 31E1E& 4 31E) 1E%)1E<-1E82&$ C& 8N& 4g& q31Ea1E]31E1E&"&&&!31E1E31E1E&"&%&;3K1EO1ET3]1Ea1Ef&#\w& && &!&!&!&"<& & &#|5&B&S&#d& q&5+5 5$5 5$5E&'5 1F,1F1F1Fr#&'-3>1FB1FG3P1FT1FY&*j&w&&(831F1F&(H3 1G1G1G*1G&&+&x&(H&(%361GO:1GKC&(M3#^1Gtb1Gpk1Go1Gt&+& 8&(&(3.1G1G3.1G1G&*&&&)P39.1G21G739@1H D1HI&+4Z&g&}&)3D1H1H3D1HA1H=&+d&&&)&) 1HR1HP1H]1H['3O5&*V&(c&*lx& &&*& 8&&+ & P&5J&705 !1Hu%1He*5A51H91H>3G5&kR1HV1H_3o1Hs1Hx31I1I &9\& &&8<31I91I5&8P31I^1IZ1Iq1Im&:)&x4&8PM&8W3c1Ig1Ip&8z31I1I1I1I&:(& 8&8&831I1I31J1J &9&+&=&7_&7l&9(& &&9|& &&9& &&9& '&8&9I& V&h5#Qv5p5#5,5 5 55"o&251J7#1J'(5 31J~71Jr<5%G1JK1JY1J]1Jb5 m1Kq1K 1K+1K'5#=1KD1K:5 1Kt1Kh1K1K5)1K1K1K1K5 1LL1LF 5{1Lr1Lb5 )1L-1L25 =1MA1MF5aQ1MeU1MSZ5b3k5%+v1Mz1M&3&31M1M&31M1M1M1M&33#1M1M&338%1N)1M21N61N?&3I3MY1N&]1N"f3Mo1N9s1N5|1NP1NL&33X1Nc1N_1Nv1Nr&33m1N1N3m1N1N3x 1N1N1N1N!&5A&4|K3a&4k3w1N{1N&4&4&41N1N1N1N&431O1O1O 1O &6&6@&6U1OY1Ob1O%f1O#m&5&68&6X& @&&23&58& @1&6F&S&d&6u&`&5 5g55 5!&&&&3+1O1/1O-8&B3S1OVW1OR`1Oid1Oei&tz&x&&31O1O1O1O31O1O1O1O&(31P1O3%1P')1P#.&?&L&b&Hl3}1P>1P:31Pc1P_&<&&&l&l1Pt1Pr&l1P1P!1P%1P0&:&V1PZ1Pc&x1P|1P1Q1Q&3 1Q01Q,&31QU1QQ1Qh1Qd&& 8 &&3&`@&Q&\b&o&5$5 555 =5595U5q5555#5 5$5 5%05&5K5q5P~55!5#5 k55 5 55s25;5&V5|{5\5(?5j5 5)'5 35$A5:Q5Sj5z5S55S5 5$55S55 X5+5 85$P&0@k1Qo1Qx1Q|1Q1RP1RH&03a1Ry1Rs1R1R1R1R31S*1S&0&0 &0&031SW71SU@&0U1SaY1S_b1Sof1Skq&0{31S1S~31S1S31S1S&131S1S&2 31S!1S&3/1T31T 8&2tI&V&h&1Tu&2 &1l&1l1T$1T"&1l1T.1T,1T:1T8&1&`&&1)&H6&L&\Pg1TJk1TBt&\`~&\`&\1Ts1To&\&]1T1T1T1T&^@95 =5&h&h4&pF&px&0&0&&8&"&4&&& & & & &8 & & & & & /& A& S& e& &x &x &x &x & & %& 7& c&x& 8&(&(&(&(&3&&@&@&@0&@B&@c&pz&p&p&&&&"& ?& Q& c& u& & &h&h&p5&@b&&[&@k&@&@&@&h&0&&(G&8d&0&&&([&8p&8&8&0&0&0& &?&T&d&& & & &(&(&(E&@Z&@j&@&h&h&h&p&p&pG&P&X&P"&X@&X^&n&&&&(&(&(&(&0(&0=&0M&0u&8&8&8&8&@&@&@&@\&n&&&& & ;& M& & & &!,&!#,&!5,&",&#,&%/\%/\%/\%/\(&x(&x)&x)*&x)A& )S& )&()&()&()&()&(*&*&*-&*?&*Q&*&(*&(*&(*&(+&x+&x+C& 8+U& 8+l&0+~&09=&9&=&=&>~&>&>&>&>&>&?&?#&?@&?]&?|&?&?&?&?&?&@ &@&@6&@S&A&&AC&C#&C3&C[&xCk&xC&C&D& 8D & 8D9&DI&DY&Di&D&D&D&D&xD&xE &E&EC& 8ES& 8Eh&hEx&hE&pE&pF&F&F&G &G1&xGA&xGV&Gf&G& 8G& 8G&G&G&hG&hH#&pH3&pI@&IP&Ix&xI&xI&I&I& 8I& 8I&@J &@O8&xOH&xOp&xO&xO&(O&(O&(O&(P & P& PE&PU&P{&(P&(P&(P&(P&P&P&Q&Q7&xQG&xQo& 8Q& 8S&0T&0/&.&G&YX `T P00\$ $%\'+$,0@270:@AH W Y \\P p\ \ ] ^ _@ tb d0 g.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.cst8.rodata.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @ip @:&i,i12i:Ey@@O|PJ@ʨT}00a}`9n}0i@˘` }D@P,3T@(0@60R@7(00,@0  <@7X o#(#8 9 0( :@md5.bd.o/ 0 0 0 644 35384 ` ELF8@@=@gE= aJ#a)yJy)eJe)2aJa)Tv9C#N ``pxA!a!Aa |2x}:xd})@8D })2x$d d$$(,=Sk048<>T$ 9Jx:Rp}J*~R:})R=ZU)8>9JV}(J}J2|H8}Jx|:x>|R:T`>~B| =G|8}*x|Bx9*|>_|T>:R|"~RJ}J 8}}JJx| "x}J>0UJ>:F}DR~"})P8})x|Rx})>UGU)8>:R}*J~RR|H8}NJx|"x|z=iT`>9| }J}8=A|Rx}*x|> ET>:|"~}J 89γ@}JJx| "x}J>YUJ>:R[}DR~R"})P8})x|Rx})z=]U)8>9׾}*J}R|H8|"x}DJx|>kT`>:"| ~J|8|Rx}*x|>^T>:Rq|"~R}J 8}JJx| "x}Jz=yUJ>9C}DR}"})P8})x|Rx})>IU)8>:!}*J~R|H8|"x}DJx|>ZT`>:R%b| ~RJ|8}|Rx}*x|z=&^T>9ZQ|"}J 8}"}JJx}J>UJ>:Ǫ}DR|Rx~R})8})"x})>Q/U)(>:R]}*J}@Jx~RJ| 8|Rx|r=DTH>|"} "x| P88S}JJx|"}Jz=7UJp>}DR|Rx}H8=آ})"x9})}RU)>}*J}PJx~ 8>|Rx:|~JT(>|"}2"x~JP8>K!}JJx:R}J~R"UJH>}DR|Rx| H88})"x|R})z=goU)p>9}*J}OJx} 8=|Rx9 |}JT>|"}0"x~ P8>EZ}JJx:}J~"UJ(>}DR|Rx~IH8>^})"x:R})~RRU)H>}*J}@Jx| 8<|Rx8|z|JTp>| }/x}}P8=*}JJx9L}JUJ>}@R|Rx}R~ H8>})x:9B})U)(>}*J}RJx~J~R8~RRx~R">;r~I:1} x~1| P889}JJx?{o}Jr=UJp>98 }RR>֫~@Rx:#| H8;{~O})x>Lm})z:Ra"U)>~RR}*J=|Jx}JJx|}JT >9D| >K}Jx})x}J}UJX>:ϩ}@R?Z}1Rx| Rx~1>UV1>:RK`~*~R})x}@x})r~RpU)>=Y}1J9Jp|Jx~1Jx|z}JJT >=| 9~1x})x~1>(V1X>:~~ ~})x|x})>SU)>:R'}1J~R|Jx~1Jx|R=XT>9J0| }JJ~1x})x~1}V1 >> ~ :9})x|x})~U)X>>W}1J:R|Jx~1Jx|R~RJT>>s)| :s"D~1x}*x}1z><xU)>:1|} J~1}JJx|Jx}J>ĬUJ >:Ve}IR~J|Rx})Rx|~sRTX>>e[| :Y})x}Rx})>5C+U)>:1} J~1~RJx~J~R> VR>?9~I;9}~J8|}JJx:̒}J;Z]aUJ0>?}RR?-}IK8~R})x;C});!U)P>?N}*J;}88~JARx?S;~Wx>=; 95 S89}JJx>*}J"8һUJ>=k}XR9kӑ}DK8ZR|x|T0>|"|8{"RxWP> S8})"x})!U)x>}8J}*#8J}Jx}JAUJ>}IR}D8R|Jx|aT0>|"|K8"})Rx})U)P>}$J}*S8}J}J"x}JUJx>}IR}D#8|R|Jx|T>|"|K8}k"})Rx})U)0>}$J}*S8|J}J"x}JbUJP>}IR}D#8|R|Jx| Tx>|2|K8}2})Rx|2})ZU)>})B#N `|aT8|}x|+x|#x!a#C}J|H@@9Jq({hB}JBy);]A#@;{ y) |<@|~JAhxxH`9 })9=9I|T,9I}T,9I 9)}@T, I}@L,IBxxH|P(;?@0;Ap;]{d;@``_8Ix|^ (0_8 (0^89I|T,9I}T,9I 9)}@T, I}@L,IBxx;@H|?@@lAp{{exxxH`8!a|N exxH`8!a|N xK|9a;||x|#x!a$y* ?|~R(}Q8cAhx 8H`9 ;});jx9*;|L,9*|L,9* 9J}L, }T, BxxH (09;9@ }L, 9)`B}L, 9 5J|D,9 |D,9 9)}D, }L, @?xx?PH9 })9?9)}@L,IB_?x8X8\<H`8!a|N ``` 78x ;H`K``|=@gE= aJ#a)yJy)eJe)2aJ!!a)Tv9|t|t|;pAp!xxH8`H`x|~xH8!x|N ```|a|{x?|#x!Aj!?,9A@cx;ApH`=@gE= aJ#a)yJy),>eJe)2aJa)Tv9Ap;p!xA;p;pA(>x@8xcxH`|yAxxxxHQA8`H`Dx|xHcxH`8!x!Aa|N xCxH8xcxH`,|ex@K<Ap9!p8A988>p|txjH8!|N ```<:?4" +^++"+%+ (5(+0.82?@6DH9+P=+XA~`ChFpIxLPT[`rtwy{}^ H(K085idH@HHPX`hpx HGQ+0:5 E~F ,G 8H rpI @   {  @G jmpABCL&622oV*`:?! t"! H""<7:F!.8buf/h9+ . fd/H0 end1 2  max3 4(5P5X6 `7Hh8 p9 x X buf !  in"  : :u ,:? 85 5 end5 5  ptr5 5 5K(5K0+ 7 8 9 :  8< 8< 8 end< 8< 8 ptr< 8< 8 <K(<K0 > r?  mem@  maxA  8C C endC C  ptrC C CK(CK0 =  + :=  H .+ > E .#u N 9ikH v  #t : e O Hv0   ?;buf- ?S in< ?abcd  . ctxI |p  <X = `7 wT0 ST ST7 ST0UX7T0u0 ctx3 bufG len(t$p  @TU ST@TU>4 J hST@STU?ctx1 @o bufo) Ao7|tqRR. S' lenS5%ctxUVZ STTUU DSTL{L$ lenL1&N{N'NNH$LO( S T UN--3-@&/{/%ctx0~res1 2 '3^BQI6x vS VST STU S@ DST >S =ST VbSTU  S T U/( NTC:( b(% ofs(. len(9D* E))! ST T1&S"UU1& S@ DSTF5str&ofs1len<ctxres *HXGS*7))! ST T1&S"UU1& S@ DST++I~ : ; 9 I8  : ; 9 I 8  :!; 9!I!8 !I: ; 9 IH}1B $ >  I : ; 9 I8  : ; 9  :!; 9 IBI!I/ <4:!; 9 IB4:!; 9 IB1RBUX!Y W H}:!; 9 IB:!; 9 I.?: ; 9 'I<.?:!; 9!'@z41B :! ; 9 I:! ;9 I: ; 9 I 414:!; 9 I.?:!; 9 'I@z &I! !!: ; 9!" :!; 9 I8#.?:!; 9!'<$ U%4:!; 9!I&4:!; 9 I'4:!; 9 I(H})41*.1@z+.?<n:!;!,% -$ > . /GI0 : ; 9 1 : ; 9 2&35I4  : ; 9 5 : ; 9 I 864: ; 9 I?<7I 8 : ; 9 I 8 9.?: ; 9 '<:.?: ;9 '<;: ; 9 I<1X Y W =1>1RBX Y W ?.?: ; 9 ' @.: ; 9 ' A: ; 9 IB C!I/D1RBUX Y W E UF.?: ; 9 'I G1 PTTUY3wv'xv'u"" ([7$  # %!x"YYYYT Z Y P P aZZTTYXZZZZY T Z Y Y PYbZZTy;# $  %!v"WTTTTZ Y P Z a YPYhYZVVPwv'xv'u"" ([7$  # %!xw'wv'xv'u"" ([7$  # %!x"w'v"" 8H<$  # %!"x"PPPTZ Y b Z a YPYhYZSlSlToTToZUU?zSS@n18$8#$  %! @$!!18$8#$  %! @$!!18$8#$  %! @$!!4oyYy1y8$y8#$  %! @$!y!SmhSmhSmTo@oToToUkUkUkYY@y@ySS@n@n"#S##n##S"#T##T"#U##U"#qp##o !S""S""q#0 !T""T""q#8!!o!"0!"SSkS k S kTnn n T nh h hSoSSUoSU S S ooSj#$S$$S#$T$$T#$U$$U$$U$$U$$T$$S$$S$$S$$n$$qp$$oSSTTUUSnSqpo,t!!!!!!"""######$$$#$$$$$#$$$$$$$$$ c runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/caml/usr/include/powerpc64-linux-gnu/sys/usr/include/powerpc64-linux-gnu/bits/typesmd5.cstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.htypes.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hplatform.hio.hmd5.hstring.halloc.h z"""""#"#"f%!!!/!!%"""!!!/!!!qf .//<.//<./K ./= .//.././ ./K ./= ./= ./= ./= ./= ./= ./K ./J.0 J./ ...!.J.!.J.!.J.!.J.!.J./.J.!.J.!.J.!<<.! !z $ ,X !z  !z  !z " !  # +#! <  " ! /;//J  tX J~f<"""" .#  ."  ! = !!Jg=-/ .z !=z"""  ""#0# C*!EIL /</  D = !!= J ..q..  Y! u.  X.J. X=;//. /-u/. JV  X^-<""""S +.#N #* "T / Q!=<Pt<"""" .#   ."  ! = !! memprof_young_triggerlongs__sizecaml_getblock__jmp_bufsize_tc_stack_linkdependent_size__alignrequested_global_major_sliceyoung_limitmajor_slice_epochgc_policymlsize_tcaml_md5_block__jmpbufswept_wordscaml_local_roots_ptrbacktrace_pos__builtin_memsetlong long unsigned intunique_idmemprofcaml_failed_assert__next__int64_tsigjmp_bufcaml_MD5Finallimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnextintptr_textra_params_arealong long intsigned charcaml_plat_mutexbuff__jmp_buf_tagmark_stackrequested_major_slicecaml_md5_chanint64_tpthread_mutex_tbitslong intvchanmajor_work_done_between_slicesallocated_words_directcaml_MD5Initallocated_words_suspendedmemcpycaml_minor_tablestoreadextra_heap_resources_minordouble__pthread_list_tcurrent_stackbacktrace_slotslice_targetcustom__prevcountcaml_heap_stateoo_next_id_localbacktrace_last_exn__uint32_ttablesintern_stateexn_handlerrequested_minor_gcallocated_wordsvaluechar_osmajor_refinside_stw_handlerlocal_rootsblockunsigned intcaml_custom_eltstack_cache__int128caml_channel_unlock__valGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned int__kind__datacaml_ephe_infooff_tnamecaml_MD5Updatecaml_md5_bytescaml_stateminor_heap_wszintnatdatadependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatcaml__framesweeping_donedigestcaml_MD5Transformcaml_md5_string__builtin_memcpyc_stackyoung_ptr__ownerbasetrap_sp_offyoung_startasize_t__mask_was_savedstack_infoatomic_uintnatlong doubleextern_statetrap_barrier_off/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bemarking_donecaml_ephe_ref_table__off64_tcaml__roots_vchanephe_infobyteReverseexn_bucketextra_paramsfinal_infouintptr_texternal_raisebacktrace_active__pthread_internal_list__saved_mask__int128 unsignedyoung_endthresholdslice_budget_Boolmemprof_domain_sunsigned charcurrcaml_md5_channelgc_regs_bucketsdls_rootcaml_ephe_ref_elt__sigset_tcaml__dummy_vchancaml_channel_lock__pthread_mutex_schannelstat_minor_wordscaml_custom_tablechan__count__lockuint32_tcompare_unorderedntablesstat_forced_major_collectionsmutexcaml_intern_statechargc_regscaml_final_infostat_blocks_markedcaml_alloc_stringshort int__elisionbuffercaml_domain_statelockedtrap_barrier_blockoffsetcaml__temp_resultruntime/md5.cMD5Context__spinscaml_raise_end_of_fileyoung_triggernitemscaml_gc_policymemsetephe_refreserveparser_tracerequested_external_interrupt__nusersflagsminor_tablesreadshared_heapsize__listprevbacktrace_bufferfile_offsetaction_pendingstat_promoted_wordsrefcountcaml__roots_blockcaml_extern_statecaml_ref_tableephelongjmp_bufferGCC: (Debian 13.2.0-18) 13.2.0zRxA HH, R  MDx0F AFA~rmG GAA E GAA 4F AEA~K`l FAD NA~REALC ACH"A~ZAUAK IAA UB AA (lC AEA~X DAD NA~MDA NA~REA   H &005<HJQ`asx md5.ccaml_MD5Initcaml_MD5Transformcaml_MD5Updatememcpycaml_MD5Finalmemsetcaml_md5_stringcaml_alloc_stringcaml_md5_channelcaml_statecaml_channel_lockcaml_getblockcaml_channel_unlockcaml_failed_assertcaml_raise_end_of_filecaml_md5_chancaml_md5_blockcaml_md5_bytes l  |   h  P   P X h ZXC h       "2&2.0204 T ~ZXC 220"0$   0 8 H &3&P 30& 83H& P3`& h3x&3&p3&@3&3 z   &* / ;= D W  Hc rj q x   .    O 2 U    v  3 t= oK  P ] bj H}      @            ^: ]L eZ  _ k | ?  7     6 Y   "# 11 ?  M .[ Ki Dw  M   &          - ; NI |W e s      1 f   k  ^ g   # T# / ; OG S N_ k w          e   M     -  o1 ~; BJ W d  Mq [ &       0  $  U o   !  6 x- : dM W  d \u 1   m  Y  G    4  N .h  0u         9   m -  3 : H T  n r {   V ]  B    H   r   +  V > ; K ( s  H  r   V W   F   ? ` O  W # w  5  x  &P    E  !     %  )  6 k : G E d J&  a  k  o } ~   i     & p "     & 0 (  [  U $& T . - =  A  J  N  W 7 [ 5 a& p x& & T & & > &   o. 2 A E R RV J[  l }p yy& t     & t& &  & <& </ 3 < @ K& i&   X  &@    }   ! 8&xB hQ U [&& G&p {    @ :   \ Z < z f d# X,  6 q: o?&M&,^&k& 3&   y        %    K ;  )&>  H L V&` Mo s y&&p&&&& &>&c&<x&&&\ M&      & }& * 3 7 @  D  I [  _  h&r   3  /&4&@&L  :&]& x  L|  H  b  ^  x  t    &( 8    &T&`&l8  F< A E &r&0P|    pp@.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @t@Vx &,61@Z;2'OJJ@\H%[*Oi.P ~80y@@0 8?8 @p0D V0P' PH@R(0 UX`memory.bd.o/ 0 0 0 644 112472 ` ELFX@@|?;|xx!H`,@P=")xI?_IH`,@08!|N |dxH@@H="))|>H@@4?j=,)A`=] |)P@A(|@xH`=|9I]K|<,)A< hIp{8!}}J hIpN ```|<{8!| hIp}}J hIpN ``?|x!j>,)A< h{9@|(@A}C@PIh8!N ```|<|K}&|}x|#x.$!aAL|>@x@x?j=,)AT,?Alp`BpA|piX=B`BɁpf`$ɊX*` XA8!} N ``{{B}JxAp`Bp*@{{BiX}JxAp=B`BɁpf`*`$ɊX*` X@||88`H`8`H`8!|} N `|H`.#|~x|K```|<?j=,)A,?Ap`BpApp`BɁpf`$i`=BɊX*` `@|H`|8!} N ``{{B}JxAp`BɁpf`*K```{{B}JxAp`Bp*K@```|<H@A=")), AD|?j,#Ax8H`|p@P<|&H@@D="))|&H@@0?j?,)A`?_ |)P@A(|@(xH`?|9I_K```=BJJ|?P@AK``|<H@@D="))|>H@@0?j>,)A`>^ |)P@A(|@xH`>|9I^K```=BJJ|?P@AK``|<|K<@Hp||x*sAttx})y)9)}>*p8!N |{H}]*}@I@L,| 8!xN ``|<"} @L,| 8!xN ``|<As= a)xy)xe)8a)A<,'A$,'A=|3x9]*99J,(*9JA${} **9J **Bxx8H`8!xa|N ```88`pH`8`;H`(pAK```H```H````|A=")})j!Q,?A|~x8|#x|#x8x;H`||yA_?8qJ})*}B?A?})*?= _0a)y)e)a)}*Hy)|(H@A(;A,>As= a)xy)xe)8a)A<,'A$,'A=|3x9]*99J,(*9JA0{} **9J **B```xx8H`8!xA|N `88`pH`8`;H`(pAK```H````="),)L |8`!H`=",#iAcc8!p|N 8`AxH`xK`=")?!q;,)A,#|xA|xx;H`,@_?x*_IH`,@xH`x8!|N ```|H`8!|N ```8!N |dxI?uB=%M&:?X"     " % (( +0 .88 2L@ 6QH 9P =X A` Ch FIp IIx LI PI TI [I `8 rI t wI y { } 8 8   8 I I I I  H( Z0 8YidH@ HH P X ` Ih Ip 8x 8 8   I I I 8 I H 8 8  T ^  18+sp0 1 3 :H; . < I(id= 0pLuspw xLEF iG 8H pV"@ 8 8 O"""" "@TjmpA BC,"Y7&M,22|cI7*%`&:?>  ?! H?"Z&:7F>. [buf/+u 9 , 9,2I,3I85 5 end5 5 ptr5 5 5Z(5Z07 8 9 : 8< u< uend< u< uptr< u< u <Z(<Z0 > ? mem@ maxA 8C C endC C ptrC C  CZ(CZ0 z,]:% _&:+u    ! " # +u0 h\!H+u         '] @ @ ^" $ %T 3_:A  A  8!+   .-!. O8!= H .-"4 .-C H B O H- H 9"8 . B@ OC-")W .0,x  . . HDf8#-    D>`$b0$a H9 J a%I0]   i0/  ,9e9 O 9 H CV n5HC  plen .i HsO   i HE,bs Oll . wSACTU # uF##1$@S )S@Sx C  s:OEZ7 7  u#y$@dS )S@SxACSTUS T U Z C[ s:O C [Mkv #$@S )S@S +SACSTUx' Cs@O . 7 7 num;Z szHZ I 7 ##s$@^S )S@SALST0U9999 7<o b= 7 szHZ oaSSTTx 7x0 bC 7 szNZpb   !  88 899  S S88 8 99  S  SF!oT! rST )S )S  ".# $@S )S@S $|$ b|0 7pb  !o!   8W8 8B99  S S88 899  S  SS's 7+szs4Zu h\ szh2Zh:H bi;k STTUUx 7M szM8ZM@H bNAP Q Ip0[p1\p2]p3^p_1p`Epa T#$@zS  )S@SS T U RS T U S': 7`sz::Z pb@ @JSS# )S$&,  8(58 8 99  S S868 899  S  S$l @S@.S 2  )pb2 c !o pb0  8  8 8 99  S S88 8!Y99  S  S: !b: 7#$0 tag>& G&G&&&&& 9R"s9u9i9]&"&"TUVW"STV0"S6T1#S1$3 tag05& &&&&&& 9R$,9u9i9]&$S&$xTUVUW$STV0$S6T1$S1x&* tag8& &&&&&& 9R%9u9i9]&&&&)TUV0W&LSTV0&hS6T1&S1x:'&tag4D!H|v  i$' obj( v31@'i H 9'99996ES T U )F ref-8)F )p)c)V)}) 9$(94!959@.)) )S T U /) )')obj3>L 8ret H)p S T U  p) - ref'2@- .. --.$ 9$h*94!959@..0+.58xm8888(9+tTU0+S T US T U.@.A!.K.W$,%.X.d8xx8888(938x-^#888888,S-.S T US T U-{TU0-S T US T U'd.sobje ee"e0g 8H.@pj, pt)u H u)u.s_. ref_, v_7d.SST1UTO1 objO2O= vOKretQ R 81/Y )Y 1Y 1 9$S/94!959@8x\8888(938x1*8888880S0S T US T U1GTU01yS T US T UIX2 refI(e2HK 222F9$A2/94!959@/222'>3obj>.>9@ 8 F )F 3$04N fp0>, val0H3ref;3S3S T U ;S T U ;4S T U 6S T U :$p4 res6 maxDS T U !$5 res0 max>53S7T15JS1S T U ;5I6S T U;6EI7S T U;48qJfp:,JvalD16K)K8qf8x8#888(938x7#8888887S7S T US T U8TU08AS T US T UL8Mobj )8)")1 gref28m48 28m;829$(Oerr4HNm89M 4o9M4oILC9)D|)D#8)D.HhHN+9Mval8 49M4I:H9a,Ib7IresD*2X:222 9$A:s94!959@/222*->?--. ..$ 9$h;794!959@..0<7.58xm8888(9;TU0<S T US T U.@.A!.K.W$<.X.d8xx8888(938x=#888888=]S=S T US T U=TU0>S T US T U*)F?)V)c)p)}) 9$>94!959@.)>)/) )*?n#?`$@*@9 u@+# @$@@S )S@x*[ACkv A #@$@@S )S@S A"SACSTUOOI~1B41BH}H}(  : ; 9 I8  !I 1RB UX YW  I : ; 9 I 8 :!;9 IB :!; 9!I!8: ; 9 IH}$ > 4:!;9 IB.?:!;9 'I@z1RB UX!YW : ;9 I4:!;9 IB4:!;9 I : ; 9  1 1U : ; 9 I8 :!;9 IB: ;9 I U U4:!;9 I !41"<#1$.?:!;9 '@z%I&!I/ '.?:!;9 'I !(1RB X!Y!W! ): ; 9 I*.1@z+>! !I: ; 9 ,4: ; 9 I?<-.?: ;9 'I<. 1U/ 10.?: ; 9 '<1 2.: ;9 ' 31RB UX!Y!W!44: ; 9! I5 :! ; 9 I6:!;9 I7: ; 9 I 8.?: ; 9 'I<9.?: ;9 '<:.: ;9 'I ;.?:!; 9 '@z<&I=GI> !!: ; 9!? :!; 9 I8@ :!;9!I8 A4:!;9 IB.?: ;!9 '<CD.?: ; 9!'<E F1RB X!YW G1 H I:!; 9 IBJ:!; 9 IBK4:!; 9!IBL.: ; 9!' !M: ; 9 IN.: ; 9 'I !O.?<n:!&;!P% Q$ > R S : ; 9 T : ; 9 U&V IW5IX  : ; 9 Y : ; 9 I 8ZI [ : ; 9 I 8 \4: ;9 I?<]  : ;9 ^ : ;9 I 8 _!I`.?: ; 9 '<a.?: ; 9 'I<b4: ;9 Ic.: ;9 '@zdH}e1RB X YW f1RB UX Y W g4: ; 9 Ih.: ; 9 'I )*STSTUmUVSVWmWWSWWSTTq#8UU8UUUVWW8WWq8WWq#8UVjVVSWWjWWSUUjUVnVVSVVnWWjWWSST0WW0TT0TT q03%WW0UU0UU 03%UV 83%VV 83%#VV q83%#WW0VVSVVoUUjVVSUUSUUjQRSRRlRSSSSlSSSSSlQRTRRnRSTSSnSSTSSnQRURRmRSUSSmSSUSSmRRoRSSRRnSSnRRoSSSRRnSSnRRSRRoPPSPQnQQSQQnPQoQQSPPSPPnQQnPPSPPsoPPQQSQQPPoQQSPPmQQmPPSPPoLMSMMSMMSMNSLMTMMTMMTMNTMMnMNSMMSMMnLNLMSMMSMMSMNSLMTMMTMMTMNTLLSLLSLLTLLTLLSIISIJoJJJJSJJSJKoKKSKKSKKoKKSKKSKLoLLLLSIITIJnJJTJJTJKnKKTKKTKKnKKTKLnIJlJJS@KLlJJSJJoLLSLLoIJlKLlIJ KL JJSKKSJJ KL JJ KK JJSKKSJJ KK IIoKKTKKnKKTKKnKKSKKoGGSGHoHHSHHSHHSHHSHIoGHmHImGGSGGoHHSGGmHImGG HI GGSHHSGG HI GG II GGSIISGG II EESEEoEESEEoEETEETEEUEEUEES??S?@m@C`CDSDDmDDSDDmDDSDDm??T?DnDDTDDnDDTDDnDDTDDn??U?ClCDUDDlDDUDDlDDUDDl@@o@@Y@@"@C"DDS@@ "<%#<$@C "<%#<$@@@Co@CS@Cm@CT@@@AoAAzAAzAAzAAzAAzAAzABSBCm?@kDDk@@S@@o==o<< == <<S==S<< == == => ==S==S== => SxoxSo4  ,4SS,4  X  `SS`  77S79n99X9:n::S::n::S:;S77T77U7:j::T::j::T:;T77T77U7:j::T::j::T:;T77S79n99X9:n::S::n::S:;S7:o::o78S8:l::S::l88188U88o89033S35n55X56n66S66n66S67S33T33U36k66T66k66T67T33U33V36U66U67U35067033U33V35U66U66U67U33T33U35k66k66T67T33S35n55X55n66n66S67S36o66o34S66S66m66x66S66m34134U34o450//S/1n11X12n22S22n22S23S//T//U/2k22T22k22T23T/10230//T//U/1k22k22T23T//S/1n11X11n22n22S23S/2o22o/0S22S22m22x22S22m/01/0U/0o010--S-.n..S..S./n--T-.m..T..m..T./m..o..o..Y..n..x..Z+,S,,m,,S,,S,,m,-S--S--m+,T,,T,,T,-T--T--T+,T,,T,,T,,T--T--T+,1--1+,S,,m,,S,,S--S--m+,0--0,,n,,S--n,,Y,,Y,,S,,m,,S--S--m,,S""S""o"#S##S#$o$%S%'o''S'(o((S()o))S""T"#T##T##m#$T$%T%&m&'T''m''T'(m((T((T((m()T))m))T""U"#U##U#$n$$U$%U%&n&'U''n''U'(n((U((n()U))n))U""U##U#$n$$U$%U%&n&'U''n''U'(n((U((n()U))n))U""T##T#$l$%T%&m''m'(l((T((m))m))l""1#$1$)1""S##S#$o$%S%'o''S'(o((S()o))S""0#$0$)0""Y##Y""S$%S%&o''o((S((o))o%%U%&n''n((U((n))n%%T%&m''m((T((m))m%&0''0((0))0%%S%&o''o((S((o))o##S#$o''S'(o))S##S#$o''S'(o))S##U#$n''U'(n))U##U#$n''U'(n#$l'(l#$0'(0##S#$o''S'(o&&n&'U()U&'0()0&'o()o&'n))nSSTUTSoSoSSoSTTUlUlUlnSnnt1&T1& T1&3$s"UYYUllUlnnnT1&T1&T1&SooSSoSnnllT1&T1&SSooSSSS1SSSS0YSSSSoSoSoTnTnTTnTnn S o SoSSo T nnn S m o o S m o T n n T n S nSoSSoSoSSoSSoSoSoTnSnTnoSnSTnnTn00SooSonn00oommSSSSTTt1&T1&Y T1&3$s" T1&3$S"SSSSoSSoSo S o S S !o!"S""ST"TUUlUnn l U !n!"n""lVVV V  V !""Vt1&"T1&YY T1&3$s" T1&3$s" T1&3$" T1&3$S" T1&3$" T1&3$s" ! T1&3$"!" T1&3$S"VVV V !!"VUnn U !n!"nT1&T1& !T1&!"T1&SoSo S !o!"S T1&3$s" T1&3$" T1&3$S" T1&3$s" T1&3$" T1&3$S""" T1&3$s" T1&3$s" T1&3$" T1&3$S" T1&3$s" T1&3$" T1&3$S""" T1&3$s"VV V  V""VVV V  Vl lT1& T1&SoS S o SV!!VT1&!!T1&S!!So!!o)*S**l**S*+S++S++S++l)*T**T*+T++T)*U**U**U*+U++U++U)*t1&**T1&*+t1&++T1&**m**S++m**Y** t1&3$s"** T1&3$"** T1&3$S"++ t1&3$s"++ T1&3$s"++ T1&3$"*+ t1&3$s"++ t1&3$S">>S>>sp>>S>?S??S>>S>>oEFSFFnFFSFFSFFnFFSFFSEFSFFnFFSFFnFFnFFSFFoFFSNNSNOnOOSOOnOPSNNSNNsoNOOOSOOOOoOOSNOmOOmNNSNOo,+) $4,4<@Xh`h !!" !!" !! !!!!!!""""#$%)""""""$$%&''(())%%%&''(())#$&''(()#$&''(()&'()&'())))*******+++++,,,,,,,--+++,,,,,,,,,---...../////122///////122///033333566333333356633347777777:::777777777:::7888<<<<<<<<<<<<==<<===========>===>???@DD@@@C@@@AEEEEFFFFGHHHHIGGGGGGGGGGHIGGGGHIGGHIGGGGIIGGIIIIIIIIKKLLKKLLIJKLIIIJKLIIIJKLJJKLJJJJKKJJKKLLLMMMMMMMMNMMMMMMNNNOOOPPPPQQPPPPQQRRSSRRSSTTTTTTTUWWTTTTTTTUUUUUUUVWUUVVUUUV$ runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includememory.cplatform.hmajor_gc.hdomain.hmlvalues.hmisc.hstddef.htypes.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdarg.hstdio.hstdint-uintn.hstdint.hconfig.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.haddress_class.hmemprof.hpthread.hruntime_events.hstring.hstdlib.hshared_heap.hsignals.hcustom.h @<.@ @.p..Z.&  !! !!ST..J ..<.~ j. ]_  X  X  /J XJ1 .Z~ . YX .w  .<oXJ. f  < < <  t    t.$f.J*//<.#!("#!!#!.J.J.(  " #!#!!#!.i//<.+  !1 0/!    !1z  )$!2!  + (+$ + ( +$ ( + $  (.+$ (+$ (+$.(+$  +.$ +  + (t+$ (t+$  (+$  (+$  .(.+$ (+$ ($+ $ (+$  +.$ +  + (t+$ (t+$  (+$  (+$  .(.+$ (+$ ($+ $ (+$  < .Y< <.9   K    Y" #<U/.PI 7.F.7 I.#  >/!  /#<D< .9  K.k, " " .<~J. 9    p<. O 1 ! !JT..<<+#Ju.. t ~J.<./     .   /#~.  ~   ~p.. O 1 ! !JT..L %! Ji< .J fX1  0 !! Jv  . ~.<.< ! t=!1H.P~   ~.  ~ <J~#  0/!  X#G#~   ..2 y 'wu/~.~ 1  0/!  YJ ~X  .2y '< uJ w</~.~ 1  0/!  YX ~J  .. zu//!EM >/!  /Y/!X ~< <9. !X    z 4zz GN  : "/  ! ! J , "  &~EM >/!  /-L!=! !/4" !< < ~< <9.=J'" !<<lX EV_C_MAJOR_SLICE_BUDGETcaml_atomic_fetch_addcaml_stat_memdupc_stack_linksize_tallocated_words_resumedmark_stack__atomic_compare_exchange_ptr__kindwosizeEV_C_FORCE_MINOR_ALLOC_SMALLmemory_order_acquiredependent_sizecaml_stat_strconcatnewvalbacktrace_slotephe_info__pthread_list_taligned_memmemprofEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLEhandle_exncaml_raise_out_of_memorypthread_mutex_unlock__nextcaml_atomic_cas_field__data__prevcaml_fatal_errorshared_heapcaml_heap_stateCAML_MEMPROF_SRC_NORMALEV_C_MAJOR_DEPENDENT_WORKreserved_t__pthread_internal_listcaml_stat_alloc__ownerrequested_major_slicecaml_ref_tabledom_stcaml_adjust_gc_speedepheCAML_MEMPROF_NUM_SOURCE_KINDSslice_targetheader_tresultcaml_minor_heaps_endcaml_custom_tableoldvalEV_C_MAJOR_HEAP_LARGE_BLOCKScaml_ephe_infostat_promoted_wordsget_pool_blockcaml_marking_startedcheck_errcaml_atomic_load_fieldlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnat__builtin_memsetEV_C_REQUEST_MAJOR_ALLOC_SHRcaml_plat_mutexcaml_intern_statestat_blocks_markedPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_sdatacaml_bad_caml_state__nuserscompare_unorderedcaml_initializeEV_C_MAJOR_SLICE_TARGETcaml_atomic_fetch_add_fieldcaml_minor_tablesntables__atomic_store_tmpsigned chartrap_sp_offaction__pthread_mutex_s__atomic_exchange_ptrunsigned char__spins__int128 unsignedbacktrace_last_exncaml_request_minor_gccaml_custom_elt__atomic_load_ptrcaml_statefinal_infoEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLEdirect__builtin_va_listPhase_mark_finalout_size__gnuc_va_list_BoolEV_C_MAJOR_WORK_COUNTERcaml_lockdepthlink_pool_blockvaluehandle_valuecaml_gc_policycharcaml_ephe_ref_tablemodulowrite_barriercaml_stat_alloc_noexcextra_paramscaml_set_fieldsCAML_MEMPROF_SRC_MAP_FILE__builtin_memcpymemory_order_acq_relcaml_free_dependent_memorymajor_work_done_between_slicesPhase_sweep_and_mark_mainextern_state__jmp_buf_tagyoung_startcaml_stat_calloc_noexccaml_request_major_slicecaml_stat_stringEV_C_FORCE_MINOR_MEMPROFalloc_shrcaml_domain_alonesweeping_donetablesraw_memreservecaml_exception_contextPTHREAD_MUTEX_ERRORCHECK__lockcaml_umul_overflowcaml_alloc_shr_reservedEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKSoo_next_id_localminor_heap_wsz__uint64_tlong unsigned intselfcaml_atomic_loaddependent_allocatedslice_budgetexn_bucketlongjmp_buffercaml_update_major_allocated_words__mask_was_saveduintptr_t__sizepb_newyoung_endcaml_atomic_exchange_fieldexternal_raiseargsc_stacksigjmp_bufEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEcaml_shared_try_allocvfieldcaml_stat_destroy_poolunlink_pool_blockEV_C_MINOR_PROMOTEDgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_doneva_listtrap_barrier_blockextra_heap_resourcesmemory_order_consumememory_order_seq_cststack_handlerdoublestackcaml_minor_heaps_starthandlergc_phase_tparentcaml_extern_statememory_order_releasecaml_custom_get_max_majorcaml_stat_alloc_alignedswept_wordscaml_stat_strdupthresholdEV_C_MAJOR_HEAP_POOL_LIVE_WORDSunsigned intcaml__roots_blockcaml_stat_resize_noexcpthread_mutex_tintptr_truntime/memory.cgc_regs_bucketsincrcaml_modifyold_valrequested_external_interruptEV_C_MAJOR_HEAP_LARGE_WORDS__atomic_compare_exchange_tmpPhase_sweep_ephecurrent_ramp_up_allocated_words_diffatomic_valuetotaloffsetslencaml_stat_resize__saved_maskblockcaml_ev_counter__jmpbufEV_C_MINOR_ALLOCATEDEV_C_MAJOR_ALLOCATED_WORK__count__jmp_bufnew_val__atomic_store_ptrnitemsEV_C_REQUEST_MINOR_REALLOC_REF_TABLEallocated_wordsnextyoung_limitlong doublePhase_sweep_mainEV_C_MINOR_PROMOTED_WORDScaml_darkenunique_idallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningPTHREAD_MUTEX_RECURSIVE_NPsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listEV_C_MAJOR_ALLOCATED_WORDScaml_stat_blockcaml_alloc_shr_noexcpoolev_runtime_counterhandle_effectnbytesEV_C_MAJOR_HEAP_POOL_FRAG_WORDSallocated_words_suspendedpool_mutexephe_refinside_stw_handlercaml_stat_alloc_aligned_noexcmemsetEV_C_MAJOR_HEAP_POOL_WORDScaml_stat_strdup_noexccaml_failed_assertfieldchar_osrealloc__int128malloc__alignbacktrace_activestat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policycaml_atomic_casPTHREAD_MUTEX_ERRORCHECK_NP__atomic_exchange_tmppool_block__atomic_exchange_valPTHREAD_MUTEX_NORMALcaml_atomic_exchangecaml_plat_unlockPTHREAD_MUTEX_ADAPTIVE_NP__atomic_load_tmpcaml_alloc_shrcurrent_stackatomic_uintnatEV_C_MAJOR_EXTRA_WORKshort intuint64_trequested_global_major_slicepthread_mutex_lockwordscache_bucketatomic_intnat__elisionextra_params_areatag_tcaml_plat_lock_blockingEV_C_REQUEST_MAJOR_ADJUST_GC_SPEEDPTHREAD_MUTEX_DEFAULT__valexn_handlerstrlen__int64_textra_heap_resources_minormemcpyyoung_ptrcaml_adjust_minor_gc_speedasize_tdls_rootmlsize_tstack_infoCAML_MEMPROF_SRC_MARSHALstat_minor_wordslockedcaml_alloc_dependent_memorycaml_stat_freecaml_stat_create_poolcas_retcaml_realloc_ref_tablereservedcaml_memprof_sample_blockfreeshort unsigned intmagicexception_ptrbasemajor_refnoexcEV_C_MINOR_ALLOCATED_WORDSintern_stateHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_domain_statestack_cacheEV_C_MAJOR_HEAP_WORDScaml_plat_fatal_errorminor_tablescaml_ephe_ref_elt__sigset_tcaml_gc_phaseCAML_MEMPROF_SRC_CUSTOMEV_C_MAJOR_ALLOC_COUNTERprevPTHREAD_MUTEX_RECURSIVEEV_C_FORCE_MINOR_MAKE_VECTmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA (C AFA~R DAA dD4CEP DD O AADA~IAAV AAA~GAE AFA~DAAA~IAA AFA~E AA 0BCI FD A AFA~FAAH,BCM BD A AFA~EA`CFF_ EFC Z ACA~GEAAFBFA AAA~FAE AFA~EA@tpCFF] AAA~DAA EFC Y AFA~EAPBCQ BD U AAA~GAX AFA~DAB AFA~DAB AFA~E AA  X X`4BFY FA O ADA~IAV AAA~GAP AFA~DADA~IAA AFA~E AA |BDO CD Ag ADA~KAFEV ADA~KAV AAA~GAP AGA~EAAA~KAA AGA~EAB AFA~E AA SAA,BDN CA Ag AADA~IAAFEV AADA~IAAV AAA~GAP AFA~DAAA~IAA AFA~DAB AFA~E AA HIAALDLKACAIDCA AFA~DA8 BCN HA I DC A AFA~DA0HF ADA~R FAB ,|JA~O GAD ,JA~O GAD 0KA~S HAB lHpA~I BAA ,0C AFA~i EAA (`GA~I DAD CEA4F AFA~ GAA $\B ACA~D CAD 0D ADA~CGA CAB HC` $CBEC ABBA~SAABADA AAA~DBADAAAAA~DxB ABDDA~EWB EAA C EAD PM<CpA~D BAA 4CBC ADA~O DAA GAAD4$C ADA~T FAC FGA,\C ADA~T FAC 4 D ACFFA~U HAAFA LD AIFA~F KAAFA O KAAFA   (2(  %8Mcx"40H`+;Tnxp"XX  6 F8bPxh !l7>Ofu(\@X$px<'.ELSd umemory.clink_pool_blockpool_mutexpthread_mutex_lockpthread_mutex_unlockcaml_plat_fatal_errorcaml_minor_heaps_endcaml_minor_heaps_startcaml_gc_phasecaml_modifycaml_darkencaml_realloc_ref_tablecaml_failed_assertcaml_alloc_dependent_memorycaml_free_dependent_memorycaml_adjust_gc_speedcaml_ev_countercaml_request_major_slicecaml_custom_get_max_majorcaml_adjust_minor_gc_speedcaml_request_minor_gccaml_initializecaml_num_domains_runningcaml_atomic_load_fieldcaml_atomic_loadcaml_atomic_exchange_fieldcaml_atomic_exchangecaml_atomic_cas_fieldcaml_atomic_cascaml_atomic_fetch_add_fieldcaml_atomic_fetch_addcaml_set_fieldscaml_alloc_shrcaml_shared_try_alloccaml_memprof_sample_blockcaml_raise_out_of_memorycaml_bad_caml_statecaml_alloc_shr_reservedcaml_alloc_shr_noexccaml_stat_create_poolmalloccaml_fatal_errorcaml_stat_destroy_poolcaml_lockdepthcaml_stat_alloc_noexccaml_stat_alloc_aligned_noexccaml_stat_alloc_alignedcaml_stat_alloccaml_stat_freecaml_stat_resize_noexcrealloccaml_stat_resizecaml_stat_calloc_noexcmemsetcaml_stat_strdup_noexcstrlenmemcpycaml_stat_strdupcaml_stat_memdupcaml_stat_strconcat20$ 62(:@(X 20 20 2@2@R2V@f2j@ZXC 2@ZXC F2J2(R0V0(\ r2v28z080 228008 22P00P  ZXCf2j28r08v0| ZXC62:28B0F08L ZXC 2 0j 2 0# $ % 228"0&08, ZXC 2 0' 228008 2@2@B2F@VZZX\C 2 2h 0 0h  62 :2 B0 F0 L f2 j28 r0 v08 | 2 2P 0 0P  2 @ "2 &@ 2 @ 2 @ 2 @ 22 6@ F2 J@ ^Z bX dC  2 @ Z X C  J2 N2( V0 Z0( ` 2 28 08 0  2 28 0 08  2 2P 0 0P  , J2 N@ 2 @ 2 @2@*2.@BZFXHCh 2@2@2@ZXC( R2V@fZjXlC 2@22(0 0( *2.28608>0@ Z2b2(j0n0(t 228008 22P00P 228080 >2B@2@2@2@ 2@&Z*X,CH 2@2@2@ZXC 226@FZJXLC 2@22(00( 228 080 *2.2(60:0(@ Z2^28f0j08p 22P00P 228080 2@2200 2@2200  b2f2n0r0t ZXC4 5 ,# <$ `6 p7 ZXC4 5 ,# <$ `6 p7 ZXC4 5 <# L$ p7 2(@(; 2(@(20< 20$ 6>Z:2(>@(B>XD>C? >C>C 20 20 &2(*@(D; T ; 2(@( ;  "; "22"62">0"B0"D "R2"V2"^0"b0"d "A "6 "2("@(# ; # #@; #`6 #2(#@(#2#0# # $? $8? $v2$z0$| $2$0$ $2$2($@($0$ %  %8F %H %pF %; % %; %2%0% %2%0& &  &<E &X6 &2(&@(&; & &I &; 'LK 'V2('Z@('l; '| 'L '; (,K (62((:@((L; (\ (pL (; (6 ) 2()@(); ), )@L ); )6 )2)20)0)00) *XK *|K *K *2(*@(*; * *K +L +d; +6 &3& 30&83H&P3`&ph3x&P3&3& 3& 3& 3& 3& 03 & (38&@3P&X3h&p3&3&3&3&3&3& 3&3(&"03@&"H3X&#`3p&$x3&&03&&p3&'03&(3&(3&)3&&&)&    &*/L= (DWcj 3qqx *y o`z4 )I6C5P\]jw  U) N! - 9wJ[sy ~ O dd)  ! 2Ygu eVf   k A+U9GUAcSq  Msi "i %d1=RI Uba m i P d ?#+/;:GoS6_k Vw 4< d?& ?1Wdqf~k bc0d   ( z:G qZtd~q=     | ! ' -; 3 t : F R ^ jz w  j  d r       4 j N [d hr {     j  d r 0 , 3 8 D l r x ~$    f   M I    6  J   4 :N @ " F L R X ^' di j< p v | t  : !       s j         1  4 A&( J[ W& ` r    /A Xyq G  i?J&)jn t WI&*`&*&*"'C+70&*W[`&+x&+&*  &*&*&*&*2&+lG&+W.b&(dLUI&)&) "+&)DHM&)$e&)0z&)&)&)H&)&0& Y&("&+6: C&( L]#afoCs9|qm&(@&(H&(T&(`&(&(4,&(xN&(\w &&p m&&}%&&>BG&&_&&t&&&&&&p]$"91d\ &&0%).9=B&&@b&&`p {&$`L  &$ &$', 09&%B7S/W+`Bd>i&&z&&%&% Bgc&%(R&%& &%(&&$/&$KOU&%@s&%L&&&%&%&%&%#&%x1<8&#X\atLxH&#a[&#{w&#&#"'&$8&C&#\&#equ~&# #&$&&#&$&$@L, 57&"XL\Dalppl~&"&"&  & V* F/j: > C(N R WVj n }      a 7 '&   }&!X   &"F3 7 @& Y ] b& {& &"&"L&&&"l&&0&LK&Xa dh&   &&  &,    &&!&,:&C+O "S \&e;v Gz C Z V&&&K&&& &  { * 2& S W { `& i z ~ &,      & & &, &X '! ! !&`!3!( !, !5 /!9 +!>&!O&!Z&`!pS!!&!! _! O! ! !&!! " "  :" *"" }"  y") "- "6&"?"P "T "] "a "j "n "x&\" " "&"&"&D"&T#&x#%#0&#G#R #V #f8#j*#o#zz#~p#&#s#######A#3##z#v###&#$ $ $$$#$'$1&T$J$N$T&$y&$&4$&D$&h$&x$G$&%%%%-I%1;%:&%C9%O%S%\%`%i%m%v%z%N%%%2%&%&%h%a%_%l%j%v%t%&T%&~&&&*&&M&4&i&D&&h&&x&9&&&&'' &'/'3'A'E'J&'h'l'u&$'~)'' ')'''%'#'&'&|'&'&'(&((=(,-(1 (<(@|(I&(R(^(b(k(o(x(|((O(K(f(`(&((((|((((&)&)&)%&P):)>)G)d ])q )~)&)&)&)})& *** *(\*,:*1*<*@*I&D*R,*^*b*k'*o*x{*|u***,***&D*A*A***L*/*!*&*k+ m+a+++$+(+1+5+>&+G&+X&+u&H+&(+&+&+&8+&++9+/+&,g,],, ,*&,3,?,C,L,P,Y,],f,j,s&,|&,&D,,1,+,Q,M,f,b,,y,u,&,&x-&8-&-/&-@&P-M&-_&P-|&-&(-&-&-&8-&-- ].  ..%.La.Yv.e V.v.{.& .....& . .& /// ]/&/*/81/<%/Lg/P_/U/`/d/i& $/~[///////& /x/x///& /00000!0!0*T0.F07& D0@& D0U& 0^0k0o0x0|00000000& 0& 0&80&0& 1 &P1&1+& 1H& h1]&(1j&1z& 1&81&111 ?1& 111& 1& 2(2&2!92%12.^22\2;& 2D& 2`& 2zi2~g2& T2u2q2222 ]22253 33&373;3K3O3Tb3h!3l3q&3& 3&83&3& 3&P3&3& $4&h4&4& T40&4=&4O4V&P4x>4|04~4v4&4&4&84&44&p44555&54&5K&5X&45i&85v&5d5&55%55&T5&85&5 5&66X6L6&6(&865&6F 6L&6l6p666&6O6 666"66&6<6E6;6m6i66~7&d7&d7%&7.L7@7D7M7Q7Z7^7gW7p7t7y&$7&7&87&7&7&P7&7&8&d8%&(82&8B&8S&88`&8t8y88 8G8 88w9 B9%C969A59S 9^ :9j9v"9b9 99599& : ::' ):+ %:4 ?:8 ;:A& :Jm:[m:i Y:m W:x& : e: a: : :& 0: : :!7:!3:!_:!I:!:!:!:!;& P;;;-";1";<;I"9;M");V&;_;k";o";x#;|#;#E;#=;#;#v;&;&;&0;&|;&(;&<&<&8<&&<<&H> &8>-&>D&>_&>c&>l&^>p&V>y&>}&>&>&>&>&>&>>>'>'>>'*>'>&`?'? '?& ?1'?5'?>&@?W'?['?a&?s&"?( ?'?(4?(0?&"?l?(M?(C?&#?(w?(q?&#@ &# @&#H@,&#h@>&'0@Y(@](@f(@j(@s(@w(@&'`@@) @)@&'h@)@)@&'t@&'@&'A &'TA#&'ADAH>AMAQ+ &!&I&Y&n&~&&&&&&&&&*&:& & & & & )& 9& a& q& & & & & & & 5& E& &&HpxP $ 8   00 L4d ""$#$&0&p('0`(().symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @+ @,&,(,,(012,(9E-h@@"0O0 J@(`T0f0AVa@)@ rrx).@0@0-$@80{0] @P hmemprof.bd.o/ 0 0 0 644 175432 ` ELF@@||ix88!A(Dd8*j})JN!A(8!p|N ``## N ``||x9@9?t} !Aa!!_@;lxxJj`X```I |Bx}E*xUH,|2}*x}J:x|*xTX> IB=B}>P<9)h=B8y);l=B9)F})x=B=B =B*#!p`Bp` *p`BApUI~}Jpe)?}Hv9!p((yI`9)})Sxy)$`Bp1z@}ISxp!x;:`Bx`apC:bz P:Bh; ?B?b>?;p{9;Z;{:;H|>@< AX9 y)LA@LAALAAp^|>@p`B!p< @9 ?x8!!Aa|N ```(^p`B!p})xK8`8~xxH`KP ```!="|x #@)ɉ L@@؁?x( @AL9Iy)H}?J_xx,?Ah9 y)|?H@A8!xN ```|xH?x|9Iy)H_x}?Jx,?@|<})i ,;A ;|)@;|)@;> ;|)@ >0|)@0|'@;0AHax>0(|=H@A> |=H@A8!x8H|< ||=H@@@|<(y)@4,$A(?xIi}IIN!A(8!8`|N ``!|x#q)#(@xy#,@L?q*@,=BJJ|)P@@=BJJ|)P@A8!xcN `8!8`xcN ```=@&yJ}*P9@|<Sx(8!x!Aa|H```:z$~xH`|{yA(88{hH`si@x;[?p()@:|)@@``hH`9 `?h?ps:A``<9 9@~h>8>0>(> >^@H`xH`8!|N |dx ,)@8>(9@^U)U)a)>(}]*;(|:H@@[(?x!Aa8!|N <H@@(0K``qJA(Ax'Al8Kh K``0x9 KP```988}9KxiH`a9,)APY99 aJCY(*@0``H y&$9)aJ}F9*Y|)P@A#xH`K}'@*q)A<A`,<A<, A4?|)@A8!N ``<P,)A|I}Jt( A`I}Jt, @p)=B ɉ AXxH_}*@P})t|)@@H cxc$H8`9 8|<PH<P,)@`_```|*@@<A<HH`8!|N ``xHHH`8!|N ``<,)AP,>A`,<A<, @>Q, @@;`;@8!x_AaN ```|=")| H@L,,)A xH>`,)A9@;I~H~H`xxxH_,AxxH>`,)A9@xIH~H~H`8!x_|AaN ``!x;<x%xxH_,@x#xHH,=A; H``@,=A=8,)A)})t( AL]0=|*H@@xxxH?_, A!x};KxK```=8xH=8,)@Kx`!xK``|<|,>@`|<`K```<`K\!A|3x|zxa|#x|+x?!Aj?,)A,?A|=@AL`,>A>, A$8!!AaN >P,)AI}Jt( AI}Jt, @|x=B )ɉ @x8!!Aa|N `|<@ApA ?;J|=@@?@) L@@Ё?x( @@xH?x9Iy)H}?J_xx,>@@<PH>P|,)@K`|a?}&|}xpj|#x!A|3x!^0,:A:,/!0AL/`,1Ah9Ap89 Z9A9!A9A!!!!xp`PA,>A^, A<I??".;:q:z;:;;9oHoH`9/pA8@A0H! 9/h!(~\x```;xA ;:~P|.@=":@H@```9Iy)H}/JOxIx,:Ah|:@AP}pP|0p@t/@:R) L@@H/x( @@}{xH/x9Iy)H}/JOxIx,:@8xx}pPH`|0pA,2@,<@,0xA8@H@`,.Ax!0|5H@A ~ex~$x8aH!P!`B!, @~jH88`H`H`?,)A I }|(P@A|= A10,)@~cx8H/`,)A9@}{xIHoHoH`!a, @!0XhAxa!:8!p!Aa|} N ``/`x), A/@ (Fi|ct|cH`8|zxH`,:|vxA,sI89 A h,'9 `A8{JB}Ih9I}H*a}I*9)h}P*a}Q*B/p()@{H$|)@@A8~cxH,#A01,<808|#x01~~ )*})*I (U>a0 (@`KL``8x~xH`K``8x#xH`K|=A10,)@~cxHK,)A(I9*HP,>tA0o|>@@;`}{xH/x;|cJ|>@oA;,;P@Xj~,#Ah,?@PjH|,#ApH`!0:8!p!Aa|} N /p()@HohH`9 /h/pK,<P8~H^P,*@KTH```|!,?Ax8`hH`,#AP99 9@##@##H#@#8#0P#(XC ?X#`X8!|N p<|~x`,)AW>, A<~H~H`8!|N ```xH~H~H`8!|N ```<`KX```<Ad>`,)AxxH,#A> ,)@\XA,?^@}ISxA$?0,)@_P`,?@>@,)9@@^xA)=B ɉ @j,#A jH},#A(H`xHxH|a8!Pa|N ``<$L@A=")K``<A$`,?AX?P,)A4I}Jt( AI}Jt( AL)})t, A8!8`N `8!8`N ```|9 8?PH?P|K``|9 8?PH?P,)@|Kl|<@`|<,)A,>A`,>A~P,#A#})t( Al#})t, @|j8H`~,#AjH,#AH`8!8`|N `9 8~>PH~P,#@`K```<= 1One_log1m_lambda(domain->entries.config) <= 0.1 <= resres <= Max_longdomain->currentIs_block(e->block) || e->deleted || e->deallocated || e->offset!e->alloc_young || e->promotedrunner->running_table == esrunner->running_index == ies->active <= es->sizees->young <= es->sizeruntime/caml/mlvalues.h((value)p & 1) == 0Is_block (block)lockunlock!thread->running_table*pes->config == CONFIG_NONEe->callbacks == CB_MASK(CB_ALLOC)e->runner == NULLe->callbacks == 0!e->runnerfrom->config == to->configrunner->running_table == fromes != NULLi < es->sizee->runner == threadIs_block(v)Tag_val(v) == 0Wosize_val(v) == 1e->deallocated || e->offset || Is_block(e->block)Caml_state_opt != NULLdomainparent->memprofstate->memproftrigger >= state->young_starttrigger <= state->young_ptrCaml_state->memprofthreadsampled_words >= allocated_wordslen < Max_longsampling(domain)encoded_lens == NULLCaml_state->young_ptr < Caml_state->memprof_young_triggerCaml_state->memprof_young_trigger <= Caml_state->young_ptr + whsizedomain->current->suspendedalloc_ofs == 0trigger_ofs <= 0new_entries <= allocsentries->size == 0thread->next == NULLGc.Memprof.startdomain->entries.size == 0thread->entries.size == 0Gc.Memprof.stop: no profile running.(status == CONFIG_STATUS_STOPPED) || (status == CONFIG_STATUS_SAMPLING) || (status == CONFIG_STATUS_DISCARDED)Gc.Memprof.discard: profile not stopped.Gc.Memprof.discard: profile already discarded.?=h8qN@gH?1r?^_?jRO)rSint*J,-QTEQf y  W ZQ l mU,V  T T&Qd"Q = 3 5# 6# w 7w(& r J r J  r " _ # _ $W(C Q@E@FQ@G &a"Q'H& rXO2JX8#NE #2#9 ; Y<,>,?J :&J"Q?Z" "% ((+0. 82@6H9P=XA`ChF,pI,xL,P,T,[,` r,tw,yH{R}\  a ,,,, r(s0k8[idr@rHP.X.`,h,p x  u,,, ,r  z. * *  E F G 8 H /p * @H H         * M* W * f* p* z@)jmpA P BH C) \=z?H sL8HOPRQU XX `[ah\ pc JxAf `xAg xAl , B&J;22 b$j kr l ;2,;3,85 R 5 R)end5 R 5 R)ptr5 R 5 R 5s( 5s0 7 8  9  : 8< < )end<  < )ptr<  < <s( <s0 W> / ? )mem@ )maxA 8C C )endC  C )ptrC  C Cs( Cs0 :& "QB* & "Q?F   G! rG"d]  )"QBF F. P^buf/ ) 62J n U H  )2J y" 3h! 7%) - 1 s4X8 `2J0 tha_!r2J B      D,E F N F N F N;H! Z30a     +J@+B+C+D+E+F+JG+JI#o"n #p3@It a "  ( 0 8#p& #q4z3Ho8q st8@#tE &`"Q"Q?&,p"Q?$x8 ${ t $~ #i ` a #n H  3 8If z n aZ ][\]&lbQ#]y 84, ) Cb cf4- ) '$  '4 .<. .Cd C[, d#?JJL B '+l m 'a  s'    a < '!)  '  ',  'Z / s4SA ' \ s<C rs s ae  r< r s4"h 4#F Je   r -  +  ,  ~ST5~ST5S T U S S - (     ~T3a a Z@ [ZRZ` ZrZS4 sS` 1 S S T U S T U ES T U xS T U S T U -J /Z@ SZRZ` ZrZSZ@ ZRZ` ZrZSS T U S T U S T U -Glv)szv3 >GH$~r$$$~r .sz   . 54i r 5a 'a SS6S  SSS S9T0T1   4 SX+S 1 V]SO5uSS T U  S T U S T U NS T U S T U S T U S T U S T U  9S   H%_ < O/O)O 1 O5S 1 S T U QS T U %H = hS=RBSS-  I PS T U S T U S T U -  HSZ` SlSy` l`8`+`ShS T U % - (, 4r $r ;-GH   ,Dres~$}r$~$}r      DI$ S#SSSS"SS T U 3s#33,333(3d@SVW0 1 #S T U $S T U $FS T U $yS T U S T U ' ! '/( )?(&v????7?%z?@)%@D@76@)k @D@7 /&(T~U~V $ &&EST0S T U ^* _7_*___^^^_D_N_YST1S$SST'|S'STU 'STU STU (MikelaS T U n3(33>33Z@ZRZ` ZrZSO){O)O 1 S T U QaI)aO{*FO)OO5)S 1 S T U Qa} *|a *S T U 7*S~TU4*S3T1 ,h+ST[+3S+fS T U O+S T U [+S T U +S T U ,2S T U ,eS T U 6,S T U ,S TU ,S TU -S TU -HS TU -{S T U 4-S T U 5S T U [ <%1 & ' ' $r3/33>33Z@ZRZ` ZrZSS0uSSSS0DSST/S/S T U 0S T U S T U S T U 3s133333(3=d@TSVTWV13S T U 1fS T U S T U %3s 2 542. ,SS3233>33Z@ZRZ` ZrZS3S T U 3CS T U S T U  30%3&src2r 4 ,  -] 7_a rescfendoty85es{Z`| 4ZrZS7STUX(f5X,(X9.XC5qXHXTgGSOg6O)O 1 S T U QO6O)OO56RS 1 S T U Q76STUV6S76STUh7ST7MS T U _7S T U `S T U b8$l;F % es%&res';1. i0 e1 a8cbG ;STUZ`.8ZrZS;F9:;q,;e,;X;|;;?:i?((?5?Ag?M~?Y7?9?.?e:8?ja+9a=.?vX: ?w:#T0/SS T U :S4T0;:STUVYS T U 6^0= ^^^](S; es&i1e a  8?  es icb    ,e ares=pv ai<ay9aaa= S T U =@S T U S T U Z`=ZrZSa=a^>Y^^^S T U >STWUX>S T U >S T U S T U ?&GHrK?l i ?4@r res  i~@)~7res  lk @Rk6kE%N@ N4 O@S T U P O%6DO 61 719O9BxOOO`'A`8`+`SZ1BISlSy`B3`8`+`ShBbS OSV.HCVIV<VV9VbVc9VmVnV{)CEVVV{, VVSKCS6S SSSDS T U AS T U B%&E &5(X$,EX,(X9.XCEXHXTgGSKgEJST0U V0W0VEbSLO5S T U )8 lGXe1a :`F F`VM`a^`{`qhaiR Fay9aaaM`R``G(S T U S T U %H 5X$HX,(X9.XCH XHXTgGSKgH[ST1U V0W VHsSLO5S T U !HN5SN1T Ie1a:%Jf. z 4 n $ 1 #$X$JNX,(X9.XCJ9XHXTgGSKgJST1U VW S T U !XK+es+ 5K+:US#8  Kge a)K+!L 3 @f/ 8 1 ot8LL=STUVWLLmSTUVWLSTUVW!{HM {- {;f|0 |9 }2 MYi:TZ`MZrZS:ST%^Os^)O`NO),O 1 O5N<S 1 S T U QNS T U _NS TU _S TU `O O5O/sO<!@O @; S T U BO:!1 !RB - 5 PW RBXQXX`Q``Q a`xS S7XQGXX```Qa`xS \S_R` /XR S //S!,SU - pSU_<R` //RSS%S T U S T U   S8 ,S,len<,res , S(,T+res ,!qUt q)s 5DAx Ut}DBy U{Ti| rU} ,V ,UVV#U"i rUU(UU(Ui rf .STU &U"Q?&5U"Q?Z5UyZ'i\UOf5Oiu\!Uexp^ 5x` 57V.74i7@rres9 t: % V{%+%<' i( r t)Vx0Vz !W 5pWot88 Z`W|ZrZSXWX_W` / /ZS 8 Xot48 X|,pWKXaX|, X|,  X.ot8 X|,8 Z@ -  es ot8`Y`8`+`[YS](YSYSH_YYSThZ SThZ+ST/SZ`- zZesz)I ZI(toI8U iX _ !8[es8.5[mi;^=^^^?]([SSS T U :!4](es-]i e! a^. \^^^S TU \S T U %\S TU ,S TU -=](SS!<^es%i j ] ]S T U S T U ?_Y^SST0^MS T U ^S T U =_YSST0 ^es$i/e a_Yes($1%4"r/#i e a8 _es& 1   aAT0 `es% `Fes$/C/]r`a0v]#/Qr`0vQ&0sQ0 N/Mr`0hdM(0sM3 N`m4` t`m;`a(err4r/a+PG1aKval1!,aip,!/+a0val8 QX|Q,/traPtE1SxbSSTbSb9S T U blS T U S T U 1K0cEKBKMKZK00 c4KMKB(KZ:U:U1H8d@HIH dIH6ai ay9aaaS T U 13sPgG333333?fD?@@@)ed@D@7@)k @D@7 /7@f @aK ea]S T U .leSjSUxf S0TUV ^` f_7,_*___^^^_D_N_YST1?O5gSSS T U 1X hX,X9`h ``ga`xS S.Xa h>XbXn```ha`xS \S1Z\jZZZZ`N iGZrZSZ`O iZrZS7ZjZ>ZZ^\j$^,^^S T U jWS T U bS T U a_YjS?_YjSST0S T U Pj$I~1BH}H}41B4:!;9 IB1RBUX YW ( I :!;9 IB : ; 9 I8  !I H}: ;9 I :!;9 I8  : ; 9 I 8 : ; 9 I :!; 9!I!84:!;9 I4:!;9 IB U: ;9 I4:!;9 I.: ;9 'I 1RBUX!YW $ > :!;9 IB U.: ;9 ' 1RBX!YW  : ; 9  !.:!;9! '@z"!I/ #: ;9 I$4:!;9 I%.?:!;9 '@z&I'.?: ; 9 'I<(41) : ; 9 I8 *<+ :!;9 I k,1-.?:!;9 'I@z. 1/.: ; 9 'I !0: ; 9 I1.1@z2>! !I: ; 9 3 :!;9!4.?: ; 9 '<5 61RBX!YW 7 1U8.:!;9 'I@z9 1:H};4: ; 9 I?<<.?: ;9 'I<=H}> 1U?H}@ :!; 9 IA :!;9 I8B: ; 9 I C.?:!; 9!'<D4:!;9 IE&IF !!: ; 9!G :!; 9 I8H'I :!;9 I8!J.?: ;9 '<K LH}M1RBX!Y W! N:!;9 IO :!;!9 IP: ; 9 IQ4:!; 9! IR% S$ > T UGIV : ; 9 W : ; 9 X&Y5IZ  : ; 9 [ : ; 9 I 8\ : ;9 ]I ^ : ; 9 I 8 _4: ;9 I?<`'Ia : ;9 b!Ic.?: ; 9 '<d.?: ; 9 '<e.?: ;9 '<f : ;9 g41h1RBX Y W i : ;9 j.?<n: ; 3fSoSȞSȞoSSoSo y $ &Z۞ZZZ0ܞ05ܞ5S؝SĚnĜnĚn̛nS̛0ĝ0̛3ĝ3Sĝ˝S̚n̛n̛̚SSSSnnnĘnؖؗؖؗԙԙSS˔q#0TT˔q#8UU˔q#@kkԔk0Ԕ00Ԕ0Ԏ  Еߕ Ԏs1&s1&Еԕs1&ԕߕ1&Ԏێ!!nnnЕnnooďď4ď`3%#X3%#SSSnԒnԒn܊S܊oySS܌oo܋oon܋nnSoSSSSSSos؈ooS܉o܉SSSS܇n܇SdžS#ȆSX@snoSoumuwSwzmzzSz|m||S|}m}~S~mSmSm؁S؁mSmSnoTopopToToToTnoUoppUUq#DUnoVowkwwVw|k||V|kVkooYov~w|~||q~|}~~~~ÀYÀ~~؁~ow_w|_|__owaw|a|aȀaaoww||ouuwS#wzzzS#z|||S#|}}~S#~S#؁S#؁S#S#p00p00qt^tv^wz^|~^^؁^^^qs`sssv`wz`|~``؁```rr0rwewyezze|~ee؁eԃeerrrtltvbwzlzzb|}l}}blbԃbuv.zz.}}..uu~0.zz~0.~0.{{nnȅn{{__ȅ_{{0{{o{{Z{{o0{|0~~0{|m~~m{|s#~~s#{|_~~_suowzo|}oooԃoss0stbwzb|}bbyzfzztwxjxyl|}ljwy_|}__xxSxyj|}jxySyyf||S|}fxx0xx1||0yyj||0yy_|}_|}j|}_yz1yz0yzbyzoyzfyz`yzyztyzYss_st_zz_ssjttjzzj}}0}~bb}~oopp___ppnnnZZnnqr1ԃ1qr_ԃ_uu~ vv0؁0vv_؁_vv~ vw ~S ~SggSghjhhShijiiSiiSimjmmTmmSmnjggTghkhhThikiiTiiTimkmmVmmTmnkggUghmhhUhhmhiUiiUilmlmUmnmggVghihhVhiiiiViiVimimmWmmVmnighohioimommSmnoghohhonnoghnhhnnnnhhYnnYhhnnnnhhnnjlmllUmnmnnmjlomnonnojk0kklkkklllllllmnlnn0kkoklomnokknllnmnnlmimmWmmVnnilmkmmVmmTnnklmlmmUnn0lmjmmTmmSnnjlmommSnnoYYSYYoYYSY\o\\S\\S\\oYYnY\n\\nYYmY[m\\mZZSYYnYZnZ[nYYlYZlZ[lZZY[[YYZlZ[lYZZ[`anacncdnegn`alablcdlegl``s`aaasacccscddesegcdmccmcdmcdmddmaanad fg aaYaa1fg1aanfgnbb0ff0bbnffnDDTDEjEETELjLLTLLTLLjLLTDDUDEoEEUELoLLULLoDDsDEEEsELLLsLLDEYFFYHIYIJYJJYDEnEE0FHnHInIIVIInIInII(ILnEEmFLmLLmIIWDDoEEoEFoFHnJJnJLnFHmJJmJLmGHSHHXJJSHHWFGhLLhGGfJKfGH0JJ0JK0LL0GGJJYJKiJJyJJ~JK0KK1KKYKKyKKYIInII(IIoIIm<<T<=T==T=@n@@T@AnABTBCnCDT<<U<<[==[===>U>@k@BkBDk<<V==V===>V>@j@BjBDj<<W<=W=>W>DW<<X<=X==X=>U>DX<<Y<=Y==Y=@l@@Y@BlBBYBDl<<Z=>Z>AmBCm>>f >@i@@fi@@  &i@AfiAA  &iAAs ABsBDfi?@iCCi??i??x??Y>?k@Ak??fi?@iCCiAAjCDjAAkCDkAAnCDnWXSXXoXXSXXoXXSQQSQUkUVSVVkVVSVVkVVSVWkWWSWWkQQTQUlUVTVVlVVTVVlVVTVWlWWTWWlSVoVVoVV0VW0WWoQQTQSlVVlQRSRSoVVoSSSVV0RR1RRRRsRSoRSSSSZSS@SSsSTUSUoSTUTTYUUUST0UUZUUYTUTTYTUWUUZUUUUUUU uN%u'sUUuN%u'suN%u'sK%'tUVoVVoVVoPPSPQSQQSQQSPQoQQSQQoPPoPQ PPY S o S o S o T T T T  X   zx Y X YNOSOOSOOSOPSOOoOOSOPoOOoOO OOYMMSMNlNNSNNSNNlMMTMNoNNTNNTNNoMMUMNmNNUNNUNNmMMVMNVNNVNNVMMWMNnNNWNNWNNnMNkNNkMNoNNTMMkMN MMY S (Y(;uH;XS$T$XT$T$XT-.S./j//S-.T./n//T-.U./m//U-.V./l//V-.W./k//W..o./o++S+-n--S--n--S--n++T+,o,-T--o--T--T--o++U+-m--U--m--U--m++V+-k--V--k--V--k++W+-j--W--j--W--j--8,-o++S--S--n\]S]]n]]S]^n^^S^^n^^S^`n]]n]^n^^n S o S o S o99S9;n;<S<<n:;o;;S;;o;;o9:n<<n99o9:m<<m9: << ::S<<S:: << :: << ::1<<1:: << ::S<<S:: << ;;S n S !n!!S!!n o !!o o o !o SoSo+0zv"Vx9$T s#2% s#2% s#2%#ss  #2% #2%# #2% #2% #2%# #2%?5.?5.?5.#$S$%i%&S&&i&&S#$s$$j$%j&&j&&s#$0$%k%&S#P&&k&&0$$o$$@$%o%%S&&o$$l$%l&&l&&8$$o$$o&&o%%o%%S%%o66S67l77S79l99x99S66066n77y"77n79n66o67o88o77o7777S#78o8889o99S#78S88m8889m78X78@78S!!S!#o##S##S##S##o!"0"#Y""Y""o""X""wz"&'S')l))S))S)+l&'0')n)+n'(o((o)*o**o**n*+n**l*+l**o*+oSnSSnSSmoommkkSnSSSnTTTTTTt1$ooSSSoSoSS o SoSoS o SSnSToTToTonSoSoSSoTTTTTTooYyxZZSoSSoTmTmUhUhViViWlWljjoooSjjjjSnSnn0noonoSkkkk0lhijmgy01YSSSSsys  SS   0  SS  /0S04n44S44S45n55S55S55n55S56n//T//k//T/4k44T45k55T56k04j45j55j00n00S00n55S55S55n00k55k55k01013l45l55l22o33o45o23l55l23o55o,O""""$$$$$%%%&&$$$$$$$$&&$$%%%%$$%%%%&&&))+''(()+((***+++++--+,--005555005555034555111223455511235577789:<<9:::::::::<<::<<::::::::<<::<<;;;;>?@A?@CCAACDDEEEFFFHHIIIJLDDEEFFFHJJJLFFFGJKLLFFFFFGJKLLGGKKJJJJIIJJQQQQQRSSVVRRRRRRRRRRRRRRRRSSRRSSSSSTTTTTTTTTTTTTTTTTTTTTTTUUUUUUTTTTTTTTTTTTTTTTTTTTTTTUUUUUUUUUUUVVYYYZZ[YZZ[YZZ[]]^^^^aaaafgbbffcccecccdddghhinnhhnnhhnnjlllmnnnkkkkklllmnlllmmmmmmmnnppppppqqvwz|~{{{{{{{{ȅ{|~~~~qqrrrrrrԃqrrrrrrrrrrtwyyzzz|}qrrrrrrrrrrrssssssstttzzrrrrwyyz|}rrrrwwwy|}xxxyyy|}yyyyyyyzvv؁vv}~}}}~؆܆܋ؖؖؖȗЙؖȗЙԙԙĝ̝̚Л̚Лܞ9 runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/usr/include/powerpc64-linux-gnu/bits/typesmemprof.cshared_heap.hmlvalues.hplatform.hfail.htypes.hstddef.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.haddress_class.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.hroots.hmemprof.hpthread.hruntime_events.halloc.hstring.hbacktrace.hcallback.hsignals.hdomain.h  0>. Y3/|f g; <  3=*(!H!!! $!!+" < @ !!"!): a $  \<&&.&b..7&g  -+1.Y  XK "0&].  2  $ K+1   )& *"&@,<).!!!+> L&zX&&)zJ  /&T pZ t0" .K  00 0. !/LL.   .!<,vJZ/t s<+     /"!/,zJX  Jf /y  -A // 08] !> / ! !!. q  <.t< S 8. 9X N"  rM    /  /  < /==! "!.#!<% q f !/>/.  r ! !J  ..t?/+" JLL. g<  *(# /J $t>L   ) +.XX <. !.qJX  J+u   0 'z !M #!  z}  }<0 :!. 1 . [<$) )! fvf<0 ! &./ ! !!! ! x!R !< <.}J5.0/!.>u/   [  -/= H= } !"  ))!<sY/ J y^ !/  /#{<p.. { .{  { .! ! !{<.{!!T..tt {..<.tmz &3 {  // 0@!@3 '   ! B ! //  " 2""/< zJyxJ.|== X!J$ =.=  ! = !  .  $ <!  z .J>  2dJ@~.<#-. &2 ! t & K t! ~ !~.0 / i }  // "@3  '}   !  . w   w < .!- ~X!0Xz !~= = ! > <(X$w = /  /    .=. ! ! =<  $<  <f ! . s  /   "< Jg   "<{  .{#-.*1.K 1e !B;/!=1B 1 ./< . *x< <{/"g!! =g  2! /g 2<  {t > *..JY<,   /#-3N+  /#-3OL.? ! > X!J<PK/==  %! &t&  =. 1 ~> ! ! =<  .J. =."=."=.#9!9-,   !.","o<.. JN+  <~/ !!Q J  Z1! =/ ! "! % !/"   f  < hX./1 }  !  } !@!3'   ! 6 = ! v =  3 !! !q.=  j  < X j! }! M   2{pX. {  .{   {  .{  !|< !|=T..<! / !! 4 z  // 0@! @z 3 '   ! /=<  y..<. = /0= =. C.=..F DJ9 E!! "!-! Z3&!"w %!=  /= /0y  /#-.s %.4/=+s    /!!# X: X>4 =/// . . Jx!!"M5 w  "> ! -K !<   . i . .   i  .W w qx.-#-. !   "  .< [@x  . .<t!. . #.J.}X!1 |XJ-/-/L< wX   J2XK!1 {XJ/!.x .'K!1 {XJv/!.x..}X } }./2z  1.! z  {" z ' 3 @  !"!!! #{" /1!!{ } ! {  !@3 '  ! { ! !" "!= /-%% { w"-!"=///< r!! ..!!. .!! .   v% #!!!!o !!!)z   |/ / X<<  |.0.  << n."< }</"<< u< u Y 0!!!.*v !!!.fg!/  !V.<.= !J Q<wq  K#-. !J X%/!  ./"  .w!!"  <+J.u/. !!< t .JX,{,=,!,!,/ .  p. /#"/< J tX0/< JpX uX .X.<=Y f/=/..!/!/<<).5W.).< JY. xfJ { /+ { #/< X!./ { / ## "/< 5X.) 5W. ( !< <a + X!5 ?! x.J  t/w  /#-./L X!  -xf!0XJc .f<!</Jt{X uX uX!. .!//@ .<. A wq  /#-. t!J <>J. J.y    X<!</Jy(u( Y.%(" ^ 10 0. !!!!"2!(!2(!U.K  /&/ 0 0. !! 2#X] /"(-!2("z !  X1f J<y$/ .z} !-!"  .t===u!."!!!/== !/ K!  $ <v%      h. ..'x  % z /~ <~  .z  y ; /<}{  .y  {<J!% !%" #x.  x [0 0. !///x !x K  /&/ 0 0. !.<x /3.  1W!/B &n  x 6p"N !K+,  ".+ " + 2y '!< @ y / ## "/<p..< JJ J ..t| | > <.@$/!=./." /!."!<"  C  -/=.<u<0 !   u   u !   u. !!! ! x!R   x<}f/<<4.8 4 8 y 8 y (!( K.2-!(!2(  y y !!. ..! ./. < ..|X C : //""  t . t# K/   / ///  ! !<0.+  J0.J .}t.~wq  /#-. !J  Xu!.~   J.z u.t.=Y ..Cy ^ 3  (z. u.& t(x .t1t)ty.}!0  <q.XK /x= #!{  !!! {  !@3 '  ! { ! !"X< Y.\/!/!1><.y .g/J1.t/":"M @,2 /!. \/=!  ! y. /#0/< y0/<y uX.=//==. < =!Bz !-!=Z ! X[ 1   0%y  "" / !0 K K K =( (   -!)- 4 o<  o 1..!/@.2? "!  "!=!  w.  w/ ! X  /! .//0 .J .rX w0. "J71<'=.<tYtAX   J&XtY X %<o..J/!<.!/ /uq  /#-.#-3  K ! < ! uX !-!  uf !-!"  f.f<!</Jt /Ju<  q. X Z o   o 1J.!/!/uq  /#-. .1< /! .0t!!"   =GtY tYto..XY/ !2 J <Jp..\ JJx. > <rand_posEV_C_MAJOR_SLICE_BUDGETentry_scancaml_memprof_scan_rootsc_stack_linksize_tallocated_words_resumedmark_stack__kindwosizesourceEV_C_FORCE_MINOR_ALLOC_SMALLmemory_order_acquireorphans_adoptdependent_sizecaml__dummy_configentries_ensurexoshiro_initcaml__temp_offsetglobal_heap_stateint32_tbacktrace_slotcaml_plat_fatal_errorephe_info__pthread_list_tcaml_allocmemprofstashEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLEcapture_callstack_no_GCcaml_raise_out_of_memorycaml_memprof_after_minor_gcpthread_mutex_unlock__next__datacaml_callback_res__prevalloc_woszconfigstatecaml_memprof_run_callbacks_ressplitmix64_statecaml_memprof_startcaml_memprof_stopshared_heapweakcaml_heap_stateEV_C_MAJOR_DEPENDENT_WORKscanning_action__pthread_internal_listrun_alloc_callback_rescaml_stat_alloc__ownerrequested_major_slicecaml_ref_tableUNMARKEDHas_status_hdnext_rand_geomcallbacktrigger_ofsepheis_youngCAML_MEMPROF_NUM_SOURCE_KINDSslice_targetVal_ptrcallstack_stash_theader_torphans_pendingis_exceptioncaml_minor_heaps_endcaml_custom_tableEV_C_MAJOR_HEAP_LARGE_BLOCKSentries_evictcaml_ephe_infostat_promoted_wordscb_indexcaml__roots_callstackcheck_errlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatrunning_tableEV_C_REQUEST_MAJOR_ALLOC_SHRcaml_plat_mutexcaml_intern_statestat_blocks_markedcaml__roots_resdomainnew_entryPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_smemprof_domain_t__nuserscompare_unorderedentries_sentries_tcaml_initializeentries_finish_scannew_capacityEV_C_MAJOR_SLICE_TARGETcaml_minor_tablesntables__atomic_store_tmpcaml_plat_lock_blockingsigned charorphans_destroytrap_sp_offcaml_failwithcallstack_buffer_len__pthread_mutex_sunsigned char__spins__int128 unsignedbacktrace_last_exncaml__roots_lvxoshiro_nextcaml_custom_eltcaml__temp_valcaml_statefinal_info__atomic_load_ptrresultEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLE_BoolEV_C_MAJOR_WORK_COUNTERfromcaml_lockdepthvaluedeletedcaml_gc_policycharentries_apply_actionsthreadscaml_ephe_ref_tablelambdaorphans_lockentry_update_after_minor_gccapacitythread_destroycaml_stat_alloc_noexcextra_paramsCAML_MEMPROF_SRC_MAP_FILE__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicesextern_stateentries_clear_offsets__jmp_buf_tagorphans_createyoung_startptrdiff_tcaml_result_privateone_log1m_lambda_vcallbacksEV_C_FORCE_MINOR_MEMPROFcaml_alloc_smallsamplessweeping_donetablesfrom_camlreservemin_capacityset_action_pending_as_neededcaml_exception_contextshrink_callstack_buffercaml_global_heap_statePTHREAD_MUTEX_ERRORCHECK__lockcaml_raiseentries_actionmemprof_thread_smemprof_thread_tnew_entriescaml_atomcaml_invalid_argumentrestartedEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKSoo_next_id_localminor_heap_wszcaml_memprof_delete_domainclosure__uint64_tHas_status_valcaml__framelong unsigned intstatuscallstack_bufferparamdependent_allocatedmlsize_tslice_budgetexn_bucketcaml_memprof_set_triggeractivelongjmp_buffercapture_callstack_GCdomain_destroypending__mask_was_saveduintptr_tyoung__sizecaml__roots_one_log1m_lambda_vSCANNING_ONLY_RECENT_FRAMESyoung_endentry_deletecaml_memprof_new_domainalloc_ofsexternal_raisememprof_orphan_table_tc_stacksigjmp_bufEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEEV_C_MINOR_PROMOTEDrunnergc_regs__uint32_tGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_doneframestrap_barrier_blockrand_initGARBAGEextra_heap_resourcesmemory_order_consumememory_order_seq_cstdoublestackcaml_minor_heaps_startthread_configchildentries_clearcaml__dummy_resparentcaml_extern_stateencoded_lensmemory_order_releasefloatentries_clear_inactivetriggerswept_wordsthresholdunstash_callstackcaml_memprof_after_major_gcEV_C_MAJOR_HEAP_POOL_LIVE_WORDStotal_sizecaml__temp_resultunsigned intcaml__roots_blockfflagsSCANNING_ONLY_YOUNG_VALUEScaml_stat_resize_noexcpthread_mutex_tintptr_ttrackergc_regs_bucketsthread_createcaml_modifyrequested_external_interruptEV_C_MAJOR_HEAP_LARGE_WORDScurrent_ramp_up_allocated_words_diffallocsCAML_MEMPROF_SRC_NORMALorphans_presentcurrentalloc_idxMARKEDoffsetsampled_wordsentry_action__saved_maskblockcaml_get_value_or_raiserunning_indexcaml_ev_countercancelled__jmpbufEV_C_MINOR_ALLOCATEDcallstackEV_C_MAJOR_ALLOCATED_WORK__count__jmp_bufentries_update_after_minor_gc__atomic_store_ptrnitemsEV_C_REQUEST_MINOR_REALLOC_REF_TABLEallocated_wordsalloc_youngnextyoung_limitseedlong doubleEV_C_MINOR_PROMOTED_WORDSentrynew_sizecaml_memprof_sample_youngpromotedunique_idorphans_abandonfdataallocated_words_directaction_pendingbacktrace_poscaml_memprof_delete_threadPTHREAD_MUTEX_RECURSIVE_NPcaml_memprof_is_samplingsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listEV_C_MAJOR_ALLOCATED_WORDScaml_stat_blockscan_closureev_runtime_countercaml_memprof_update_suspendedcaml__dummy_one_log1m_lambda_vcaml_copy_doubledeltanew_tcaml_resultallocated_words_suspendedephe_refinside_stw_handlerEV_C_MAJOR_HEAP_POOL_FRAG_WORDScaml_set_action_pendingupdate_suspendedwhsizecaml_memprof_enter_threadcaml_memprof_main_threaddomain_apply_actionsEV_C_MAJOR_HEAP_POOL_WORDScaml_failed_assertentries_run_callbacks_resxoshiro_staterand_batchchar_os__int128__aligngrowsub_allocbacktrace_activeentry_update_after_major_gcstat_major_wordsmemprof_young_triggerPtr_valrequested_minor_gcyoung_triggergc_policysuspendedPTHREAD_MUTEX_ERRORCHECK_NPthreadvalidated_configorphanscaml_memprof_discardPTHREAD_MUTEX_NORMALcaml_plat_unlockPTHREAD_MUTEX_ADAPTIVE_NPcaml_log1p__atomic_load_tmpcaml_alloc_shrcurrent_stackatomic_uintnatEV_C_MAJOR_EXTRA_WORKshort intuint64_trequested_global_major_slicesample_infopthread_mutex_lockmemprof_orphan_table_sis_unmarkedscanning_action_flags__elisionextra_params_areatag_tEV_C_REQUEST_MAJOR_ADJUST_GC_SPEEDPTHREAD_MUTEX_DEFAULT__valexn_handlermaybe_track_blockcaml_memprof_new_threadcaml__dummy_lvlog_approx__int64_textra_heap_resources_minorrand_geomcaml_get_callstackmemcpyyoung_ptrunitcaml_local_roots_ptrdomain_createrun_callback_resasize_tdls_rootruntime/memprof.cstack_infoone_log1m_lambdaCAML_MEMPROF_SRC_MARSHALstat_minor_wordsdeallocateduint32_tlockedcaml_stat_freeactioncaml_poll_gc_workcaml_memprof_sample_blockshort unsigned intorphans_update_pendingafterbasemajor_refEV_C_MINOR_ALLOCATED_WORDScaml_result_is_exceptionuser_dataentriesintern_statecaml__roots_configHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tgeomintnatsamplingsplitmix64_nextcaml_domain_statestack_cacheEV_C_MAJOR_HEAP_WORDSentry_sentry_tminor_tablescaml_ephe_ref_elt__sigset_tdataCAML_MEMPROF_SRC_CUSTOMEV_C_MAJOR_ALLOC_COUNTERrand_geom_buffentries_initcaml__dummy_callstackcaml_reset_young_limitrand_binomPTHREAD_MUTEX_RECURSIVEentries_transferevictEV_C_FORCE_MINOR_MAKE_VECTmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA XEpA~KBA8DLC AO A~ MAD XxBX BD A ABA~DAH AFA~DCADA AFA~DAB AFA~DCA4BL ABA~FAA AD I AFA~EA4(lBL BD e AFA~EAH AFA~EAP`EL AAAA~NAAB BB A AAAA~EADA~BBAp<BBEABtAAIDAA AFA~EAE AFA~DAAA AFA~FAC AFA~DEA$(C AEA~]EA0P8BV BB A CD E AFA~EA@PC ADCC EA~z LAD $ EA~i DAB (,C ACA~g DAC (Bg BA A AFA~DAXHBCD AAABACBA~o AAAABAACD HABDp4BEACACABsAAAAAAABBA AFA~DAB AGA~RAC ACA~MA8HF ACDDA~j HAA 4TC ADCEA~[HA\BE AD A AABA~WH ACACA}AAAAA[AABAC A~PB ABAC D H@(C AEA~R GAC Bh B DAGA@lC ACA~EAdA^DAAA~tEI EA A AA A BABACABA~^ AAAAAAAAAC ` AAAAAAAAAABA (lC AFA~EACYAAFGABA~S A B|AAt DH zAAAD AAAAAA4C ADEA~Y GAD DA~W DAA DA~V DAB @C AFA~ECBr AAAEAA EAAAEAAA~BEAAA~D AAAEAA ,B ACA~F DAA KDA`BDO DC D AAA~sAC AFA~EAADAA AFA~D AA BA8\C ADCA~R EAC H EAC |BGS HD A AAAA~l BCAEC Aj E ICAA AFA~EAE AFA~EAE AFA~DAAA~ BDDBQ FA L AA ABBA~FAAAEABBA AFA~EAE AFA~EAE AFA~DAA A~F ABAIABC \AA ACA~EA4 C AEDGA~FsAAAA A A A A AA AAAAAAAAAABKAAFC flKAAFA A~F|T Qm ht ( DA~\ CAA AJ@ 4BJ BB A AFA~EAE AFA~EAC AFA~DCA$ xHB ADA~DDA4 B ADA~R DAD H DAD 8 C AJA~ IAC h BB[ CB A CD A ACA~EAD ACA~GAB AFA~EAE AFA~EAE AFA~E AA CA$ EA~l EAB 0 B ACA~N DAA L DAA Agnu X=0HHxR`oxl<8P  , 8#P:h4PHf{\l  ((0 ,AXo,>IZe(}@Xp6Uo 0HH`x/@O_jmemprof.centries_finish_scanentries_update_after_minor_gcrand_batchrand_geomset_action_pending_as_neededentry_update_after_major_gcentries_ensureentries_evictentry_scanentry_update_after_minor_gcmaybe_track_block.part.0orphans_adopt.part.0thread_destroyentries_clear_inactiveorphans_update_pendingentries_clear_offsetsentries_apply_actionsdomain_apply_actionsentries_transfer.isra.0orphans_createdomain_destroyrun_callback_resentries_run_callbacks_resorphans_lockorphansorphans_presentcaml_failed_assertcaml_set_action_pendingcaml_minor_heaps_endcaml_minor_heaps_startcaml_global_heap_statecaml_stat_resize_noexccaml_atomcaml_get_callstackcaml_stat_alloc_noexcmemcpycaml_stat_freepthread_mutex_lockcaml_lockdepthpthread_mutex_unlockcaml_plat_fatal_errorcaml_stat_alloccaml_callback_rescaml_statecaml_alloc_smallcaml_alloccaml_memprof_scan_rootscaml_memprof_after_minor_gccaml_memprof_after_major_gccaml_memprof_new_domaincaml_memprof_delete_domaincaml_memprof_set_triggercaml_memprof_update_suspendedcaml_reset_young_limitcaml_memprof_run_callbacks_rescaml_memprof_sample_blockcaml_memprof_sample_youngcaml_ev_countercaml_poll_gc_workcaml_raisecaml_memprof_new_threadcaml_memprof_main_threadcaml_memprof_delete_threadcaml_memprof_enter_threadcaml_memprof_startcaml_copy_doublecaml_alloc_shrcaml_initializecaml_log1pcaml_invalid_argumentcaml_raise_out_of_memorycaml_memprof_is_samplingcaml_memprof_stopcaml_modifycaml_failwithcaml_memprof_discard:2B2J0N2R0^0b2v0z2 ~0 202022 :2>2B2N0 R0V0Z0<. j 2r 0 02"2P*0P.04. f2j2 r0v0 |. 22`0`0. (/ v2z2p00p.  2 @ 2" @b 2f @2200. 2200. 3 L V2 Z2 b0 f0 l. 2 2 0 0 . 2 2 0 0 . 2 28 0 08 . < F 2 J @ Z 2 ^ @ 2 2 0 0 . 4 5 2 @  2 @ $  ` 6 7 $8 R2V2^0b0d. r2Pv2h~0P0h. 209 :Z2(:X:C@("@(*20.@08:CD; ~20< 20< 8 X8 2200. 2200.  2200. t 88 8  8 2200. 2020. 2@&0@(. F2J0R2(^0(`.  8, T  \ 4 B2F2N0R0T. b2f2pn0r0pt. 22@00@.  8 822P00P. d h =   H t8  209 2(:Z:X@(:C6@(B20J@0X;   8 8 8 2 0 < 20 < >  2 @ 2 @ | 8!"2!&2!.0!20!4. !B2!F2!N0!R0!T. !b2!f2!n0!r0!t. !2!2!0!0!. !2!2!0!0!. !2!2!0!0!. !2!2@!0!0@!. " # 8#b?Z#j?X#l?C#@ $, $ %`A %8 %2%2%0%0%. &2&28&0&"08&$. &20&@0& &2&2'0' 0'  'B2'F2P'N0'R0P'T. '20'@0' '2'2'0'0' ' P' `'2'2P'0(0P(. (>20(B@0(\ (b2x(n0x(x ( P( `(2(2P(0(0P(. (= )`= * 2* 0+  H+d +2+2X+0+0X+. +2+2p+0+0p+. , ,22,62h,>0,B0h,D. ,P -* 2-. 0-@ H-| 8-2-2x-0-0x-. -2-2-0-0-. .&2.*2P.20.60P.<. .~?Z.?X.?C.G .I / `/ G /I /B2/F2p/N0/R0p/T. /r2/v28/~0/08/. /2/2/0/?C/0/. /28/08/. 0 ?Z0?X0$?C0200@00 0G 0I 1 1  P1< `1DG 1LI 1 1 2$ 2X 822228202082. 2222P2020P2. 323 230303. 322362p3>03B0p3D. 3b23f2p3n03r0p3t. 3?Z3?X3?C4Z 24b 042428404084. 4242P5050P5 . 5625:25B05F05L. 5 25 06 06.2622P6:06>0P6D. 6 6262 6060 6. 6262`6060`6. 7272707"07$. 7D 87~?Z7?X7?C8V28Z28b08f08h. 8t?C8282`92P9 2 909"0`9&0P9*0 90G 98I 9 29 0:  0:@. : :?C:M :N ;( ;D `;LG ;TI <5 < A < =,. =L. =p h= H=?C>?C>G >I >l8 >2>28>0>08>. >2>2(>0>0(>. >?C?T?C?h ?z2?~28?08?0?. ?2?2?0?0?. ?2?28?0?08?. @ 2@ 0@*2@.2P@60@:0P@<. @R2@V2@^0@b0@d. @r2@v28@~0@08@. @2@2@0@0@. @2@2p@0@0p@. @2@28@0@08@. @2A2@A0A?CA0@A. A.28A:08A<. AV2AZ2A^0A`?CAn0Ap. A28A08A. A2A2pA0A0pA. A2A2A0A0A. A2A2B0B0B. B2B2(B"0B&0(B(. B>2BB2(BJ0BN0(BP. B^2Bb28Bf08Bn0Bp. B2B28B08B0B. B2B28B0B08B. B2B2B0B0B. B 8CO C@= C2C2hC0C0hC. D62D:2PDB0DF0PDL. Dv2Dz2D0D0D. D2D2@D0@D0D. E E(  EG EI E `EG EI F2F2pF0F0pF. F22F62F>0FB0FD. Fn?ZFz?XF?CG& 2G* 0G: 2G> 0GTU GpV GW GW GW GW GW HJ H?CH@ H 2H 0H?CH?CHG HI H PH `I22I62I>0IB0ID. Id HIX I 2I 0I2I2pI0I0pI. I2I28I08I0I. J2J28J 08J0J. J22J628J>0JB08JD. Jb2Jf28Jn0Jr08Jt. J2J2PJ0J0PJ. J2J2pJ0J0pJ. J2XJ0XJY JZ JO K ?ZK?XK?CK 8K 8L2L28L"0L&08L,. LV2LZ2PLb0Lf0PLl. L2L2pL0L0pL. MJ M?ZM"?XM$?CMx?CM] M?CMG MI M 8M2M0M^ N2N2N0N0N. N"2N&28N.0N208N4. NR2NV2PN^0Nb0PNd. Nr2Nv28Nz08N0N. N2N28N08N0N. NO O ] OB2OF2ON0OR0OT. Od] O2HO0HO^ O2xO0xO^ &3&` 30&83H&`P3`&h3x&3& 3&3& P3& 3& P3&3 &(38&@3P&X3h&`p3&3&3&3&03&3&@3&"3(&&03@&'pH3X&( `3p&(x3&+3&,3&.p3&03&33&7p3&C  30&C83H&DP3`&E@h3x&F`3&K3&L3&N30&1&2&% * c**W&*)1*s8*?*F*M*T* {[*b*g*z* X*X** U** [*Q* *K*2**Y*) ** L!*-*G*e*Ms*\x**?**i** x**=**{* **0*&;* \F*b*t**z*I****^***v*:**** */*V*:d*r* O* * **** **#* P*. *p* (* 6*D*R*G`*Xn*|*)**,**_*s***K*** "*E.*2:*F*MR*^* #j****4*b** ** ** *0*<* *,*8*[D*jP*\*h*t* *****D*P**a*s*p**5!*b.*;* N*pX*g*q*{*I* ** **h*(*c** 3*)*)* 6*C*]P*^*l***h*;* e**X***[* *5 +* 8*F E* X*; e* r* *b *1 * *5 * *F * *I *" 0*3 =* W*5 q* ~*F * *~ * * * * 2 *h * ; * **  7* b* h* o* {* * *# *] * * * * *% *@ * *( *~ **5 D* J* P*/ V* \* b* h* _ n* u*9 * * * *  * * 5 *q * * * * * * *m *j *} * *E * * * * * * $*u **8 0* 6* <*W C* O* [* h* u*j *, * H * *" * * * * I * **)*%*M4*C*R* b*&t*** *u*F* V* * *Q***n*(+*59* q*c~&(*L&*&0** ***+*C*P*zm**A****** * * -*5*NM*m*** *-*z* *-0*iB*]* y*I*[***0*k&N*Q& & $* /&3&8(A*L&P&U*Y`&d&i&O(&Ol&O\&&&O&H&O&x*&L0*;&?&D*~O&S& X*Kc&(g&$l*Qw&={&;(*&K&G*Y&d&`&M&M(&}&y&N&ML (&&'&ML1(=&A&F&M\&M t&M&M&N&&N&&&N<&8&&Nl(&P5&F&N[&8h&y&N&8&*-&K*&&*~&&&K<(?&.&*&K<)(N5&I9&E>&KX&Lb(]s&bw&`&L(s&p&n&K&L4&8&&Lt&P &&L,&p9&K*V&F`w&{&|&&*&&** o&&*-*>&!&* y*Q * c*'&:+&60*E;&U?&ON&|R&tW*b&f&k*~v&z&*K& &&G&%&&G&H*&R&N&H (&k&g&J,&H6()G&K&T&I`^&I`v&z&&Ih&G\&Gx&G&G&G&G&H&HD,&H9&HF&H^&Hv&IL&&&I&I&p&&I&8 &&J1&8>&O&JLd&8q&&J|&8&&J&P&&J&p &&J0&X:&JM*T&E@k*Kv&z&&El(&&&&&E&E&E&E&E&F&p&0&FLA&N&`*g&D~*K&=&5&E&E,*&C*X&m&e*~&& *K&&&DT3&P@&Q&Df&s&&D&@&*&&C *X&&&C<&C< &) &' !&: %&8 .&Cl 8( I&F M&D V&R Z&P c&_ g&] m&CH &C &h & * &7p * & &k * &P &> *!&!&! *!&!&! *!,* o!7&r!;&\!@*~!K&!O&!T*K!_& !c& !h*(!s& >!w& 6!|*!& !& f!*n!*!& K!& G!*Q!*=!*!& c!& _!*"& "& w" * "& "& " * "+& 2"/& "4*"?& "C& y"H* "S& "W& "\*^"g& "k& "p(d"y* "&="("& N"& H"& n"& h"("& "& "&="&B"&#&#&=##(#4& #8& #A& #E& #S& #W& #`& #d& #i(#s&?l#&>#&>#&?#&8#&#&BX#&($&$&Bx$)&8$6&$G&B$\&8$i&$z&B$&8$&$($*F$& $& $* $& W$& M$(I$*$& ~$& |$*q%& %& %&;%(h%+& %/& %8& %<& %A(h%J& %N& %W& %[& %d(%q&%u&%&<%(%&7%&3%&K%&G%&>h%&>h%&\%&Z%&f%&d%&>t%&<&)&<(&F&?&W&&d&&{&<&(&&p&&n&&p&&n&&{&&y&&&&&&&&&&&&&&&&&&&&&(&&'&' &'&'&<'4&9'>( 'J&'N&'S( '\&'`&'e&:'}&:H'&=4'&=T'('& (&(((&'(&#(&?(.&8(;&(R&8D(\(2(m&<(q&6(v(2(&[(&U((<(&x(&t(&?((J(&(&(&?((W(&(&(&B)&8) ()&) &))&)-&)2&94)?&9@)L&A)]&p)j&)&:)&:)&)&)&;,)()&)&)&)& )&;H)&;P* &;\*&@*(&p*5&*K&;d*U(*f&&*j& *o&C *}&8p*&*&*&:*&:*&:*&;,+&=t+4&>+I&8+V&+g&>+|&(+&+&@D+&P+&+&@l+&+&,&@,&8,"&,3&@,H&,U&,f&@,{&8,&,&A ,&@,&AD,&8,&Ax-&-&A-2&8-I&A-^&-k&-|&B-&-&-&B0-&(-&-*-&3.*". &j.&V.*.!&.%&.**.5&0.9&.>*.I&.M&y.R*~.]&.a&.j&3.t(.&.& .(.&-.&'.(.&G.&C.&4 .(.&Z.&V.&4 .(.&m.&i.&7H/&5`/#(/4&/8&/A&/E&/J(/S&/W&/`&5/j(/{&/&/(/&5/&//&6/&6L/&P/&/&6/& 0&0&60%&`02&0E&7,0V&0c&0z&6l0(0&S0&K0&{0&s0&0&0&0&0&0&0(0&61&41&81#&14&51I&P1V&1g&5T1x&1&1* 1&,1*X1& 1&1*~1&H1&B1*!1&d1&^1&-<2*2&|2&z2&-D23&,2=(R2N&2R&2W(R2`&2d&2m(W2v&2z&2&,2(b2&2&2&,2(m2&2&2&-2&-2&x3&3&-3&&33&3D&.D3U&P3b&3t*3*~3*"3* 3*3*3*3*~3*K3*Q4 *^4&04,*~47&4;&4@*K4K&&4O&4_&S4c&C4p&14&4&4(4&4&4&14(4&4&4&2\4&2(5 &05&050&54&5B&05[&5_&5h&5l&5r&05&05(5&5&5&5&5&05&05&3|5&p5&6 &1$6(6%&)6)&%62&>66&:6;&1@6S&1H6`&1T6m&3L6~&p6&6&1 6&1$6&16&17&270&87=&7N&27c&P7p&7&3$7&7&7*C7&"7*K7&]7&M7&7&8&8 &8(8*Q8"& 8&&84&V88&D8F&8J&8O(F8b&8f&8k&$8&"8(8&8&8&# 8&#D8(8&8&8(9&9&9&9&9&09"&.9+&#t95(9F&<9J&89O(9]&O9a&K9s&f9w&^9(09&9&9&%P9&9&9&%P9(;9&9&9&%l:&:&: &%h:$&%:9&&,:J&8:W&:j&#:&$0:&&:&:&:&$:&$; &;&;&;&;'&;+& ;2&";G*;Y*K;*O;*;*;&@;*K;&);&;&;&u;&;&<&< &<* <&;<&1<"*<-&u<1&e&>&>&>&>(> &>$&>)&!>:&@>G&>Z&>&!<>&>&>&!\>&>&>&!|>&?&?*??)*?6*?B* o?N*?Z*?k*?*?* ?*~?*?*?*?*~@*@*@** 0@8*~@E*@S* 2@Z&+@q*X@|&!@&@&,@&,L@&h@&@&,T@* @&(@*@&_A&KA*A&A&A*~A$&#A(&A1&(A;(QAL&OAP&IAU(QA^&kAb&eAk&Ao&Ax&) A(kA&A&A&A&A&A&A&)XA(A&A&A(A&A&A&)A(B&B&B&B!&B*&B.&B4&)hBJ&(Bc&+hB}&)B&)B&B&B&B&B&B&B&)B&B&B&)C&,C&(C&*PC(C)&=C-&;C2(C;&PC?&JCJ&*CT(C`&hCd&fCi(Cr&{Cv&uC&*C(GC&C&C&+C&+C&C&C&+C&+D&XD&D &+D1&pD>&DP*QDW&( Dn*XDy&D}&D*~D&D&D&(<D&(<D&D&D&(<D&%D&#D&8D&6E&(`E&(|E7&xEK&(Ec&(Ep&(E&PE&E*E&E&LE&@E*XE&E&zE&E&F&F&F&(F)&(F?&FC&FL&FP&FY&(Fc&(F&F&F&(F&F&F&F&F&,F&,F&F&F&F&F&G &G&G)&G:&GG&GY*G`&'pGw*XG& G&G*~G& +G& %G&'G&'G& CG& AG&'G& MG& KH& `H& ^H &'H &'H@&HR&H\&'Ht&'H&( H&PH&H*H&`H*(H*XH*YI*XI*,I&&I=& rIA& hIF*IQ& IU& IZ*Ie& Ii& In*XIy&!I}& I*I&!0I&!&I*~I&![I&!WI* VI&!nI&!jI* MI&&I&&I&!I&!J &&J#&!J'&!J0&!J4&!J:&&JO&'Jr&J&J&'\J&PJ&J*J&J&!J&!J*XJ&!J&!K* MK&!K&!K&<K1*!KN*XK[* MKh*Kn&K*~K&!K&!K* VK&"K&" K&"1K&"+K*XK&"PK&"JK*K&"oK&"iK*KK&"K&"L&"L &"L&0L>&XLn&L*L&L*(L&"L&"L* VL&"L&"L&#(L&#L*XL&#bM&#VM*M&#M&#M*QM%&#M)&#M.(M@&#MD&#MI&8M^&Mh(My&#M}&#M&M&M*M&.pM&$ M&#M&.M(xM&$PN&$JN &.N&.N%&/N=&/NJ&/NW&/\Nh&pNu&N&/N&8N&N&/N&N&/N&8O*O*~O6* O<&OS*~O^&$rOb&$fOg&0Ot&O&pO&O*O*hO*~O*KO* $O&O*~P&$P&$P *KP&$P&$P!&P6*5PA&$PE&$PJ&P\&Pf(6Pw&$P{&$P(6P&%P&%P&P(AP&%!P&%P&P(`P&%FP&%BP&%YP&%UP&Q&Q &Q$(kQ1&%~Q5&%zQ>&%QB&%QL&LQV(vQb&%Qf&%Qo&`Qy(Q&%Q&%Q&%Q&%Q&(Q&Q&`Q&Q(Q&&Q&&Q&R &R!&R.&RC*~RI&R`*KRk&&)Ro&&Rt*~R&&]R&&WR&&|R&&vR&R&R&&R&&R&R&`R&S&S&S&&S7&SD&S[*3Sm*~Sz*KS*S*~S*"S*~S*}S*~T*kT&T%*~T0&&T4&&T9*TD&&TH&&Ti( T{&&T&&T&T(T(T&&T&&T&&T&&T("T&'T&' T&T(-T&'KT&'GU(-U&'^U&'\U#(GU1&'sU5&'gU:(RUH&'UL&'UQ&DU*MU*<V*~V/*V=*~VJ*FVW*}V|*V*V&V*~V&(V&( V&(DV&(:V* 3V&(xV&(nW(2W&(W&(W*5W#&(W'&(W,*QW7&(W;&(WD&hWN(LW_&(Wc&(Wh&W&W(fW&)W&)W&W(vW&)*W&)(W&W&W&xX*X*X-*~XI*~XU*Xc*Xo*jX*X*~X*X*jX* @X&0X*~X&)>X&)2X*Y&){Y&)qY *KY&)Y&)Y+&)Y/&)Y>&*YB&*YK&YU(+Yf&*8Yj&*6Ys&*BYw&*@Y&*MY&*KY&hY&Y&Y& Y& Z&LZ,&|ZA*ZS*KZa*RZ*Z*Z*/Z* IZ* Z&Z&*aZ&*U[&[ &*[$&*[-&D[7('[C&*[G&*[P&*[T&*[Y('[b&*[f&*[n&[&[&[&[* [&`[&*[&*[([&+[&+\(\&+%\&+\&\'(\8&+F\<&+B\E&+Y\I&+U\N(\W&+l\[&+h\`&0\q&@\&\&\&\&\&\&h\&(]&])*b]/&]P&+]T&+{]b&+]f&+]t&+]x&+]}(g]* I]&+]&+]& t]&]&]& ]&]&]& P^& ^0& ^=&^N& ^c&8^p&^& @^* ^*^*"^*_*_* _*_+*_8*_Z*_e& _&,_&,_*_&,H_&,@_*w_&,o_&,k_*+_&,_&,~_*5_&,_&,_&_*`*`,* `9*Q`G*`b* ``*s`*`*}`*`*xa*(a*a,*aL*aj*Pa*~a*a*a*a&`a&,a&,a&-a&- a&b&<b&Pb)&b:&bO& b\&bm&b~&`b&b& Pb&-Jb&-Db&-ib&-cb&-b&-b& b& c &-c &-c&-c&-c$& c5& cJ& ce&-ci&-cr&.cv&-c& 8c(rc&.*c&.&c&.Cc&.?c& c& c&.Tc&.Rc& c&.^c&.\d&.ld &.hd& d"&d/&dE& Pd`&.dd&.{dm&.dq&.dz&.d~&.d&/d&.d&/,d&/$d&/Pd&/Ld& d(}d&/ed&/_d(d&/d&/{d&/d&/d& d(e&/e&/e&/e!&/e*& e4(e@&0eD&/eM&0 eQ&0eV&,ei(ev&0ez&0e& e(e&02e&0.e&e&he&Pe& e& f & f!& fI& fS& fo&0Cfs&0Af&0Nf&0Lf&0Xf&0Vf&0bf&0`f&0lf&0jf&0vf&0tf&0f&0~f&0f&0f&0f&0f& (f& g&lg)&g6&gL&gg&0gk&0gt&0gx&0g&g(g&1 g&1g&g(g&11g&1-g&1Dg&1@g&g&g&h&$h(&1gh,&1eh5&1zh9&1xhC&8hM( hY&1h]&1hf&Lhp(h&1h&1h&1h&1h&h&h&Lh&h&1h&1h&2Qh&2Ai&2i&2i& i(i*&2i.&2i3&iL&,iV(ig&2ik&2ip&i(i&3 i&3i(i&3.i&3(i&`i(i&3Hi&3Di(i&3[i&3Wi&j&@j&j%&\j:&jG&jX&|ji&pjv&j&`j&8j&j&Pj&j*j*&0&0D$Bo$B,&0 T&0!&0%(&%8&%`&%p&%&0%&0%&%&%&&&1&1#&1K&1[&1n&01&1&1&1&$&&`&0&"<`P`,d , PT  P L`X,0p@,"&'p ( D(+,`.p0 3 7p C 8C |D E@ F` K L N.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rodata.cst4.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @O @zO &O,O86O1@(;2SOZpJ@HTZ$aZ sZjn@  U3j@p0@h09@H0A>0^ ^( @okk . t meta.bd.o/ 0 0 0 644 36880 ` ELF@@=")iN `|A?aj!apx,<A9!p\ap8;9ap<899A8xxa89!p8cA!AH`;c|~xcxH`!px|xH`xxH`9>9@(y)d{d{dx}_.I.8xH`!q*@8x |xH`|dx8`x8H`88`H`9@8|ix8`!`B!IH`8|ix8`!`B!iH`!a#`B!AI\a8!@Aa|N 88K`<@@$8!8`AN ``|8c!xT|.<a88`xxH`8xH`,>|yxPApsp;A(|{;H`yA@``|{;;H`|{;H`7@p|>@{$})P@ps9@8xA<,'A$,'AI|3x9)I;9),>I9)A$y} II9) IIB$xCxH`!xa8`8!|AN ```!?j?,)A$)(8!)iN ``|<?|DE !:?/ " {y{{"{%{ ((+0.82 @6%H9{P={XA_`CihFpIxLPT[`rtwy{}y H(3080idH@HHPX`hpxH(2{ 8+ sp0 {1 {3 :H; . < ( id= 0 p u spw x  E_F G \8H p*d @   n  @( jmpA \BC- &!" 22P7 KLyM N  QR S T U dimV  U1:*` :?# > $! H$"$h!| r P! " # $H% J& ) >(u :| $2  5:F $#. \3buf/ 5 B   ! " # a"u 85 "5 " end5 "5 " ptr5 "5 " 53(530{ 7 \8 9 :  8< < end< <  ptr< < <3(<30 ' > ?  mem@  maxA  8C hC h endC hC h ptrC hC h C3(C30  :{ :|GACC     POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxEQyNEQz{|}~BEQ 0o1  len2 3Y{-$ HO4S {D  rH]',B%Y ? H~ J [ 3+-.Z {3h e#O Hx2envAargLosp {nsp{ i H S T US T U3S T U&*    fi /S"8 LS"8S"8 i567$%%%1 S8T U  ST0oSTp#bcp3 r cfs S S BS8 S SS T Uy6`6*7*8*: ::n~ :H;@;;;n~ ;H < len= 3 > J ? @H8 j9 S DSU ST ~ST1$# Y2ST" BIS7 'fS2T 'S2T 'S2T0S T U:+++:+?;val8< ? y= (  : ; 9 I8 I~ !I : ; 9 I 8 I :!; 9!I!8: ; 9 I H}  : ; 9  $ >  : ; 9 I8 4:!; 9 IB.?: ; 9 'I<I!I/ <:!; 9 IB4:!; 9 IB.?:!; 9!'I@zH}( .?: ; 9 '<4:!; 9!I4: ; 9 I :! ; 9 I:! ;9 I: ; 9 I >! !I: ; 9!.?: ;9 '<:!; 9 IB U!&I"4: ; 9 I?<# !!: ; 9!$ :!; 9 I8%41B&% '$ > ( )GI* : ; 9 + : ; 9 ,&-> I: ; 9 .5I/  : ; 9 0 : ; 9 I 81!I2I 3 : ; 9 I 8 451RB UX Y W 617 1U8 9H}:.: ; 9 'I ;: ; 9 I< =.?<n: ;  S l S S l T m { T m U n { U n Y Y@ [ 0 1 0 1 S S S SS SSS1&Ss~ l S1&# nnmnS i0n  #  #xnSSnnSoSo hSSq#0 hTTq#8 hUUq#@pjj00SooSnx|kk2UVTS S S,H4   A runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesmeta.cmlvalues.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hbigarray.hsetjmp.hstruct___jmp_buf_tag.hplatform.hcodefrag.hdebugger.hsetjmp.hinstruct.hbacktrace_prim.halloc.hfix_code.hstring.hstdatomic.h + /  X=///=. x =;!!/ Cy /!x/ Q 0 "  0  ">L "%  ! !L / &  J'  > L! #!!.! 1 #! != / !!./ .. < k.e<   J7X\! 0=1    >>=J wX.  3!+1 G1 6.  M! ...sJ& .!my.1K! .K-!,- =-/,- !,-<&J"/"9&/"9& !&"!9&./"9&"9&&"!9&"9&#f1I /J$.! -! < .J./ -$   !d J. "!!/  .+! !& & +.& + & .+&  !  "$ " !. X w    0,.< !!/  ..GETFIELD2GETFIELD3GETPUBMETcaml__dummy_closc_stack_linksize_tallocated_words_resumedmark_stackcaml_get_current_environment__kindmemory_order_acquiredependent_sizeUNCAUGHT_EXCcaml_fixup_endiannessPUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3caml_ba_byte_sizeint32_tbacktrace_slotephe_infoCLOSUREREC__pthread_list_tmemprofBRANCHIFBRANCHIFNOThandle_exnORINT__next__dataBLTINTLSLINT__prevXORINTshared_heapcaml_heap_statePUSHATOM__pthread_internal_listcaml_stat_alloc__ownerMAKEBLOCK2MAKEBLOCK3LSRINTrequested_major_slicedebuginfocaml_ref_tableGETGLOBALCONSTINTepheCODE_UNLOADEDslice_targetheader_tBREAKPOINTcaml__roots_ls_progcaml_custom_tableMAKEFLOATBLOCKcaml_ephe_infostat_promoted_wordslong intcaml_realloc_globallocal_rootsAPPTERM1APPTERM2APPTERM3trap_barrier_offlimitstat_forced_major_collectionsuintnatRAISERETURNproxycaml_intern_statestat_blocks_markedopcode_tBRANCHENVACC1caml_final_infomemprof_domain_sPUSHOFFSETCLOSURE__nuserscompare_unorderedcaml_initializecaml_minor_tablesntablessigned charcaml_plat_mutexGETBYTESCHARtrap_sp_offCODE_LOADEDDIGEST_LATERdigest__pthread_mutex_scaml_find_code_fragment_by_pcunsigned charGETVECTITEM__spins__int128 unsignedPUSHGETGLOBALFIELDbacktrace_last_exncaml_custom_elt__atomic_load_ptrcaml_statefinal_infoREPERFORMTERMPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4TRAP_BARRIERPUSHACC6PUSHACC7_BoolvalueMODINThandle_valuecaml_gc_policycharcodeptrcaml_ephe_ref_tableMAKEBLOCKPUSHENVACCPUSHACCADDINTcode_endextra_paramsold_global_dataOFFSETCLOSURE0OFFSETCLOSURE3C_CALL3memory_order_acq_relmajor_work_done_between_slicesASSIGNprogflagsextern_stateSETFLOATFIELD__jmp_buf_tagGTINTyoung_startrefcountAPPTERMPUSHGETGLOBALbytecodeACC6caml_alloc_smallsweeping_donetablesPROGRAM_STARTreservePUSHcaml_invoke_traced_functioncaml_exception_contextevent_kind__lockCONST0CONST1CONST2CONST3caml__dummy_ls_progBULTINTls_progATOM0oo_next_id_localminor_heap_wszcaml_ephe_ref_eltRESUMETERMdigest_statuscode_fragmentlong unsigned intPUSH_RETADDRBNEQdependent_allocatedMAKEBLOCK1caml_add_debug_infoslice_budgetcaml__roots_closexn_bucketAPPLY1APPLY2APPLY3caml_remove_code_fragmentlongjmp_bufferATOM__mask_was_saveduintptr_t__sizeGETSTRINGCHARyoung_endexternal_raiseretvalc_stacksigjmp_bufBLEINTgc_regsRESUMEFIRST_UNIMPLEMENTED_OPGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecode_ttrap_barrier_blockCLOSURESETVECTITEMextra_heap_resourcesmemory_order_consumememory_order_seq_cststack_handlerdoublecaml_remove_debug_infostackhandlercaml_register_code_fragmentdigest_optparentmutexcaml_extern_stateLTINTmemory_order_releaseDEBUG_INFO_ADDEDSTOPswept_wordsthresholddigest_kindcaml__temp_resultunsigned intcaml__roots_blockDIGEST_IGNOREDIGEST_NOWpthread_mutex_tintptr_tAPPLYcaml_reify_bytecodegc_regs_bucketsISINTGETGLOBALFIELDRAISE_NOTRACErequested_external_interruptUGEINTBOOLNOTBUGEINTcaml_ba_arraycurrent_ramp_up_allocated_words_diffoffset__saved_maskblockEVENT_COUNTGRAB__jmpbufACC0ACC1ACC2ACC3ACC4ACC5caml_global_dataACC7caml__frameOFFSETINT__count__jmp_bufnitemsRESTARTallocated_wordsPUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4nextyoung_limitlong doubleSETFIELD0SETFIELD1SETFIELD2SETFIELD3num_dimsSUBINTRERAISEunique_idOFFSETCLOSUREM3allocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listfragnumcaml_stat_blockULTINT__builtin_memcpyhandle_effectSETFIELDactual_sizePUSHATOM0allocated_words_suspendedGETMETHODcaml_static_release_bytecodeephe_refinside_stw_handlerGEINTANDINTSWITCHcaml_ba_proxySETBYTESCHARcaml_failed_assertPOPTRAPGETFIELDSETGLOBALchar_osPUSHCONSTINT__int128__alignbacktrace_activeDIVINTstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policyrequested_sizecaml_gc_messagecaml_modify_generational_global_root__atomic_load_tmpcaml_alloc_shrcaml_debuggercurrent_stackatomic_uintnatshort intPUSHTRAPclosrequested_global_major_sliceinstructionsEVENTASRINTcache_bucketVECTLENGTHBREAKBGTINT__elisionextra_params_areatag_tENVACC2ENVACC3ENVACC4__valexn_handlerCHECK_SIGNALS__int64_textra_heap_resources_minorPUSHOFFSETCLOSUREM3code_startPUSHACC5memcpyyoung_ptrunitcaml_local_roots_ptrC_CALL1C_CALL2asize_tC_CALL4C_CALL5dls_rootmlsize_tstack_infostat_minor_wordsC_CALLNruntime/meta.clockednew_global_dataDIGEST_PROVIDEDcaml_stat_freeENVACCcaml_get_global_datashort unsigned intmagicOFFSETREFexception_ptrbasemajor_refMULINTNEGINTintern_statePUSHOFFSETCLOSURE0BGEINTPUSHOFFSETCLOSURE3Hd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatPERFORMLEINTcaml_domain_statestack_cacheminor_tablesPROGRAM_EXIT__sigset_tdataGETDYNMETprevOFFSETCLOSUREmajor_slice_epochGETFLOATFIELDGETFIELD0GETFIELD1GCC: (Debian 13.2.0-18) 13.2.0zRxA 4,`C AIA~s HAA $dEA~V EAD LEH DC A ABACAEA~LYfAABAAAC,BH CC A AFA~EBAC@ xBCDb ID A AGA~EAH AGA~FA    .`BM_ov0 "@ZiH}`xxmeta.ccaml_global_datacaml_get_global_datacaml_reify_bytecodecaml_statecaml_ba_byte_sizecaml_stat_allocmemcpycaml_fixup_endiannesscaml_add_debug_infocaml_register_code_fragmentcaml_debuggercaml_alloc_smallcaml_failed_assertcaml_static_release_bytecodecaml_remove_debug_infocaml_find_code_fragment_by_pccaml_remove_code_fragmentcaml_stat_freecaml_realloc_globalcaml_gc_messagecaml_alloc_shrcaml_initializecaml_modify_generational_global_rootcaml_get_current_environmentcaml_invoke_traced_function2@.Z:XDC    H p     R2V2^0b0d    ! " 22(0"0($ V2Z@2808$ % & 0& D& ' :Z>X@Cv2z200 ZXCC2200C 2200  &&3& 30&83H&@P3`&0h3x&3   5%&* /<=1DWcj q px {-t_  ]?%3 8ERze;q~ S " 4N>T lZ` f^l uzqx! )- d;IW $estE  D  ^[    )7CE [S Gao }&9  )~5A[ gs WiUks?'V3(? 0K .WLco  / +8ER7e[o | _% +  xi.8E.V(cp}  M r    $ 1 ?9 K Zn ` f[ l s#   Z  {     2     1 b ] 6 L C b o |i    6   S 9  @ ( 5X B OD ] j  S 9  @     ' S A9 N [@ p w |b          H R [ d m v     $ * 0' 6/ <7 Bz H / N ; T G Z S ` fC l r x ~     k     C 0  8 G      E   g &i,28>-D7JP V^\b |h n t z KI6T]! =VeQV- O"(.4y:@ F LRX^dtjpv|   P Wr 6 E B   # )/ f5 ;DA mHUp Wk ( CfZ tC$M-&DN R  a Ge =t wx m     -  &&&&(&&f(&0?I M R&c&p&&@    : .  {K  ( "  &0&8M&Lg x | &L        &&8& &'0&P T Yc 4g 0u Ky C~&&&&&&,&(&$ -& DN nR hW,a e j t x }      =    $ ( - ]7 P; L@{J bN `SZ] la jf&{ i x t&&&& &P&x3&J&g&&&l&&&  &2EEIy&&0 h@0.symtab.strtab.shstrtab.rela.text.data.bss.rela.toc.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @H@M@&,61@S(@;@S@ E2 \Y|PT@T`3x e!|s%H(0@0)8)KE@01A0E EL@ G@ K0 minor_gc.bd.o/ 0 0 0 644 147232 ` ELF7 @@ |Aa|;x|+x|3x|#x|x}Cx!a# C|*H@_|*H@A_|*H@A@?,)A$ _|(PA_(0Dx8`yJ@P_(Vt|H`xH`,#A_(0}#8!?}*B}J})}CR|cJ_ Aa|N `x8H`x88`H`?? H`8!Aa|N `?j=,)A)09@_0y)8i|c?(H`|}yA(,#A H`?(_08!}IR}>I}J}=JR?? Aa|N <N ```|#| H@L,,)@(#8!8`xc})2>N ()x;Ad|9@}|(H@ }@@L,@|+x| 9@})28`_xcx>8!N `8`H``(A<8c|=| H@L,,)@?x8`K``|<xc 8H`|K|8`H(A<8c|=| H@L,,)@?x8`|K\<xc 8H`K`}&p|#x|+x!A@|!A?BZa|{x:|(A(A (@p(@,8@@sA!Aa|8!} N `8`H``(A8c|>| H@L,,)@<})=!Aa8!|} N `,8@l{{%A0PK`<xc 8H`Kh``<;6~ijx{)$8[}JJ[~8H`^>|wxqJ})>@|,7A;7xx%xxH,A(6A|,6{A,?@@px=xxK>;>| H@L,()A4,)9>AX)U*>, A$9) U)>( Al9@}IL6q)A\{(?@H[;;8{$88}*J;y8H`Y9|xqJ9)9A99)9,?Ax;?xx%x8H,@=")), =")A)9)9@9_Kl`>})>K|<9)KxKp<xc 8H`K<|xqJ9)>A>9)>,?A;xx8xH,@t=")), =")AP)9@9)>_^KxK@[{T>;:Dx{)$8}*J;~8H`^|ixq}J^A^}J^,)A .:;xAXsH!})B8HxA,'|9\A(yB} 9 |Q*9J|A*B,8@ xx8xH,@="){d), =")A 9J}JB^AsG9@8HxA<,'A$,'A^|3x;^;Z;,:^;A`y })^^; ^^BK< K|;9pxK=BJ{dJ, =BJAHJ,69)})R9A$9 9@8cy($|i|)@}YA*ApxKJK)K()KsIAd_,:<>Aab=zaAaf??b?Bp>.%!A|#x|txby!:`;;{;Z!:$)`8)P>:```\,2A 2;| H@L,()A,)@$.;<x8|)As@,="))|?H@@="))|?H@A.;:.~NPy)|)@@d`*x8|)As@,="))|?H@@="))|?H@A1;;y)|)@A.()A8dx~óxH`\,2@A?j?,)A|9@I)@~x:;pH```;|9@@?,)@?y $}J}*H*=BJ|)A<=BJ|)A(,(Aq*@|)A |)A}>KxxxxH!p|)Ap|}@p|*@ } q@L,;:|9@AP,@t8!~xpx!Aa|!Aa} N xxxHK4```8dxCxH`K``8`H``8c|?| H@L,,)A$(@xxc H`K`8dxCxH`K ``8dx~xH`Kx}sxxHKI,*A`UJ>, AT|}@p|*H@ q@L,}^Sx@4_:`K<";:1|=HA .8`'H`@ X)x9Uq(A:a@y)b})H$``):|=HA :B@ 9*9J|=@@~~x=":y9)>B;~s!;:R``{I$|8|H*`/|HP|t|}G;RyJ${$}RA Bp}sx~x~CxH`/|.H@@D|.@AH8``@,x9;H/p@|.H@A;Z|8}:})IP@@Aa#xH`V|*@@,```>)q(A;|>P@A8`;AH`88xx~#xH`8`H`8` H`8x8x~#xH`8` H`8`(H`8xCxH8`(H`8`'H`,@8`H`@@@$=|>@@A```*;|?H@A8`H`8`&H`P@AAK~x#xH`K0yJ<yH$,@H`=")_)*K8`1H`K8`H`(A|8c|8| H@L,,)@K8`H```(A8c|>| H@L,,)@H`]`K<xc 8H`KxzzB})x!`B*KyIyJB})Sx!`B! !*K8H`8` H`KX=")8`)q)@@H`;,@K`<xc 8H`K=B*9)*K8`H`~#xxH`8`H`KL<JR?? |N H@A8`0H`8!|N ```<HP|)P@@<88`H`H`@H`?_}>HP|)P@A_?|)P@@$sAT&xEx{ cxH`8!!Aa|} N xH`xH`8!!Aa|} N H````|!H`H`8!p|N ``|?j!1a,>AH`>^|*H@A(a8!|N `| j,>A9!p9@9>ApAxH`a8!|N ```<ptr == tbl->limittbl->limit <= tbl->endtbl->limit >= tbl->thresholdCaml_state_opt != NULLnot enough memory%sinfix_offset == 0infix_offset > 0Wosize_hd(hd) == 2allocation failure during minor GCruntime/caml/mlvalues.hval & 1sz == 1Wosize_hd (hd) == 1get_header_val(v) == 0!Is_debug_tag(f)Wosize_val(new_v)caml_domain_is_in_stw()running stw empty_minor_heap_promoteMinor collection of domain %d startingdomain == Caml_stateparticipating_idx != -1taking remainderidx: %d, foreign_domain: %d, ref_size: %ld, refs_per_domain: %ld, ref_base: %p, ref_ptr: %p, ref_start: %p, ref_end: %p!(Is_block(**r)) || !(Is_young(**r))promoted %d roots, %lu bytesref_base: %p, ref_ptr: %p!Is_block(vnew) || (get_header_val(vnew) != 0 && !Is_young(vnew))Minor collection of domain %d completed: no minor bytes allocatedMinor collection of domain %d completed: %2.0f%% of %u KB livecleaning minor ephemeronsTag_hd(hd) != Infix_tagupdating memproffinalizing dead minor custom blocksrunning finalizer data structure book-keepingrunning stw empty_minor_heap_domain_clearfinished stw empty_minor_heapdomain->young_ptr == domain->young_endr->major_ref.ptr == r->major_ref.baseIs_block (val)domain_state->young_ptr == domain_state->young_endFatal error: No memory for minor heap!caml_domain_is_in_stw()requesting stw empty_minor_heapref_table overflowGrowing ref_table to %ldk bytes ref_table threshold crossed ephe_ref_table overflowGrowing ephe_ref_table to %ldk bytes ephe_ref_table threshold crossed custom_table overflowGrowing custom_table to %ldk bytes custom_table threshold crossed @Yspin_on_header_^0 :_int[2T *g , -:`T  |  W Z: l: m: O 113:A4:  O.;g X Y5/:aE2!E3!5NT2E}5259 ;b < =) > ?g B Cq$ 34:?c"     " % (W( +0 .8 2@ 6H 9P =X A` Ch F p I x L  P  T  [  ` r  t  w  y" {u }          H(T08didH@HHPX` h px    HR\v8+Wsp0 1 3 <:H; . <  (id= 0puWspw x\WEF|G8Hp2<@""   p0#u$ * /H7  ; 'p:; u<  = u(>  H? P@ XA  `Bhz<< <@RjmpA oB"Cq<WF&!22za b$jkHl   2@ SO ^ w  # ($ w0%% 86 ^ SBH w cB  |6     B  !]  ;gJ       !"#$%&'()*+,-./01 } ;g        %F* 3 4:?P 7   Q! HQ"Ae  H4:FF 7P. ofbuf/ H U;g   t   6 q  :  6   z!"$   < ! " #W  ufun val H   old  !  "   A- . /H0  3 Ag:;g( !(!#!2 !3 !/!3855end55ptr55 5T(5T078 9 A: 8<<end<<ptr<< <T(<T0>? mem@ AmaxA A8C&C&endC&C&ptrC&C& CT(CT0 :hgp34:  : ' R775R>7O7H7O2 D EF CFCFC!H!O!!O89 :  8-8-end--ptr-- -T(-T0id jp0 G2 G4    z k 75*99T8HOHlIbm[? 4 ` HH``I?I@Si *HH6zHz6zBHz(AA))@)RH*-wAM5  W!NzFz Z z)  "W G $  zNJ  zH"a Rsz2H P z8OHSH * H8I % 8H *$2zQDzng`g`>*9H{T8J 8eOH*#=H.S9oOH*a9 T-d0=tbld;>SSTHU:V W X -Z0=tblZ?>SSTHU9V W X -P0~=tblP5~>SST8U8V W X |T-V=tbl.V.%T/ 0O0)O0BO sz? T@ ToS8TU T S T Zz7AZZZZZ S {^ST1S8TU0&S T U 2S T U 3&S T U 4 S T U 7U#@#. &&"?&&Hl S T U & \%\\(]]] S T U %"p-@5z(4H%H=` \w\-sS{S0T1el?STUV+S S-^  ?^  ' ^    S0c.S0 S T U UH 9?  pS  S1T UpV W X0 S T U -<"z H? H !LH98!ST!7S 98T!dSV"!SST UUVVV"!SST # UUVV>"SST # UUVVT";z.,H<>"SSTTUUVVq\|98\=z]0^.H_>b g  n'<#l p <o2==<==*=7=D=Qr=^~=j=u====)]w,$]]] ]].=%=.=$=.=%====> >>&.>3%x>4 DWS%STZ~q S~ S T U & \f&(\ @S \&e\ @S.>C'>H S'TT(T&TT&9T4TATKTWZ'ZZZ/\/ DT TTT S T U (>V(>W>d)]w,(v]]] ]] ;Z+;u;h;;;;;)[F )n[XW[: \\\\! :$ *;;;! :7*;;;!;.;/.;<*";=;J*;S  *RSJ*kS  SJ S/\/- [F. +[XX[: \\\\!)[  4+_[ SJ\/)[( +[)[*,[8 .S #,'S  ,>S; ,VS' ,mSN$,ST3UVW0,SN ,S=,ST3UVW0-S= -&S(>-ISTU1-aS(-yS'-S T-S  -S<-ST3Us.ST3UV .4S)>.WSTU0.oS).S<.S.S.S{.S4{.SK{/S5T{/6SJT/MS;/lS /S T U m/S  /S /S DW0S0S  05SOJ0SST0jSO0S T U 0S T U  0SN$1ST3UVW01,SN 1CS=1qST3UVW01S= 1S(>1STU11S(1S' S T0 <3<&<3<4}L4>> YM4CYZ YM4lYZ YM4YZ 2S <_t6#7S 71S7HS> 7_S?7~S 7S? 7S&7S a7S7S& 8SM82S 8ISM8hS  8S18S s8ST8S19S T U c S T U -N:YN5zSYO(T' 9 R^R '9 S^tS S ;V:^;;;;;;<X[fW[t [5:[[[[[[[u7H;Z8z8+ :H =   > ^ >  + ;z#H g g + g -g -g+ <9^ ^   ^  + <_8z#elt &#v   ^+ <2z #re"#v #hd) A < <Y@>s2z#H3 #>s         #st#r #c  H  }K>C  HK=#iH +z -! 0~ 4 7 : >#prReK>V   >x   v><z wD==st:D=BH v    fz reHx@3 iA ]??]P]\]]]iDW@STU STU B%  A< v  hd)'@<DB' A <  DIA?~'Ar < DP DWSTUW]?]P]\]]]i S T U  SCYTTyT4C'TATKTWZBZZZ/\/ DTTTTTTT&)]?C]P]\]]]iCSTU CSTU DSTU  DWSTU~z O6C$v+$p>q0stD=" 0hd )0sz A" A0tag M{G E stkW ] E]1 S T U 3 wS T3UVW0 TFTTTTT\9F\^\R\FRFT2UV0 S  Z$GZ\kkO6G*STUV0G]S T U  S T U I, G cBH T/HzTTTTT\9H_\^\R\F RTV0 Z>H[\kkO6HSTUV S T U 7I iMA'tIH iVALE f\  ft] M Se JTT(TITT&9T4TATKTWZJZZZJ\/ DT TTT TmK}TTTTT\9K]\^\R\F RT1UV0 ZsKZ\kkO6KSTUV0LS T U _ S T U k S MTT(TLTT&9T4TATKTWZMWZZZJ\/ DT TTT TLNGTTTTT\9N,\^\R\F RTV0 ZSNw[\kkNS T U NS T U  O6OSTUV0 S T U P| HR$v+$p>qCGC.A"HRX0hd)'P "^" Q")' Pb" ^"  P" <" RP" ^"  9T4 TATKTWZQZZZZ/\/ DT TTT9T4TATKTWZR%ZZZ/\/ DT TTTA\\\\D )S$v$AS TT.TS TT&}T4dTATKTWZSZZZ/\/ DT TTT1)T4%v+\hd )^ , T%v"ggG> ~T  ^  3[T4:2T1U%d.z&$A%tag2M&B5\mem L~WC~(Tz0rU&lXVOXYggUYtYghVYtAYgiYt{VkS2T1eVSVS T UVS T U S Dy HXW8$valy&Du HW$valu& S T UvLlX$rl7XpXXYggX YtYghXSYtAYgiYtXS S T Un,e X%re:D\XYM0r^Y-S _ST0U,V Yg%tblV0V,N Y%tblN0VLIZz$tblI/~$szI<T$rsvIHTAZzKZZZZZZOS TU"3$ S ,7 Z%tbl78V%sz7ET%rsv8*T&87T: ]iC@g[ 3g3gMlocI`+A[%A<[%+=[F=?[%@9H[f9B[%+4[4=[% 6^ 6 @+ [+H[%,[&>)[1H\/&E) [ (,C\k&Dz&D#&D.H]H1\&G,\&*H1m\o ^o  1(H]&(=z+  +^+ @1]?Mval1!1+)]w%val8 ^  +@]Ma@>]#hB B] BN:^;;;! :7^;;;!;.;/(;< ^;=;J^S  ^SJ^S  SJ SSN>}_>> YM_SYZ YM_|YZ YM_YZ 2SN8_&l$I~41BH}1BI(  : ; 9 I8  !I H} 4: ;9 I 1RBUX YW  : ; 9 I : ; 9 I 8  :!; 9!I!84:!;9 IB U:!;9 IBH} : ; 9!41 $ > 4: ; 9 I.?: ; 9 '< U1RBUX!Y W!: ;9 I : ; 9 I8  11 1U 4:!;9 IB!4: ; 9 I?<"4:!; 9 IB#4: ;9 I$:!; 9 IB%: ; 9 I&: ; 9 I' ( 1)1RBX!YW *.?: ; 9 'I<+.: ;9 ' ,.: ; 9 ' -.?:!;9!'@z. 1U/1RBUX YW!04:!; 9 IB1.: ; 9 'I 2&I3I4!I/ 5: ;9 I6'7 : ;9 I8 8.?: ;9 '<91UX!Y W :GI;>! !I: ; 9 <<=:!;9 IB>H}?4:!;9 I@.: ;9 'I A1RBUX!Y W B'IC:!; 9 IBD.?:!; 9 'I@zE4:!;9 I?<F: ; 9 I G4:!; 9 IHI.?: ; 9!'<J1RBX YW!K L.?:!; 9!'@zM: ;9 IN.1@zO : ; 9 P !!: ; 9!Q :!; 9 I8R :!;9 S.?: ; 9 'I<T.:!;9! '@zU.?:!;9 'I@zVH}W1RBX YW X1RBUX YW Y:!;9 IZ1RBX!Y W![1RBUX!Y W!\4:!; 9 I].: ; 9 'I !^% _$ > ` a'b5Ic  : ; 9 d : ; 9 I 8eI f : ; 9 I 8 g!Ih> I: ; 9 i4G: j4G: ; k : ;9 l.?: ;9 '<m.?: ; 9 '<n.?: ;9 'I<o.?: ;9 '<p.?: ;9 ' q.: ;9 '@|r41sH}t4: ;9 I u.?: ;9 'I v.?: ;9 ' w.: ;9 'I@zx : ;9 y1UX Y W z.: ; 9 '@z{ : ; 9 |.: ; 9 'I@z}1X Y W ~4I41RBX Y W .: ; 9 ' .?<n: ; -|_`S``S__S__S__S__SXSXoSoSoSSoXTXnTnTnTTnXUXlUlUlUUlUlXVXmVmVmVVmVXWXjWjWjWWjXXXkXkXkXXkllmmnn  YooSmSm\]S^^S^^q#0]^o]^0]]Y^^Y]]n]]n]]Y^^YXYSY[o[[S[[o[[S[\oXYTY[k[[T[[k[[T[\kXYUYZlZ[U[\lXYVY[j[[V[[j[[V[\jXYWYZiZ[W[[i[[W[\iYYtYYnYYtY[[[T#[[[[T#[\YYS[[SWXnXXnWXnXXnWX WXYSTSTTnTTSTTSTUnUUSUUSUUSUUnUUSUVSSTTTUTUUTUVTSTUTToTTUTTUTUoUUUUUUUUUUUoUUUUVUSTVTTmTTVTTVTUmUUVUUVUUVUUmUUVUVVST u $@L$)TT  $@L$)TT u $@L$)TTU $@L$)TU  $@L$)UU u $@L$)UUU $@L$)UU u $@L$)UU  $@L$)UU u $@L$)UVU $@L$)ST0TTSTTSTUlUV0TU1UU1GGSGGSGGTGGTGGUGGUGGVGGV()S)8m88S8=m==S=Gm()T)*o*CTCDoDDTDDoDGT()U)8i88U8Gi()V)8e88V88e88Z8Ge)7k8DkEGk))ZCCZCD44n>>n78kDEk)4e88e88Z8;e;>e?@eAAeBCeDDeEGe)+i++Y+4i88Y8;i;>i?@iAAiBCiDDiEGi)4m8;m;=m==S=>m?@mAAmBCmDDmEGm)4f8;f;>f?@fAAfBCfDDfEGf)*d**)*Y*4d8;d;<d?@dAAdBBdBCdDDdEEdEGd*4`8;`;>`?@`AA`BC`DD`EG`--^--~x--^..n04o9:n:;o;<o??o?@n@@x@@nAAoBCoEEnGGn,-j---.j99j,,0,,h,--.h99*,0,-o---0o8909:o??0?@o@@@@oDD0EE0EG011Y44n>>n**Y**Y89 88088299 ,,U99U99~,-_99_,-_99_,,V99V99~,,W99W99~,-^99^,.n99n--U..i@@iEEiGGi00iGGi00Y::Y:;AAYAABB::YAAYAABB::ZAAZ::hAAhBBh::ZAAZAASBBSAA AA BB AA AA BB AASAASBBSAAhAAhBBhAAYAAYBBY11Y33Y33Y<=iCCiCCiEEi<=m==S==mCCmCCmEEm<<0<> ,CC ,EE ,<= <= <= ==Y==0CC0EE0==m==S==mCCmEEm==SCCSCC0EE0CCy@CCY== == == ==  == == CC ?? ?? 55m;;mABmCCm55o;;oABoCCo55o55h;;oABoCCo;;n;;AAABCC;;ZAAZ;;nABnCCn;;ZAAZABSCCSAA BB CC AA BB CC AASBBSCCSAAnABnCCnAAYBBYCCY;;Y67m67o67o77778>?m@Am>>o0>> on>?n@An>?o@Ao>>Y>?Y??Y@@Y@@Z@@YAAY>>Z>?Z@@Z@@Z>>X>?0??X@@0@@X>> 3$">>Y>>yx>?Z@@Z@@Z@@Y@@zx@@yx@@ZCD CD DDyDDYCD DDYDDyYtYYt    yY yY   Yy 1Yy 1      11  00 T %l%%T%(l U (U !b&'b!"o%&o&'o''ot e0 $ ei%( ei##e#$o$$h$$o'(o #0$$1$$g%'0((0$$c'(1!"m%&m!!Y""Y#$b'(b#$a'(a#$^'(^#$Y$$n''Y''n'(Z''Z#$^'(^#$Y'(Y'(^$$^$$Y''Y''yx''Z b&&b Y&&Y''Y&&S&& && && && &&S&&S&&o&&o&&Y&&Y o&&o Y&&Y''Y""Y SkSkSkSk TllllnlTlnlZlnl UmmmimUmim SkSkSkSkiiinnnininno0oooooooofffjXjXjf:%f:%ffjhhh3$hhhUUUUUUUUjjjjVjj02nS03nnnnn0SsS00ffnnSS00iinn001010101010101nnnnnn00yZ00nnnYYiiiYYSS    SSiiiYYY01iS02illlooooooooooonnnoooooooooooSS    SSnnnYYY0jnS0in S o S S o S S o S S o S o T n T T n T n U U Y U U U Y U U U Y U V V V 0 S 0 S 0 1 0 Y Y Y sx x S8 sx x S8 sx x sx x Y Y Y Y     sx x S8 sx x     S o S U sx x S8 0 S S       S S S x x x Y Y Y S S       S S S x x x Y Y Y Y YQQSQQQRSQQSQQQRSQQSQQSQQoQQS8QRoQQSQQSQRYQQ QR QQ QR QQYQRYQQoQRoQQSQRSMNSNPmPPSPPmPPSPQmNPoPPoQQoNPoNOoOO8OPMMSMMSMMSMMSKLSLLoLLSLLSLMoIISIKoKKSKKoJKoJJoJJ8JKIISIIoIISGGSGHoHHSHIoGGTGITGGUGIUGH8HI8GGUGHUHIUGGTGHTHITGGSGHoHIoHHSHHnHHHHSHInS ST TSoSoS oSSTTy@YRRSRSnSSSRSoRSoSS8SS,0                                         && && &&&&&&&&&& !"%&!!!!"""""##$'(###$$$'(##$$$$)48;;>?@AABCDDEG+,,.89++88,,,,,---99----..@@EE00GG00:;AABB::AABBAAAABBAAAA<<<=CCCCEE======CCEECCCCCC============55;;ABCC55;;ABCC;;ABCCAABBCCAABB6666676666776677>?@A>?@A>>>?@A>>>>@@@@GGGGGHHHHHJKKKKKJJJJJJKKJJJJJJJJJJJJJJJKKKNPPPNOOOOOOOOOOOOOOOOOOOOPPPQQQQQRQQQQQQQQRRQQRRRRRRSSRRSSRSSSSSTUUUWWWWYYYY[[]]]]]^^_) runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesminor_gc.cplatform.hdomain.hmajor_gc.hshared_heap.hmlvalues.hmisc.hfail.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hweak.hfinalise.hcustom.hstdatomic.hruntime_events.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hroots.haddress_class.hsignals.hmemprof.hgc_stats.hglobroots.hstring.h  ==>   1 P! $, " !KK!# ' "#',!7 !!!". l4K   < /;!///// z.  K  1 X %h %h ./ ! CJ~J ~ X}.3 ...}X'+~X  - 0! 0 X.# # !". mt h!.2 " "$K} t 0 . #u ! "v  ,!/=~<.f <Ll><  K0  0- !0   .. + * !D. <.f L  i "!#I0 6  ##')$ $$$ %z7<X % !Iz ' /Iy7   .  S - <2S   <}J !Z.2,  4 t 0v>=v>=K!/=j| <h != /./  5=t/=K=>!#"#1 .-"/>- %!!$. |<.fh[KM=/ X% 5=K=??=K ,  !L  .X   ! .>=K=>=K|"> |&|   !  & | . |. |.&  , =t K, <=KKt<.<}J   0- . .J/#&X .X <|X.<...<X{.<.  1$  /  . XJC!#f2<U!./ .| Jf f  /.p/  zX| Jyz.!| Jy.> /=K ~  "6 < &XEj6 /  !+{  {.   43 / !.A|0}=   !<. /#// D|.~X$! !+{  # {    K / !.zJ</ ~ X}<X/ ~ X}. f} .< 2.t|<J  0   !/\zX| .<      }=KE5u| t.==J~|  t 0v>=v>=K!/=j| f y< m<9t    r.!!0/  ./#%" !  w !%*5""!!  <t. f00//KJ tY > u g /! / A!6.)!   f !! / A!6.)!   e !! /A Ab 6 )   /<* dt+#X + = . <J/t .J+. . <J/ -! j%=%!%!%/ /,"/K/x.L<2 X g  /!./ A!6.)!   f !! / A!6.)!   e !! /A; AE 6 )   ;..yJ%y.X .'1tv'x.  <. .n J ~ X}.3  ...tK"10 |&|  !  | & |  . |. |.&!. #[M   .B:>. ",zJ. ;J>". zJ<  >".  P>.1K  ! W! mtJ Y..1\!  1=<sf  g@2(x 01y< y .   3Kk.'3    .#/ !fX J8=?X Jx<.f=//=!-/!x./ <x!...u/ fzX.XYt+X < <locked_ephemeronsEV_C_MAJOR_SLICE_BUDGETscanning_actioncall_timing_hookcaml_memprof_scan_rootsc_stack_linkcaml_plat_latch_waitsize_tallocated_words_resumedmark_stackEV_STW_HANDLERcaml_verb_gc__atomic_compare_exchange_ptrwosizeEV_C_FORCE_MINOR_ALLOC_SMALLmemory_order_acquireEV_DOMAIN_RESIZE_HEAP_RESERVATIONcaml_opportunistic_major_work_availableremembered_rootsdependent_sizest_voldify_onecaml_plat_spin_stepbacktrace_slotephe_infocaml_opportunistic_major_collection_sliceEV_FINALISE_UPDATE_LASTEV_MAJOR_EPHE_MARKmemprofcaml_minor_gc_end_hookmsg_errorcaml_ev_endev_runtime_countercaml_plat_barrier_arriveEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLE__func__handle_exnget_header_valcaml_stw_empty_minor_heap_no_major_sliceelement_sizecaml_memprof_after_minor_gcextra_heap_resourceswork_availableEV_MINOR_GLOBAL_ROOTScaml_fatal_errorshared_heapcaml_heap_stateEV_EXPLICIT_GC_FULL_MAJORreserved_tmax_spinsblockcaml_raiserequested_major_slicecaml_ref_tableUNMARKEDcaml_do_local_rootsdom_stcaml_adjust_gc_speedepheslice_targetencoded_alloc_lensEV_C_MAJOR_DEPENDENT_WORKdirectheader_tbarrier_statusis_exceptioncaml_minor_heaps_endcaml_custom_tablecaml_gc_mark_phase_requestedEV_C_MAJOR_HEAP_LARGE_BLOCKSstat_promoted_wordscaml_marking_startedlong intlocal_rootstrap_barrier_offlimitcaml_empty_minor_heaps_oncestat_forced_major_collectionsEV_C_MINOR_PROMOTED_WORDSuintnattodo_head__builtin_memsetvalue_ptrforeign_major_refEV_EXPLICIT_GC_MINOREV_EXPLICIT_GC_MAJOR_SLICE__saved_maskEV_C_REQUEST_MAJOR_ALLOC_SHRcaml_global_barrier_release_as_finalcaml_intern_statestat_blocks_markedlatchdomainEV_MINOR_EPHE_CLEANcaml_plat_barrier_is_releasedcaml_scan_stackcaml_final_infomemprof_domain_ssaved_minor_cyclecaml__spins_171EV_MAJOR_GC_STWcompare_unorderedev_runtime_phaseEV_C_MAJOR_SLICE_TARGETsuccessEV_EXPLICIT_GC_SETcaml_minor_tablesntables__atomic_store_tmpdo_ephemeronssigned charmark_requestedcaml_shared_try_allocfinaltrap_sp_offcaml_alloc_minor_tables__atomic_exchange_ptrcur_ptrcaml_global_barrierunsigned chartry_update_object_header__int128 unsignedbacktrace_last_exncaml_request_minor_gccaml_custom_elt__atomic_load_ptrcaml_statefinal_inforesultEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLEev_counter_namePhase_mark_finalcaml_minor_gc_begin_hookoldify_statecaml_plat_futex_BoolEV_C_MAJOR_WORK_COUNTERcaml_enter_global_barriertablevaluestack_valuehandle_valuecaml_do_opportunistic_major_slicecaml_gc_policycharserializelive_bytescaml_realloc_custom_tablecaml_ephe_ref_tablecaml_plat_spin_back_offcustom_operationscaml_stat_alloc_noexccaml_mark_roots_stwextra_paramsmemory_order_acq_relmajor_work_done_between_slicesinfix_offsetflagspromPhase_sweep_and_mark_mainextern_statecaml_debug_is_major__jmp_buf_tagyoung_startcaml_domain_is_in_stwcaml_result_privatecustom_finalize_minorcaml_alloc_tableEV_C_FORCE_MINOR_MEMPROFmajor_ref_sizereset_tablecaml_domain_alonefilecompareEV_STW_API_BARRIERsweeping_doneupdated_lasttablesextra_rootreserveEV_MAJOR_FINISH_MARKINGcaml_plat_barrier_releaseEV_EMPTY_MINORcaml_exception_contextunusedcaml_scan_roots_hookcaml_global_heap_stateEV_MINOR_FINALIZEDref_startEV_COMPACT_RELEASEEV_MAJOR_FINISH_CYCLEEV_MINOR_CLEARCAML_FROM_CAMLfunctionEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKScaml__spins_813caml_plat_latch_setoo_next_id_localminor_heap_wszcaml_final_empty_youngcaml_empty_minor_heap_domain_clear__uint64_tparticipating_idxcaml__framemark_requested_pEV_STW_LEADERrefs_per_domainlong unsigned intfinalizecaml_ephe_lockedrealloc_generic_tableselfstatuscaml_alloc_small_flagscaml_final_update_last_minordomain_unuseddependent_allocatedminor_allocated_bytesslice_budgetcaml__roots_extra_rootexn_bucketcaml_memprof_set_triggerlinecaml_plat_barrier_resetlongjmp_buffernallocscaml_update_major_allocated_wordsalloc_generic_table__mask_was_saveduintptr_tyoungcaml_timing_hookSCANNING_ONLY_RECENT_FRAMEScaml_gc_logyoung_endEV_EXPLICIT_GC_COMPACTEV_MINOR_FINALIZERS_ADMINcaml_get_header_valcaml__spins_799external_raiseEV_INTERRUPT_REMOTEc_stackcaml__b_941sigjmp_bufEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEruntime/minor_gc.cspinsEV_MAJOR_SWEEPcaml_free_minor_tablesEV_C_MINOR_PROMOTEDEV_MAJOR_MEMPROF_ROOTSgc_regs__uint32_tcaml_scan_global_young_rootscaml_realloc_ephe_ref_tableGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecaml_ephe_nonecountertrap_barrier_blockmsg_growingoldify_scanning_flagsGARBAGEEV_EXPLICIT_GC_MAJORcaml_ephe_infomemory_order_consumepromote_resultmemory_order_seq_cststack_handlercaml_ev_begindoublecaml_plat_futex_wordstackcaml_minor_heaps_startfinalisablecaml__dummy_extra_rootCAML_DO_TRACKgc_phase_tlog_eventsvnewcaml_allocation_statusparentcaml_extern_stateephe_clean_minormemory_order_releasecaml_plat_latch_releaseswept_wordsthresholdcaml_empty_minor_heap_setupcaml_plat_latch_is_releasedEV_MINOREV_C_MAJOR_HEAP_POOL_LIVE_WORDSgeneric_tablecaml_try_run_on_all_domains_with_spin_workunsigned intcaml__roots_blockSCANNING_ONLY_YOUNG_VALUESEV_MINOR_FINALIZERS_OLDIFYcaml_stat_resize_noexcintptr_tPtr_valgc_regs_bucketsrequested_external_interruptcompare_exttodo_listEV_C_MAJOR_HEAP_LARGE_WORDSinitial_young_ptrspin_on_header__atomic_compare_exchange_tmpPhase_sweep_ephecurrent_ramp_up_allocated_words_diffreset_minor_tablesatomic_valuecaml__loc_171MARKEDoffsetcaml_minor_collections_countfirstmust_sweep_ephecaml_get_value_or_raisecaml_ev_counteroldify_mopupEV_EXPLICIT_GC_STAT__jmpbufEV_C_MINOR_ALLOCATEDagainfutexEV_C_MAJOR_ALLOCATED_WORK__jmp_buf__atomic_store_ptrnitemsEV_C_REQUEST_MINOR_REALLOC_REF_TABLEcaml_try_empty_minor_heap_on_all_domainsallocated_wordsself_minor_tablesnextyoung_limitfield0long doublePhase_sweep_mainEV_MAJOR_SLICEredocaml_realloc_ref_tablecaml__alone_941EV_MAJOR_MARK_ROOTSalloc_sharedcaml_memprof_sample_youngunique_idEV_MINOR_MEMPROF_ROOTStodo_tailcaml_gc_phaseallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningitemsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedclear_tablecaml_alloc_small_dispatchcpu_relaxEV_C_MAJOR_ALLOCATED_WORDScaml_stat_blocklivenew_vupdated_firsthandle_effectcaml_reallocate_minor_heap_arenatail_callcaml_resultallocated_words_suspendedEV_COMPACT_FORWARDcaml_do_pending_actions_resdeserializeephe_refinside_stw_handlerfixed_lengthEV_C_MAJOR_HEAP_POOL_FRAG_WORDSEV_MINOR_LOCAL_ROOTS_PROMOTEdomain_statewhsizememsetparticipating_countEV_C_MAJOR_HEAP_POOL_WORDScaml_failed_assertEV_MAJORwsizechar_oscaml_stw_empty_minor_heapCAML_FROM_C__int128EV_MINOR_REMEMBERED_SET_PROMOTEhandlerEV_MAJOR_MARKnum_participatingbacktrace_activeminor_gc_leave_barriercaml_empty_minor_heap_no_major_slice_from_stwcaml_set_minor_heap_sizestat_major_wordsmemprof_young_triggerEV_COMPACTEV_MAJOR_FINISH_SWEEPINGEV_MINOR_REMEMBERED_SETrequested_minor_gcyoung_triggergc_policy__atomic_exchange_tmptodocaml_collect_gc_stats_sample_stwbarriercaml_check_gc_interrupt__atomic_exchange_valfinal_funcaml_gc_messageref_endglobal_heap_state__atomic_load_tmpcurrent_stackatomic_uintnatEV_C_MAJOR_EXTRA_WORKshort intEV_MAJOR_EPHE_SWEEPuint64_trequested_global_major_slicecaml_plat_barriernonatomic_increment_countercaml_global_barrier_and_check_finalcaml__max_spins_813EV_MAJOR_GC_CYCLE_DOMAINSwordscache_bucketatomic_intnatscanning_action_flagstodopcaml__continue_941caml_handle_gc_interruptEV_MINOR_MEMPROF_CLEANextra_params_areatag_tEV_C_REQUEST_MAJOR_ADJUST_GC_SPEED__valexn_handlerbsize_32caml_debug_is_minordesired_hdephe_ref_table__int64_tcaml_plat_srclocextra_heap_resources_minoryoung_ptrcaml_local_roots_ptrEV_MAJOR_MEMPROF_CLEANasize_tdls_rootmlsize_tstack_infocaml__max_spins_799cyclemsg_thresholdstat_minor_wordsuint32_tlockedcaml_minor_cycles_startedarrivedcaml_major_slice_epochEV_COMPACT_EVACUATEEV_DOMAIN_CONDITION_WAITnew_tablecaml_stat_freecaml_poll_gc_workEV_MINOR_LOCAL_ROOTScaml_empty_minor_heap_promotereservedcaml_plat_binary_latchcaml_plat_barrier_waitcaml_minor_collectionshort unsigned intmagicCAML_DONT_TRACKfinal_todoexception_ptrbasemajor_refminor_gc_end_barrierEV_C_MINOR_ALLOCATED_WORDSprev_alloc_wordscaml_plat_futex_valueintern_stateEV_MAJOR_GC_PHASE_CHANGEscan_roots_hookHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatrunning_finalisation_functionbsize_64custom_fixed_lengthcaml_domain_statestack_cacheEV_C_MAJOR_HEAP_WORDShashcaml_final_do_young_rootsparticipatingcaml__1000_171minor_tablescaml_ephe_ref_elt__sigset_tEV_MAJOR_MARK_OPPORTUNISTICdatacurr_idxEV_C_MAJOR_ALLOC_COUNTERforeign_domainEV_MINOR_LEAVE_BARRIERprevcaml_check_urgent_gcidentifiercaml_reset_young_limitcursorforeign_minor_tablescaml_alloc_point_hereEV_FINALISE_UPDATE_FIRSTEV_C_FORCE_MINOR_MAKE_VECTlastmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA TC ACDEA~j QAB N HAB Z QAA p4DA~F DAB I DAC JDAXBCO DD I FA BT BBB P D A AEA~EAB ABA~N BAA DEFB AAAAACBA~bAAAABAAEFBA~FS AAAAAAAEFB e A gAJ Dg HACA~ E AA W AA BT AAC A DdD AL KFA~O  NAEFDA X|C A DO A~FA ACAB PAAAA?MADFA A~Fa(B AFA~O MAA <XEA~IDA$`B ACA~o CAA (CO BD A AFA~DAX,C AGA~} JAC (BH AA O ADA~EA$$C ADA~HNAXL<F AEA~CE ALAD IAJADA~EJA CA~V BAA $EA~S DAD XD ACDDGFA~m KAAFA G KAAFA P8CpA~EBA8p@C AFA~L EAB S EAD 000Agnu "H;`FxS||      (>I_n0"LZf.G\s%Fb X29Pd Xx8Ph<0Ty1KV8l@0(0@0(minor_gc.crealloc_generic_tabletry_update_object_headeroldify_oneoldify_mopupcaml_stw_empty_minor_heap_no_major_slicecaml_stw_empty_minor_heap__func__.1minor_gc_end_barriercaml_minor_cycles_startedmark_requested.0caml__loc_171.2caml_gc_messagecaml_stat_resize_noexccaml_ev_countercaml_request_minor_gccaml_statecaml_stat_alloc_noexccaml_stat_freecaml_failed_assertcaml_fatal_errorcaml_gc_mark_phase_requestedcaml_empty_minor_heap_setupcaml_verb_gccaml_do_opportunistic_major_slicecaml_opportunistic_major_work_availablecaml_opportunistic_major_collection_slicecaml_ev_begincaml_ev_endcaml_num_domains_runningcaml_plat_spin_back_offcaml_minor_heaps_endcaml_minor_heaps_startcaml_gc_phasecaml_global_heap_statecaml_shared_try_alloccaml_scan_stackcaml_ephe_nonecaml_ephe_lockedcaml_minor_gc_begin_hookcaml_scan_roots_hookcaml_minor_gc_end_hookcaml_domain_is_in_stwcaml_gc_logcaml_enter_global_barriercaml_final_do_young_rootscaml_memprof_scan_rootscaml_do_local_rootscaml_memprof_set_triggercaml_reset_young_limitcaml_collect_gc_stats_sample_stwcaml_memprof_after_minor_gccaml_final_update_last_minorcaml_final_empty_youngcaml_plat_latch_releasecaml_mark_roots_stwcaml_adjust_gc_speedcaml_plat_latch_waitcaml_scan_global_young_rootscaml_alloc_tablecaml_alloc_minor_tablesmemsetcaml_free_minor_tablescaml_debug_is_minorcaml_debug_is_majorcaml_set_minor_heap_sizecaml_handle_gc_interruptcaml_reallocate_minor_heap_arenacaml_get_header_valcaml_empty_minor_heap_domain_clearcaml_empty_minor_heap_no_major_slice_from_stwcaml_global_barrier_and_check_finalcaml_global_barrier_release_as_finalcaml_try_empty_minor_heap_on_all_domainscaml_try_run_on_all_domains_with_spin_workcaml_empty_minor_heaps_oncecaml_alloc_small_dispatchcaml_do_pending_actions_rescaml_poll_gc_workcaml_memprof_sample_youngcaml_raisecaml_minor_collectioncaml_check_urgent_gccaml_alloc_point_herecaml_realloc_ref_tablecaml_realloc_ephe_ref_tablecaml_realloc_custom_tablecaml_major_slice_epochcaml_minor_collections_count ! 8" L \# $Z$X$C% & B2F2N0R0T' r2v20~000' 22H00H' 22h00h' 20( 20( "2&@:2>@F@R2V0b2f@2@@202@- 2@(. T/ `. l0 2@2"0(2 202 2@2 "@ r2z0|2 2200' 2200' 7 X H 7 l H z2( ~@( 20 @0 2 2 0 0 ' &2 .0 02 >2 B28 J0 N08 P' ^2 b20 j0 n00 p' 7  H 2( @( 20 "@0 x7 , H :2( >@( N20 R@02(@(20@02`0`8 20( 22(00(' 2 200' &2*220608' F2J2R0V0X' 222h2000h0.2P20P2@2 @ 2@2 @ T' n$Zr$Xt$C28@82@@@4 ` ` ' `2 |' '  `2 2h00h' > 20? 20? / 2H"@HJ$ZN$XP$Cn2`v0`/ 20002H&0H?  ` @ T/ pA |0 / B 0 /  x0 0 20? @ "2&0(? `/ C 2P@P/  x0 0 4D @E pF ~2X@X" " " " 0 2p0p? 0/ :20>00@? LG X0 p/ z2H~0H? 2@2 @ 0 /  2p0p? H (0 4/ >2B0D? TI ^2z00 20? j2n2v0z0' ? 2@2 @ 2200 ' F2J@Z2 ^@ n2r2(z0~0(' 20>2B0P? b2d/ r0- 0 / 20 ? 28@82200J  ` 4K F2 N2 ^0 f0 t' ~28 @8 0 ! L !22!:0!<2 !M !0 !2!@!. !2!0!2 !2!@"@"/ " N ",0 ":2">2"F0"J0"L' "Z2"^2"f0"j0"l' "z2"~2"0"0"' "2"2h"0"0h"' "/ ". "0 "/ # A #0 #$/ #@B #L0 #X/ #l x#x0 #0 #2#0#? # #% $& $f2$j0$l( $% $Q %& %L& %& %& %2%2%0%0%' &2& @&2 &"@ &V2&Z2@&b0&f0@&l' &2&@&2 &@ &$Z'$X' $C'@" 'H# 'PV 'lW '& '& '& (B2(F2P(N0(R0P(T' (b2(f2h(n0(r0h(t' (2(0(( )2)0)2 )\I )f2)0*[ *"2`*&@`*P *b2 *j0 *p* *x\ * *2 *0 ** * +> +.2+20+4? +B,2+F*2+J2+^,0+b*0+f0+h^ +2+2+0+0+' +2+@+> +2+/ +0+] ,0 ,22,62,>0,B0,D' ,a -" -b -V -`c -D -E -d .# .$V .^$Z.f$X.h$C.g .$C.V /22/62h/>0/B0h/D' /b2/f2h/n0/r0h/t' /2/2/20/0/0/00/ /2P/2h/2/0P/0h/0/ /2/2/2/000000 &3& 30&83H&P3`&h3x&p3&@3&#3&#3&$3&$3&%3 &&(38&&@3P&(X3h&)@p3&)3&+3&+3&,`3&.3&.P3&/3(&/03@&/H3)&+&1&3& 4&(5&06&89&@:&H;&P<&X=&`& && P!&*/=D W c;jeqx }  ^"*" $B"PU@msmy   [ %&   *i6BQNbZfwPK  ' AV"\*8F"Tbp ~$*~#! P&$4BtP^ \jv3! miH}( , 8 D!gP\ht`h- 3 Z  $1|> ]ci#Ms!rF (^47A N[yh#{+# "Fu eV `8!EXb"Jor I#"6"- I#g  "~  , 9 F ^ r ` Z  I      # ) / 5 ? ; A9 G M S# Y _B e k q  w }!t  " {    B #6     )      "      Q  / 2 8# >u D J Pw V \h b h n th z %     "h   H   a # @  !% ~ S    n z * Ij V-    * !  ~    "9 /^ B h v   |  F | wj  "),5AMYeq}!>| "# *!D^>k|x !> | .5b:F\X ^dj  K K !Q {PP "0 DUP\ivA )y,!>|+ @l&Qk&Z!f&o{& > +#'.@f -m t:p/A ySx<#rK%"Kbst q 31~G D3 |E 1fG|=M X [  &/59 >&0`&m&z&4&/&"&/&&h&P &//<388&/Z&0g&t&:&`N k=9' ,05@DI&p&&&& &&%&6&B&@_&T&d&\&&&&0&& &H&'&8&hE&\#Rg&.P~ # ?=IG&/&/|&h &!&.+=FVJRS&.lipey|}x&.&/L&h& &,`  ! %*<599->5IvMjRF]aj&,tt&-&,&-&-&-$&-h&-,&-ADG&+^i#mri{&62&+GEZX&+&+ &+&, /&,L@&M&do&+&+$&+<&&+p&*&,& &+ & (& :L @&) W bx fb k w v z T   " } g  &    ^   ^   !&*t! &*!8&*!M&*!e&*T!& !&*!&!&+!&""&#""*"."3 ">"B"GT"R4"V0"[""fJ"jF"o&#""&@""h"\" """T""""# # # A# G# A##( c#, ]#1 #< ~#@ z#E&#c #g #q&#{a# # # # # w# c#a# # # # # # # 9# %# # $ $ $ f$ ^$ $  $) $- $6 :$: 8$C F$G B$P&$Z&${ Y$ W$&$ c$ a$$ m$ k$$ }$ w$$ $ % % %  % % % %' %+ %4%8%A.%E*%N%[?%_=%d&%y&%&%&%&%&%& $%& O&G&&&-&&7&Hp&Ll&Q&&j&w&{&& &&&&&&&& &&&&&&'+' ''& '# '1@'5:'>w'Bq'K'O'X& 'b'j&!D'{&'& '''''&'&('&'&( ((&|($&|(E(I(R&|(l(p({&l(%(((9(-(%(f(d(u(o(&t(&t)))&t)&t)4)8)A&t)V)Z)c)g)s&)}?)))))?)()$)&!)N);)7)N)N)N)L*Y*]*[*#&!*<&"*S&"*l&"*&*&*i*&*~*i*e*&*~***~++ +&!+&&!+B+F+K&!+d&!+n&!+&+&+++&+&+++&+&, &,&,(&,?&,W&\,n&x,&,&,&,&-&-'&-J&-b&-z&-&-&0-&-&h-&-&.&.5&.X&.p&.&<.&H.&x.&.&.&/&/7&/N&/c&p/m&/&/&/&X/&/&l/&/& 0&!0&"06&"(0T&"40k&"T0&0&0&"0&h0&0&"0&#1&# 1-&#,1D&#H1r&#T1&#`1&#p1&#1&#1&#2&2&2$2529 2B2K:2O22X2aa2eW2n&2x222222&222222223&!3 333(M3,G35r39l3B&!3L3T&!3e&3t& 33333&333&!(3&L3&L44 444&\4)4:4>4H&4R4c4g4q&4{444&\4&,4 444 4444V4R45s5 e555"5&5/&H5H5L5[&l5e/5v5z 5/555'5#5& T5:5:565:5M5I5b5`5& |6&6&6(&!62&!6Nl6Rj6[&!6p6t}6}66&!66666&6&6&6&86&H7&07&T72&`7I&x7`&7u&H7&7&7&7&p7&$7&07&<8&L8)&83&8J&8_&8i&8&(8&8& <8& 8&"t8&8&9 &"9&9'&999?& 9V9d 9r& 99999&p9 9}9!999&891: ::1:#':'#:0T:4H:=<:F:J:S:W:c&H:mG:z:~ :&H:R:4:0:R:Y:U:~:z:]::::: ;9; w;"3;07;>;K;[5;i;vT;#;e;; 8;;b;;;;< < ]<' >  > >'>IB>X>e>~ >>">M>&p>>>>>> >?%?"??"9?-A?1??6?AP?EJ?T?X|?]?h?l?q?|???&,????&??? ? ?&@&@4,@= '@H @L@Q@\3@`/@e<@n#@yF@}B@_@U@@@&@@@@@@@&@AA AbAQA%%A5&DAJAUAYA^bAiAmAs&8A&A&AAA&AAAAA& B&hB&B*&LB4BEBIBNBW B[BdBuB~"B B&HBB.B*BSBOBlBhB&HBB&hB&4CC{CC C,&LCACECNCRC^&<Ch&<C&<CCC&\C&C&D&DEDLDSDXD_&DvDDDID)DDD'DDD|DfDDDDD&D DEE EEhE"!E+ E6E:E?WESEWE`&|EjbE{&E"E&E&(E&E&E&`E& E6F7F 5FBF@FNF#LF,YF0WF56F>cFBaFK& FUAFcmFgkFpxFtvF}FF& F&F&F& FLF& F& G& G+& G@&GM&G^&`Go&G|&GGWGGGGGG& GGGGGH H  HH H H$& (H.H< *H@ &HI ?HM ;HV RHZ NH`& H& HH& H H& \H& xH&0H&II cI aI!& hI? IC lIIWI[!I_ In!<Ir!0I{& IvI!vI!pIvI!I!I& I!I!I!I!I{I{I!J!J& JJ(!J,!J5" J9"JB"#JF"JO& JY& Jm& 8J~&J& J"8J"2J"TJ"NJ& JJ"lJ"jJ"wJ"uJ"J"K"K"K K"K"K"& 4K,K:"K>"KG"KK"KT"KX"K^& (K& xKK& xK& xK& pK& K&L&L& XL'&8L4&LJ&4LT<Le"Li"Ln<Lw"L{"L&4L#FL#@L#rL#\LALAL#L#L&LLL#L#M#M#M$M$M&M(&M<&MM&M\&Mq$*Mu$$M~$FM$@M& tMmM$^M$\M$iM$gM$xM$vM$M$MmM$M$M& MN $N $N$N$N#$N'$N-& NL& DNVNg& DNqNx&N&N&N&N&N&N& 0O&@O&O%&O7IOB&Oa$Oe$Or%@Ov%2O{O%O%uO O%O%OXO&O& O~O&UO&OO&OO&O&kOP&P&P PP' P"'P'&`P<PF'(PJ'PObPY']P]'YPcPlPv'xPz'rPP'P'PPP'P'PP'P'PPP'P'P&pPQ'Q 'Q(Q(Q ("Q$(Q-&pQ7 Q?&QP&Q_&\Qt(>Qx(8Q(`Q(ZQQQ(zQ(vQ&Q!Q(Q(Q(Q(Q(Q(Q&R1R &0R&R*&R?(RC(RL) RP)R]&RgsRrsR)%R)!RRR&(R):R)4R&(RR)[R)URR)zR)vR S )S)S)S)S%&(SB)SF)ST&(S^Sl)Sp)Sy)S})S* S*S&(S(S&)$S&S&(S*S*S*/S*+STT'T5STLTX"TdTp&TyT&TTTTT rUzU &&U#U-*JU1*>U69UJ*~UN*xUW&'HUa&'HUy&'PU&'XU&'|UU*U*U&'|UU*U*U&'U&'UV*V *V&'V#&'V-V8*V<*VA&(VP&'HVl&'tV&(\V&PV&V&(|V&hV&V&(V&W W&&W/*W3*W9WC&%Wd*Wh*Wm&&tW~&@W&WW&$W+%W+W&%W_W+GW+EW&%WoX +QX+OX&% X%&%@X/X=+[XA+YXF&%TXX&%tXbXm+gXq+eXv&%X&%X&%X&X&XXX&$Y +xY+rY&$Y.&$YNYh Y sY&#Y+Y+Y+Y+Y+Y+Y&#YEY+Y+Y+Z+Z ,Z ,Z,AZ,;ZEZ(,aZ,,WZ1&$ZP&$Z]&$tZn&Z{fZZ ZGZZZ[  [][+ 7[9][G[Y][g[u][[[f[][ H[{[[[\ {\\"\1\:D\GP\S\_b\l\x%\\'\\ \\\e\\K]]] ]@!]^]j]x:]]]&],],],],],],^&^h^,^#,^,-^0-^5h^Ch^L-^P-^Y&^w-,^{-*^&0^&\^&h^&t^&^&)@_-:_-4_"-U_&-S_/&)d_93_J-__N-]_X&)_bC_s-i_w-g_&)_N_-u_-s_&)d_&._&.$_&.,_M_N&G&W&g&&&&p&&&&&&&&&&-&=&s&&& l&l&.l&>l&k&&l&l&&&&&&;&K&`&p&&&5&E&!&!&#&#&'&'&(&(&)&)&&&&'&+(%&,`t p\@##@$d$%&&(()@P)++,`T.t.P///.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.cst8.rodata.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @0 @=x2&0`,0`0120`E7xX@@pO9hJ@t8T:8a:Hn:Xi@v0 :p_@v0mf-@.8S0@30Ѓ)@3H`0 $0% %4@3X o++( 8  5`6misc.bd.o/ 0 0 0 644 41696 ` ELF @@||#x!H`="=BJ8)})j|xj),)A@<xx|8H`xH`8!|N `=-9)i9C|cIN ``=-9)I9J| @IM |<| Ax|9 8!>N |,$|~x!A@#, @4x;^{$;|jH*H`>| Ax9 ~>H`8!|N `=");!,)A="), @;8!{N |=")m XS/*/?0!%1!%2!%3!%4!%5!%NS&x@!A[!\!]!^ } G29;;;B&>G2T&d6?C"  "% ((+0.;82@6H9P=XA `C hFGpIGxLGPGTG[G`;rGtwGy `{ j} t;; y&;GGGG  (0 8Did@H&P X `GhGp;x;;  GGG;G;;  H&  E F #G 8H ep  @ ` ` ; ;    e  o  ~    @ jmpA B `CC  &d(22  ). Ebuf/ 85 5 end5 5 ptr5 5 5(507 8 &9 7: &8< ,< ,end< ,< ,ptr< ,< , <(<0 > e? &mem@ 7maxA 78C C endC C ptrC C C(C0 1  : 60 <  H! T" `# l$ ? Q l F G / *Hf  Z .I} AJc "m i="z * KS  "^  L$S MgES T1UD tbl-6+  8-,C<D N\-tbl..7/#i tbl/D $i S U3$Otbl+@ #res+ 0 P-tbl1.F #res/1 1  Pptbl-6 ST3$ l+4F4F TSUT TU .S2 @fmt3argD TSUT .S22nmsgn/$app q%+s  s QFSST A E|S T1U= JTUNS: aiamsga.%*ci cG$apd  JZU  SYmsgS%Ui UGV Y{W  i,ST U WS JJTU SjR6 IDS T UK DP(D(FS T UGS@(26T61 6>3{: SSTT ES T1U6 .d.'.= .J3{3 STTU T U '{'$ '1( ;SS fT VW STs404 E-8,CLD55 : ; 9 I8 I~ !I : ; 9 I 8  :!; 9!I!8: ; 9 II:!; 9 IB $ >  H} < .?:!; 9 '@z H}H} : ; 9!4:!;9 I?< : ; 9 I8 :!; 9 IB4G:!; 9 1B41BI!I/ 4:!; 9 IB( :!;9 I4:!; 9 I.?: ; 9 'I< UGI : ; 9 I ! :!;9 I8 ".?:!;9! 'I<#4:!; 9 I$4:!; 9 IB% U&&I'7I(4: ; 9 I?<) !!: ; 9!* :! ; 9 I8+1RB UX!Y W , 1-:!; 9 I.:!; 9 I/ 0 1U14:!; 9 I2.?:!; 9 '@z31RB X!Y W!4.1@z5.?<n:!;!6% U7 I8$ > 9 :: ; 9 ; : ; 9 <&=I >> I: ; 9 ?'@'A : ;9 B5IC  : ; 9 D : ; 9 I 8E : ; 9 I 8 F4G: ;9 G4: ;9 IH.?: ; 9 '<I.?: ;9 '<J.?: ;9 '<K.?: ; 9 '<L.?: ;9 '@zM.?: ;9 'I@zN.?: ; 9 ' O.?: ; 9 'I@zP.?: ; 9 'I QH}R!I/S.?: ; 9 'I@zT.: ;9 ' 0S0xnxS0T0TTT S Tn0 o ,@S@mS@T@kT@0@@lL\o\l(S(ToTXSXSoSo(T(PnPXTXTnTnT4nHTnTnS4oHSoS(m(0$SS<ostdatomic.h7 &7g0=,!!. v=< fK!h!=!".:0 ?.;!W/ t.  o*!/. XLu<L"[u. 'zXX =<0"Ot#!  jf/zx.JgY !-!/ /kY;!= /Y t 0$1 !/!.[ Z  !5  / =. p \+. /#>/!" .Xx X. tiJ l   !5 (x / =!. <i .K</# 0/!"7%# <.w=!)t.) %<f ! ! My 'w.y.!J) .) %<J & z /<6f-&!!/ O!E>!  0j!-/ .Y /!=D}JDK!=levelc_stack_linksize_tallocated_words_resumedmark_stackcaml_verb_gcmemory_order_acquire__jmp_buf_tagcaml_ext_table_init_IO_codecvtbacktrace_slotephe_infomemprof_IO_save_endcaml_minor_gc_end_hookcaml_runtime_warnings_firstcaml_debug_abortcaml_raise_out_of_memoryextra_heap_resources_IO_write_basecaml_finalise_end_hook_lockcaml_fatal_errorshared_heapcaml_heap_stateblock_IO_save_basecaml_stat_allocrequested_major_slicecaml_ref_table_chainephe_cur_columnslice_targetcaml_custom_tablestat_promoted_wordscontentslong intlocal_rootsmemmovetrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_failed_assertcaml_ext_table_add_IO_markerfmtbufdependent_sizenoalloccaml_intern_statestat_blocks_markedcaml_finalise_begin_hookruntime/misc.ccaml_final_infomemprof_domain_scaml_bad_caml_statecompare_unorderednew_capacitycaml_minor_tablesntablessigned charcaml_fatal_error_arg2_IO_FILEtrap_sp_off_IO_wide_dataabortinit_capaunsigned char_freeres_listbacktrace_last_exncaml_custom_elt__atomic_load_ptrcaml_statefinal_info__builtin_va_listcaml_minor_gc_begin_hookfile_os__gnuc_va_list_Boolcaml_ext_table_clearvaluecaml_gc_policycharcaml_ephe_ref_tablecapacity_IO_lock_textra_paramsmemory_order_acq_relmajor_work_done_between_slices_IO_read_ptryoung_startcaml_runtime_warnings_activecaml_stat_stringextern_state_markersfilesweeping_donetablesreservefatal_error_hookcaml_print_loccaml_exception_context_offsetfmt1fmt2noalloc_leveloo_next_id_localminor_heap_wsz__builtin_fwritelong unsigned intcaml_major_slice_begin_hookcaml_runtime_warnings_flags2dependent_allocatedcaml_fatal_error_hook_IO_read_baseslice_budgetexn_bucketlinearg1arg2_unused2longjmp_buffercurr__mask_was_saveduintptr_tcaml_timing_hookcaml_gc_logyoung_end_old_offsetexternal_raiseargsc_stacksigjmp_bufsnprintfgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_doneva_listtrap_barrier_blockatomic_uintnatext_table__builtin_fputccaml_ephe_infomemory_order_consumememory_order_seq_cstdouble_IO_write_endcaml_ext_table_removecaml_extern_statememory_order_releaseswept_wordscaml_stat_strdupthreshold_IO_buf_baseunsigned intcaml__roots_blockcaml_stat_resize_noexcintptr_tgc_regs_bucketscaml_major_slice_end_hook__pad5requested_external_interrupt__int128 unsignedcurrent_ramp_up_allocated_words_diff_flagsoffset__saved_mask_mode__jmpbuf_codecvt__jmp_bufnitemsallocated_wordsnextyoung_limitlong doubleFILEhookunique_idcaml_noalloc_endallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcaml_stat_block__off_tcaml_abortallocated_words_suspended_freeres_bufephe_refinside_stw_handlernew_contentscaml_ext_table_add_noexc_IO_backup_base_shortbufchar_os__int128__off64_tbacktrace_activefputcstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policy_IO_buf_endfprintfcaml_gc_message__atomic_load_tmpcurrent_stackstderrshort intrequested_global_major_slicecaml_fatal_error_arg_vtable_offsetcaml_noalloc_beginextra_params_area__valexn_handler__int64_textra_heap_resources_minoryoung_ptr_IO_read_endasize_tdls_rootmlsize_tstack_infostat_minor_wordslocked_filenocaml_stat_freecaml_ext_table_free_wide_datafree_entriesshort unsigned intbasemajor_ref_IO_write_ptrintern_state/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatexitcaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tdatafflushvfprintffwritecaml_alloc_point_hereexprmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA $C ACA~YDA@dD AEA~`TDA~|(PPpA~DMpA~4AL C A AAABEA~YAAAAA,AK D A AADA~HAAA(FA~H@GpA~ `lE AHA~$PC ADA~EDA8BCL BA E ABBA~N AAD HAADBCN BC A ABCA~Q AAD FAA AAAA~00F ADEA~bGA(dCF AABA~KAABB(C ACA~EKFCA(CBH BA A AGA~HA$EpA~    29H6Yhd{0TH(`PxD@.3lIP]m 8Ph-$AWmz (08@misc.cnoalloc_levelcaml_runtime_warnings_firststderrcaml_print_loccaml_stat_strdupcaml_stat_freecaml_failed_assertfflushcaml_debug_abortfwritecaml_noalloc_begincaml_noalloc_endcaml_alloc_point_herecaml_gc_logsnprintfvfprintfcaml_gc_messagecaml_fatal_errorfputccaml_fatal_error_argexitcaml_fatal_error_arg2caml_ext_table_initcaml_stat_alloccaml_ext_table_add_noexccaml_stat_resize_noexccaml_ext_table_addcaml_raise_out_of_memorycaml_ext_table_removememmovecaml_ext_table_clearcaml_ext_table_freecaml_runtime_warnings_activecaml_bad_caml_statecaml_runtime_warningscaml_fatal_error_hookcaml_verb_gccaml_finalise_end_hookcaml_finalise_begin_hookcaml_minor_gc_end_hookcaml_minor_gc_begin_hookcaml_major_slice_end_hookcaml_major_slice_begin_hook "Z&2*@2X4CR2b0d p H F H F2@2P0@0P " H& F:2@>2hF0@J0hT 2@ZXC20# 2@ $ , ~2@2@$  226@h' r2v@~20 $ ( 2@ * &2*@H \ h* - X/ h/ 1 L 3    2@2 0 &2 *@ .2 :0 D R2 V0 v2 z0 & &&3& 30&d83H&P3`&h3x& 3&p3&`3&3&3&3&3 &(38&@3P&X3h&p3&P3&3& p3$ *2.@22 :0 @ L t z2~@2808    x  &+9*>vKCVbi p w~ l #   # -  # 0 !=J Wdwq~ gn4  S    4 ' 4B UNVz eC   I$ V0<KHuY v_  \ * pJ 8 1<= oIUUam<y G =X'8 ;I p =~ 0*  W  Ti _ pu&24BP (^ zl z  ,8   "N0<H vT ` l6x j _ 2 v j " O.: FWR^ Jjv@%@  Dm  A  2  - , 8 9 F ! S fa p v     ,  ) W -  $ 0 J dQ q ~     `    Q   2 > f r  Q      Y @& '?& 8>& I=& Z<& k;& t N :& 9& 8&  & 8   ?  /R B K jg   o  -  : & p& &<*&A& LR&h ~n&P  3/&`MKa]&l{u&&!9 N&]c&&T&&"%g)Y=&FtUYbfktt x 64&p& j` ]&`m&=IACFPiTeY&qw&&P&d&p, 2&SWfjo&&Y&@8hf ZzvO9& E"&,&hG&pT&i&}&& 5&`/ :& E!%+?9=B&[&ou&p :& E=;OLJ& &-&(K&4kq& &X&h&@ i&]Yvt& &P&@. 9&LR&dinsw|&&&x&&8&} &",05n?CHRV_&Th&Tz&(&H& &T&n0 *SO#& <&lQ&g&x| &og_ & +%LH&&;j?dFJO SQ&P4&PN&`b&`|&l&&&#&h&&&& &d7&pJ&j&&&&&&&A&i&{&D&D&`&`&&&p>&M&^&w&&d&d&&&&1&T&<p&&&&T &`,&M&k& & &0&d &p&0&`@&P&`&u&&&&T&&&d&%&Ddd p`,Ld4hP p.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rela.text.unlikely.tbss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @VX& , H12 E @@^hO J@^Y T@bP h `s `Xn@c`.P &9+@2wP@`2@83v@(00;%0J J0@XM0 SH obj.bd.o/ 0 0 0 644 54272 ` ELF̀@@;|#x!q|x8`]UI>| @="))| H@L,()At|yI})+x}|(P@ } @L,@ 8`8!xcN (A08cK```8`K``K|<xc 8H`|K,```pj|ix@8pj8`L i|@L,xc 8cN ```8`N ```|x$!|d*H`8!p|N ``E|ixx$8`}DI*N ```||ct(|t!A(A(A4xd xH`8!|N ```(?@xx8H`9 8!#|N ```,?A88xH`{$9 ;8!}?*|N @@H`a8! |N ```xx H`AX(?9 ;aJCAs9@{B}IX9I|8*|A*9)X|8*|A*BK````x xH`X{$aH`K,``x H`8! |N `X,(A9  @DK<A9Ap9 8@9^9A8!8`!!!!xpAH`!@a#`Ba8!|N <, L cN ``pi@\|88!H|ix8`, A8!p|N 8!p8`|N ```8`N ```9H}J0*|* AX}(Kx}(:|8})pa)}*yJ$A} 8`y)$})0*|) L 9(})y)$|i0*N ``8K```?!j>,)AipjA$9C8!xcI8cN |=9}@@8|A@L,jI?,)Api8!9Cxc8cIN ``|<|KD```|<( A|( A0=, AD`B={޲y)|>H@D,>AspP;A(|};H`yA@``|};;H`|};H`7@p|8!8`N ``$y)@=_U)>| PA|<y),)@xxH`9 8!8`>|N ``$| H@L,U)>9) ( A9@E}IL6q)AH8!8`|N < ?|  :?G " c ~ c c "c %c  (m( +0 .8 2w@ 6|H 9cP =cX A` Ch Fp Ix L P T [ ` r t w y { }     ~ H(80(8Hid H@HHP-X-`hpx9CH|chrmEFOG8Hp@    # 4>@|jmpA2BCH) & " 22)*`:?1 2! H2"I :)F1.2Jbuf/ "2"3855end55ptr55 58(580c78 9 : 8<X<Xend<X<Xptr<X<X <8(<80>? mem@ maxA 8CCendCCptrCC C8(C80]"]~  c (:K ^*O*H*O! (L~ 3, 4| |  ^/ . M"3- $ #, >+ ^2.4 uN e O HOd O 7 p p-p:tagsH5 s &#$ 2+ # &# 2 = > J } 1     z OST gT uS T U }J<J(J5%L tagM  ^i`#%a%a- ii z S"8 z S"8 zS"8 Q<     g     5 h 6    YM     \     \     _ v     uS T U Z uS T U d uS T U e uBS T U h uuS T U Y uS T U ] uS T U \E8&E- S1T0P;P&;.7=84x&4'76#,n#+t,obj&Qv Rt  uCS T U  uS T U 89v(!,obj.Stag9T% liHhiHmi$Htt v3 SSTU8D v--  &$ 2- # & 2 = > J v3STU uS T U STU v/ASTU usS T U STUT H blk"+H8Hhd tag |U| ^ V$  :  W    :  . $  + X w jX  T [:!~ v. H;res` ~H #S1T uS T Ud obj*L v1 f:1=res  SSTTUUVV S1 v+<4T T arg#YTTS`( arg9 H;resP ~Hsz tg .V' ^.qi(i' .Z  6    %S'  #JS bS!|U3$ uS T UF tagF%F0resH szI tgJ  ISTS1& gST ST S ?$ arg?- pos?8<?CU98I arg9) pos94' 4T  arg4#+ 6 &#$ 2- # & 2 = > J/# H X=arg#[hd% 0//\| &3|&3|9locI ](/m 0o o /+ =val80  >tP!  u!ZS T U  uS T U >P8! _l SS1&T0^I~ : ; 9 I 8  :! ; 9!I!841B : ; 9 I8  !IIH} 1B :!; 9 IB : ; 9 I $ >  H}.?:!; 9!'I@z 14:!; 9 IB4:!; 9 IB< : ; 9 I8 4: ; 9 I : ; 9!.?: ; 9 'I<4:!;9 IB1RB X!YW !I/ ( .?:!;9!'I@z:!; 9 IBI:!;9 IB  4:!; 9!I!&I"4: ; 9 I?<# U$41%4:!;9 IB&: ;9 I'H}(:! ;9 I): ; 9 I * :!;9 I8 +1RB UX!Y W ,:!;9 IB-1RB X!Y W . U/.: ; 9 'I 0 1 !!: ; 9!2 :!; 9 I83.?:!; 9!'<4.?: ;9 'I<51RB UX!YW 6 1U74:!;9! I8.?:!;9!'I !9: ;9 I:1RB X!Y W ;4:!; 9!I<:!; 9 I=: ; 9 I>.1@z?% @$ > A BGIC : ; 9 D&E> I: ; 9 F5IG  : ; 9 H : ; 9 I 8II J : ; 9 I 8 K : ;9 L4: ;9 IM.?: ; 9 '<N.?: ;9 '<O.?: ; 9 '<P.?: ;9 'IQ4: ;9 I R1RB UX YW S: ;9 IT.: ; 9 'I@zU4: ; 9 IV4I4W1X1RB X YW YH}Z1RB UX Y W [4: ; 9 I\.: ;9 'I ].: ; 9 ' ^.?<n: ; !!S!"n""S""S""n""S""S"#n!!T!"o""T""T""o""T""T"#o""y""Y""y!!T""T""T""Y""tx""Y!!S!!sx!!YSmSSmSmSm S S m S !mToxTToToToT o x T o T !onnny:%YZw Y ZYYY!010101010101 0 1000 0 " 0101010SsxYoxnmxYTtxYTtxZ !ZSsxYoxYSSSsSnSnSnS1X1X1XSSSV3XXWWYY xw"1&1!YSSSSSSSSYsxYSoSSoSSoSSoS S oSo T nTn U U$tZZ$(z(8Y8zYz 0 |SSsSSPxz u $ &!z u $ &!z u $ &! $m$ZHXYY    SsS S S q#0 o 0 0 ` S S Y S S Y S S T T U U V V o S S S S T SS S q#0T T q#8l l  l 0 0:%oo  o TT T T S010SVvxoSSTTTTTTTTSSSoT1&oT1&oT1&oSTS1&SS1&SS1&SS1&SYTTSSTTSYSYSYSYYSyxSSSz1$#Sz1$#SSz1$#SSs1&SS1&,     !!!!!!"""" runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesobj.cmlvalues.hdomain.hplatform.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.haddress_class.halloc.hstring.hstdatomic.hsignals.h x +o   "/ .J3 .t'J r }/ J ~ >!   <..}q  n  " . z  J f w'" 0 /!"!x &z  y !t . X  /%<cX/  / e !.oX/  /   q !E <`=!-//.  7.I /-/-!-/=+0  O!!  1 2 .  ..$ ! ' -!#-1?n  < rf .7/ < ! '75 # J'.7'  7 5 # '7 ' 7 5 # X  = -!U< < 's<7 '  7 5 # .s  XX!  .@! jK.! /Ji  ! <<J f!z=;/!. / > #/;!0 /!! <<z..XXY> =JF.ZKJ[Y> =JF.ZKJ[ ~   z. J  / "i-#+1  !5 V" d"{ ! ! "  /  ! ! ,&8  8.$.8<! 7# + t+/+!<. 2"/E"# ."0!Xz .ff.0L!+hu+xXJ. 2.!x (!.uX"# .(x..!&!.Xt .ff.6x.J!&!..h t ", 0/   !- //= @"+~       <.!=!+~   .!+~  /X/-!%- =-/%- !%-J k+~   !  J  X!tt +~  +   /=/+~    <u ! %! ! %./ = %! % % %/ ! %  y   $  J.t }   }J  }. +~   /K$*!.  }J J }  J2! J z.   c_stack_linksize_tallocated_words_resumedmark_stack__atomic_compare_exchange_ptrwosizememory_order_acquiredependent_sizecaml__roots_new_tag_vcaml_plat_spin_stepint32_tbacktrace_slotephe_infocaml_get_public_methodcaml_allocmemprofcaml_process_pending_actions__func__caml_atomic_cas_fieldextra_heap_resourcescaml_lazy_read_resultshared_heapcaml_heap_statemax_spinscaml__dummy_vrequested_major_slicecaml_ref_tableobj_tagepheslice_targetheader_tcaml_minor_heaps_endcaml_custom_tablestat_promoted_wordscaml_obj_is_sharedlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml__spins_204caml_alloc_dummyold_tagcaml_intern_statecaml_fresh_oo_idstat_blocks_markedcaml__roots_rescaml_final_infomemprof_domain_scompare_unorderedcaml_initializecaml_minor_tablesntablessigned chartrap_sp_offnew_tagunsigned charcaml_lazy_reset_to_lazy__int128 unsignedbacktrace_last_exncaml_alloc_dummy_floatcaml_custom_elt__atomic_load_ptrcaml_statefinal_info_Boolcaml_obj_tagvaluecaml_gc_policycharcaml_ephe_ref_tablecaml_plat_spin_back_offextra_paramscaml_alloc_dummy_lazy__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml__roots_vextern_state__jmp_buf_tagyoung_startoldvobj_update_tagcaml_domain_alonecaml_alloc_smallfilesweeping_donecaml_obj_set_raw_fieldtablescaml_update_dummy_lazyreservecaml_exception_contextfunctioncaml_atomcaml_invalid_argumentcaml_obj_blockoo_next_id_localminor_heap_wszcaml__framelong unsigned intdependent_allocatedslice_budgetexn_bucketlinelongjmp_buffer__mask_was_saveduintptr_tyoung_endruntime/obj.cexternal_raisec_stacksigjmp_bufspinscaml_set_oo_idgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockcaml_lazy_update_to_forwardcaml_ephe_infomemory_order_consumememory_order_seq_cstoo_next_iddoublecaml_minor_heaps_startcaml_extern_statememory_order_releasenew_tag_vmethsswept_wordsthresholdcaml__temp_resultunsigned intcaml__roots_blockintptr_tgc_regs_bucketscaml_modifycaml_obj_raw_fieldrequested_external_interruptcaml_int_as_pointerbits__atomic_compare_exchange_tmpcurrent_ramp_up_allocated_words_diffoffset__saved_maskblock__jmpbufnewvalcaml_obj_with_tag__jmp_bufnitemsallocated_wordsnextyoung_limitlong doublecaml__dummy_resunique_idallocated_words_directaction_pendingbacktrace_poscaml_num_domains_runningsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcpu_relaxcaml_lazy_make_forwardallocated_words_suspendedephe_refinside_stw_handlercaml__dummy_new_tag_vcaml__loc_204caml_failed_assertchar_os__int128backtrace_activestat_major_wordsdummymemprof_young_triggerrequested_minor_gcyoung_triggergc_policycaml__temp_d__atomic_load_tmpcaml_alloc_shrcaml__temp_icurrent_stackatomic_uintnatshort intcaml_obj_add_offsetrequested_global_major_slicecaml_update_dummyextra_params_areatag_t__valexn_handlercaml_obj_compare_and_swapcaml_copy_nativeint__int64_tcaml_plat_srclocextra_heap_resources_minormemcpyyoung_ptrunitcaml_local_roots_ptrcaml_lazy_update_to_forcingasize_tdls_rootmlsize_tstack_infostat_minor_wordslockedcaml_obj_dupshort unsigned intbasemajor_refnewvintern_stateHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatcaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tcaml__1000_204caml_check_urgent_gcmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 0BDZ DA N AEA~EALT`8DpA~DBA$8D ACA~J CAD H DAD J DAA <`C AFA~eRC EAD q EAB  $ 8LDA~GDA\d(pC AEA~_ DAA ,B ACA~H DAC LDA,B ACA~H DAC LDA8$tGpA~F BAA ACA8DLPBBJ EA O FC A AFA~EAE AFA~EAAGLBCM FD O ID A AFA~EAE AFA~EBAI8EpA~CBA8EpA~CBA88EpA~CBAlX<BDH ABA~P[AAA DC I AFA~DAAA~B AB XAu AFA~DAB AFA~DAB AFA~DA4D ADA~K FAC N EAA    ! ,  <UmTz08H$`x`$ARYcv Ld2J f88|PthP88 8!<3?(obj.cobj_update_tag__func__.0oo_next_idcaml__loc_204.1caml_num_domains_runningcaml_plat_spin_back_offcaml_obj_tagcaml_obj_raw_fieldcaml_copy_nativeintcaml_obj_set_raw_fieldcaml_obj_blockcaml_alloccaml_invalid_argumentcaml_obj_with_tagcaml_statecaml_alloc_shrcaml_initializecaml_process_pending_actionscaml_alloc_smallmemcpycaml_atomcaml_failed_assertcaml_obj_dupcaml_obj_add_offsetcaml_obj_compare_and_swapcaml_atomic_cas_fieldcaml_check_urgent_gccaml_minor_heaps_endcaml_minor_heaps_startcaml_obj_is_sharedcaml_lazy_make_forwardcaml_lazy_reset_to_lazycaml_lazy_update_to_forwardcaml_lazy_read_resultcaml_lazy_update_to_forcingcaml_get_public_methodcaml_fresh_oo_idcaml_set_oo_idcaml_int_as_pointercaml_alloc_dummycaml_alloc_dummy_floatcaml_alloc_dummy_lazycaml_update_dummycaml_modifycaml_update_dummy_lazy226@ 2 0   P  20 !Z!X!C" # $ %  & ' 22 0"0 $( P , - 2@2@N!ZR!XT!C% 22 00 ( L r2v28z0~08(   228008$( 8  !Z !X !C 2 0 !C f2 j2 r0 v0 |( 2 2 0 0 ( !Z !X !C v2 z0 !C 2 2 0 0 ( &2 *2 20 60 <(   D > 0> D> 22p00p( 2200( 2200( "2&2.0204( 22X"0&0X,( F2J2R0V0\( v2z200( > P= r2v2~00( &.&/&&3& 30&p83H&P3`&h3x&3&@3&`3&3&3&@3& 3 &(38&`@3P&X3h& p3& 3& 3& 3& 3& 3& 03& p3(&03& & m P&*/ =D W&c&jDq xdOD   N nY p  . 9 S 4Y_\ekqz      # 1?cM 9[ i w  w ,R0 l  j-;'I GW1e/s     & )\C O [1g isq <  R P;'_3{?K WWi s* -  -,\ |< eU $h05?I{b/o)  [ 9H & 98DP\ (v3L s   + (31L> Ks^j 3 (3L s   ) X 7+ D4 Q d r& { ?      p $ ? _ v    : \ &     B k [ / 3 <& E U Y ^ l& u      &     & &   &   '# +! 2& P&T h& y& &  & p  G +  B    h T   &l 'U +9 0 5  @ D I Q T X _& }  & &8 &L & & SQ& %])[2i6gA& J& fsjqs& }{& ||&&!&6:CGR&@[&@w{&@&D&D&D  &h!&h=AJ&h_&c$l2p0w&&p&&&&&&&&<%&2&C&4X&Xe&v&d&&&&&d& 0 > :& L'8 EUQ` mUy& TP& se& X & && 3&D& DU& b&u& !) %@8" +&JnNfS&uF~&`&`&`&h&h  &h+/8<ErN&mqv&&,&8&&<r& $&PB&W&8d&t&&]Uz\ x#( 6 A &JS&Ph7t~71& & & zx&0&0 &0$(3&< GKTXaen&w&& & S&@    !+ "/ AO Y -] +b&w= : 6&& & && T  J &8 < {I M R\ ` e 7o s   && &`     &@6 : ?&TU I^&u !  A ;  e [        $ ( -=6=@ D I&WHh l r& ( &&2= 3 1&h' = ;' G E S Q&&&3& K&c&}&,& && _ [   q      C$ 1)& J&Xh&&&>&    &p  $ 3 7 <&JS&t x &  &(&( 8 6 B @&( L J  X  V  ? K ^ Y k xx  I    ^  I   ^!& ! p!# `!(& !=& !J&![& !l& !y&!& ! ! ! ! !& ! !z & &&& ?& 0Pdp@(`<`t@ `< P     < 0\ p.symtab.strtab.shstrtab.rela.text.data.bss.rela.toc.rela.opd.rodata.str1.8.rodata.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@w &,61@H@@;@E28/Thax\@0 y!t@> 7x= @Ȱ0K0@0KL@00\#C0jf j@@@n tVˀparsing.bd.o/ 0 0 0 644 37136 ` ELFP@@|x!=bk!A+)(,)@(?j>,)AX)(, A<|?x8~H`~H`|8!N |<|K|}&|tAa(!!A =BJx|zx|#x|3x}**})R})N hhX|!$phDdx|3x9tt)y){$9)@AW*<!{{"}J8|`:(8})PtW@.J,@=0})t, }(Kx@iyJy){9J9);]p8`=xh8!Aa} N `hpdxt{"{{",Ap|?b!;{H `;{$Z8|@*|tT<})} J}JH(})tU)@.})R, AT9), AHZP}Jt| PA8U):x,@4HD```#x:H`,8c9A9, @?";9<&x~x8H`p@%, A %, A8`_H`pA(H8x;9H`,8cA?, @?;<x~x8H`K$```=}|H*|xH`K0`?"9}9j),)A<)(, A{"K<`!U)<}?;?`}&Ȯ|})tU)@.})*| @A4!K,``!|KState %d: read token %s State %d: read token %s(%ld%g) Recovering in state %d Discarding state %d No more states to discard Discarding last token read State %d: shift to state %d State %d: reduce by rule %d %$:(M&WW'int,(W 1E36 7 8 9 : (; 0< 8= @@ HA PB XD^`FchHpItJ xMjNxOhQxY [\]c^ _ .`b)+ YWx:Q } W:4AE ^  W Z: l m*  O. XNWB29 ;+k > w k:?, " 6"% ((+0.82@6H9P=XA`ChF pI xL P T [ `r t_w yE{O}Y^k    6 (#0h8-id@HkPmXm` h pxy    k   EFG[8Hp  @EE   w J TS c t ~  . & 22 85"5" end5"5" ptr5"5" 5#(5#0 7[8 k9 |: k 8<< end<< ptr<< <#(<#0' >? k mem@ | maxA | 8C dC d endC dC d ptrC dC d C#(C#0 :    " %& #( *  (+  0,  8-  @/  H0  P1  X2  `3  h4  p6  x7  8  9  :   N=(     k k! k lhs"  len# $ (% 0& 8' @( H) kP* X+ `, kh- p. x 1 v2 k3 k4 k5 k6 k 7 k(8 k09 k8: k@; kH asp< kP= kX> k` sp? kh@ kpA kx/qN m   A. 0 ^   !1 e 5  2  M 3, d  k44k4*54,k6 k66  S T U S T U 77k M(k7k"cmd(k"arg3kM envR sp | asp| n n1 n2 m##|k Mj|k M8&|$&k M )|$)k M , S T U ?4)9:K[|wl S[ywl S ?ST UVWS_S T1U2  ST UV T  T  M#TW;SWZS WS TU M MS8WS  MS8T1WS W*S T 5S T .  ; &! ap  S T U TU8 < =s Vs5VsA>toktk?vv k @jj-j8 : ; 9 I8 I~ !I :!; 9!I!8  :!; 9!I!8: ; 9 IH}$ >  I < : ; 9 I8  : ; 9! 4:!; 9 IBH}4:!;9 IBH}1B(  :!; 9!&I1RBUX!Y W I!I/ 4:!; 9 IB:!; 9 I4: ; 9 I?<:! ;9 I.?: ;9 'I<:!; 9 IB .?<n:!;! 7I!":!; 9 IB# :!;9!$4:!;9 I%% & I'$ > ( ): ; 9 *GI+5I,  : ; 9 - : ; 9 I 8.: ; 9 I /> I: ; 9 0.?: ; 9 'I<1.?: ;9 '<2.?: ;9 '<3.?: ; 9 '<4.?: ;9 'I@z5: ;9 IB61RBUX YW 7.?: ; 9 'I@z8 U9 U:41B;.: ; 9 '@z<.: ; 9 'I =.: ; 9 ' >: ; 9 I?4: ; 9 I@.: ; 9 'I  SSSSSS13SjSSjS j S j S j S S jSjSjSSTmTTmT m T m T m T T mTmTmTTUUVoVVVV V V V V V V o VoVVoVoVoVoVVSjSSjS j S j S j S S jSjSjSSTmTTmT m T m T m T T mTmTmTTilt1&l0k l Y t1& l t1& Y h lhllYhihlYllhlhnnn Z n Z nnZnZnnoo1&kk k k k t1& 1&kkkt1&1&1&kkkooUioYy~x8$8&8$x"/t1$ $ &8"#8$8&8$t1$ $ &8"" Y wv"8$8&8$u" v"8$8&8$u" v"8$8&8$x"" !v"8$8&8$v"1"Y8w"8$8&8$v"8w"8$8&8$8z""Yvw"8$8&8$z"v"8$8&8$x""!v"8$8&8$v"1"8w"8$8&8$8z""!v"8$8&8$v"1"/t1$ $ &8"#8$8&8$t1$ $ &8""yYx8$8&8$x"#2t1$ $ &8"#8$8&8$t1$ $ &8""# t1&y" ty" wv"8$8&8$t"u" v"8$8&8$t"u" "v"8$8&8$x""t" $v"8$8&8$v"1"t"yx"Yyx"YY2t1$ $ &8"#8$8&8$t1$ $ &8""#Z vu"8$8&8$v"" u"8$8&8$"" "#8$8&8$"""#8$8&8$"""#8$8&8$""T t1& TT n  n nnnohjUUUUggiV1&iio\S\oSSoh|8|U8,$4h    runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includeruntime/camlparsing.cstddef.hstdarg.htypes.hstruct_FILE.hFILE.hstdio.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hstartup_aux.hstring.h4  y4G41q$ '<J$.BXKZ< 's .J.t(x 6z xnu"/!  !! = ! ! ! < <J  J X!/ .  !X K! <<Xf".  ] r  / / t ! -!). . / JDI O /< /=<H.  . !  % * ! .!.< Y! /% z !!  /!$ .! !#! !!  J "< <!+"!%.   /.@s0  J k " ..! KXX  <.f" J o ! .<t=TJ+Jf !!/<! 3 K$'<J$.X7 -!< /- X!-!%.  L X!-!%.   / < @IL   X!  %=m  p Z'", "',!<  v! 0  ! 0 ?=t/XJ  ! . J  .0Y D <.! C= 'f< ."./ .. K! !f/!.!0 K$<ks %/p  s 0'", "',!<    t'~J$.<k<   @f J.y  '!?I> " " "  .!! ! !fU.+!    < .EX jv6}04parsing.cprint_tracecaml_paramsstderrcaml_statevfprintffflushcaml_failed_assertcaml_parse_enginecaml_modifystrlenfputcfwritefputscaml_debug_abortcaml_set_parser_trace2@FZJXLCn2r@  2200 "2&@  20x 20 2( 0( h |  N2R@ ZXC2@ >20B00F2`V0`X  20  F2 J0 P  *2 .@ H n20 r00 v2@ 0@   Z X C B2 J0 P Z2 b0  2 0  2 2 C "0 &0 ( z2 ~0   2 0 2 @ Z X C f2 j2 r0 v0  2 2 0 0  &&&H&3& 30& 83   &*/ =BO{Zfm t1{  ) L  U d  '$4 hAN [hu+ >C  E ' % zu+ 8F R Z*~K1  n mP u  $ q27LC Ti`l}   b Nb) P    Y #Y.z9 D1O$Ze <p { ` ^ xp   3 f!- 9 =E|Q `]wi  y 3<O$   +7MC O[g9sJ     11> + 08KUjdpu;z e  ( 4>A N \h  Fj  # = J  W l s   T    t  j  `    C  # 0 =z J W d q ~ |  T  ,  L   s   - : G T a n[ { 2     |   `   7 3  6a C \ i w z  :   M    "    6 Ni ej q&     P L &  & & & &  &&+6&M W [ a`j Jn "}   -  -        ' # X 6  $ D( 6  |:  \G  K  P Z  ^  c 8h&qw& & 5& `&\& T&D&&pW    V    & &5W@  D  IVT  X  ]&k tW    V&& W    V& & +& 0&&1& @; EJ  *N  (W  4[  2d  >h  <m Ev  Nz  F& d  q  k    & & 4 o        & P&`*&`@&X&m&&& &@& && &&  &$&|<&Q&[&p&(&p&& T&& & T&& &+& <&Xn_&v C        &  &&&&& X*5\ 8m x    2 &&X .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @$@Up &d,d12hEE@@_HOHJ@_HYT@_( e%s) 60@067 @0AB 0OM Op@HoQxQ0 T`platform.bd.o/ 0 0 0 644 51744 ` ELF @@|8|x|#x!8pH`x|ex| H@L,| @99 8x8x8`A8!|N |8|dxx`9 9888`!H`8!p|N |N ``N |9@} (}@-@L,( M |8|dxx`9 9888`!H`8!p|N |9@|x!|} (, @ }@-@L,H``H`?| H@L,( 99 888x8`A8!|N `l|#xC|}(}@-@L,|H@M |8|dxx`9 9888`!H`8!p|N ``||#x|x`!q|}@(| H@ -@L,{ H``H`?| H@L,|H@99 8x8x8`A8!|N ```?|~x!q,?;A,9@$8!|~|c8N |<(-9Ekey.  /  0  1 2> 3C((9>RFAGwS 5 5 6   HU-*$Q H +a  < H, , +`H _c K H  *H$^ H+7 *eH1 C..$ ] H, a H9 e HP m Hlq,l X HI,  H=  H C Hl  H l7  H l7  H <l n H S S  H tl t  H  SH j H  SH $ H5% k +k&locA  kIreqU`- v  S`T0S r  &mem ( 6  P ,STUP ^S T UV |ST ST S T U S T U  &mem +  tS T UV1ST% Y&mem *  S T UVH )STS T U %L  &HJmem .   ST>S T UVckS #TUS T US #S T U %   )  7*S T U ~ ~6 2IB5( O [> \ h8L   !0jx j0 k,Il  stKgmm .wwwzSTSUV W0X0Y0^ ^3_/B/5( O [ \Lh8H/   !0QvftxQ2vR7S7U9V V HpU H6.JMJJMSTSUV W0X0Y0@:ftx@vS;:ftx;vSN<1T;7ftx70v;0ftx0,v1192 2 H*" S SSHF'0" S "SSH*" S 9SS%mut< 'C< S 'MS  %Sj" S PSTlG*OG0TP`` S*ST1vSTQ~ mR~5S=lml9q8 -"S  %Ss-S STSSUSSgHmg,ip" S SS]Lm]E=rcaHcS T!  >S! V< S VCWmC/XrFH3m38=rc5HY6 P>?>=@eS T }S yST2 <S XST <SZ*L*)err*5H[buf,w `STTwU  S T\A0m41Hm5]rH0(err4H1-<1 E+ : ?l < 'C< S 'M &S  %SS?    !^PSTSUV W0X0Y0I~I1BH} : ; 9 I8 : ; 9 I !IH} .?: ;9 'I< $ >  ( 41B :!;9 IB : ; 9 I4:!;9 IB.?:!; 9 '@z1RB UX!Y W .?:!;9!'@z : ; 9 : ;9 I&II.?: ; 9 'I<4:!;9 I: ;9 I:!; 9 IB:!; 9 IB : ; 9!  :!;9 I8 1RB UX!YW  U 1U!H}"1#!I/ $%.?:!;9 'I@z&:!;9 IB'1RB X!Y W (GI)4:!;9 I?<*.?:!;9 '<+.?: ; 9 '<,7I-1RB UX YW . /1 0.: ;9!' !1.: ;9 'I !2>! !I: ; 9 3: ;9 I4 :!;9 54G:!;9!64:!;9 I7.?:!; 9!'<81RB X!Y!W!9 ::!;9!,I;.?:!;9!' !<41=4:!; 9!IB> :!; 9!?.1@z@% A$ > B C : ; 9 D4: ; 9 I?<E : ; 9 I8 F!IG4G: ; H.?: ;9 '<I4: ;9 IJ4: ;9 IBK UL41 M4: ;9 I N: ;9 IO1RB X Y W P41Q.: ; 9 ' R: ; 9 IS4: ; 9 ITH}UH}V.?: ; 9 ' W: ; 9 IX4: ; 9 IY4: ; 9 IZ.?: ; 9 '@z[4: ; 9 I\!I/]4: ;9 I^.1@z SooTTTTnSnoSoSoTnTnSVnSToTSnSSnToTToSnSnSSnSnToTToToSVoSoSYYSnSSnSooSSnSSToTTTnVTTSToTTSToTnVnVSToTTooTYSTSTYz@@$'TZT@@$'Yz@@$'TZT@@$'stS#ZT@@$'STSZT@@$'XSTS SToT SToT 1 SToTSToTTooTY S T S S T S Y S T S S S S S S S S S SSnSnToToToSSTSoST SSnSnSoSSoSSoSooSSSS  ooSS  SSSSoSoooo  PtStmSmSSSSmomo  SLo T 'S'LTSSSSTSSST  S T n T T V o V T n n T Y S T S, a                     runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesplatform.cplatform.hmisc.hstddef.htypes.hstdint-uintn.hstdint.hconfig.htime_t.hstruct_timespec.hatomic_wide_counter.hthread-shared-types.hstruct_mutex.hpthreadtypes.hdomain.hstdatomic.hpthread.hlf_skiplist.htime.hosdeps.hunistd.hsignals.hsys.h *0"0 .  w./!!./!$ 0 J} M<} #} <. >/ 1 y. f ..} .<",0kZ/ K/.}!K. .}t=.}. J.}t<} ./1f.}T<.}!.9$#?.  ...}tvf. 2LJ<wK   </ 1 y. X ..}J}.<  ..}f=.}. J.}t=.}. J.}t=.}. J.<~t< u!+- K +!.+W#55!5!5e//8w/1h= .J1j=p JJ=p..:tr : x.:( x : x.f U=+- K +!.+W .;  !;"% < 1;3M .. <;3M..====/Q  =) W.f UJ+- K +!.+W J !-<   =   <. . = <  < ! f",L0(L %X2iJ tXJ/ J lXf/  XX!-K /!v K< T  !!&E.f 1h,"M?#1 1</>vLLJ wJuX "0:0Y6! !$.5 B z & z }   }   }   & y ' y }2J t.<atomic_uintnat__g_signals__size__lowmemory_order_releasesize_tuintptr_t__prevcaml_mem_decommit__alignuint64_tpthread_cond_waitlatchlike_wait__atomic_compare_exchange_tmpcaml_timespec_of_nsecnseccaml_round_up__g1_startcaml_plat_cond_init_auxcaml_plat_futex_value__wseqcaml_plat_pagesize__g1_orig_sizelong long unsigned intnanosleepcaml_failed_assert__nextpthread_mutexattr_talignpthread_cond_signalcaml_plat_mem_mapcheck_errsigned charcaml_plat_mutexfunctioncaml_plat_condpthread_mutex_destroy__g_refscond__atomic_store_tmppthread_mutex_tundesiredlong intPTHREAD_MUTEX_ERRORCHECK_NPsearch_levelcaml_mem_round_up_pageserror2caml_plat_srcloccaml_lockdepthlong long int__lockfutexdoublepthread_cond_init__pthread_list_t__atomic_wide_countererror1new_sense_word__pthread_mutex_sline__uint32_tactionmemory_order_seq_cstcaml_plat_futex_wordvaluepthread_condattr_initnew_sensePTHREAD_MUTEX_ERRORCHECKpthread_cond_destroycaml_fatal_error__atomic_exchange_ptr__int128GNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intexpected__kind__datacaml_mem_commitsyscallintnatdatasizeshort unsigned intpthread_cond_broadcastreserve_onlyuintnatcaml_plat_mem_decommitcaml_plat_assert_lockedpthread_mutexattr_initcurrent_sensecaml_plat_cond_initcontested__atomic_load_ptr__atomic_compare_exchange_ptrintptr_tmemory_order_relaxedpthread_mutex_initforwardpthread_mutexattr_destroycaml_plat_barrier_flip__ownercaml_gc_logsleep_nsecbarriercaml_plat_mutex_reinitcurrent_sense_wordPTHREAD_MUTEX_NORMALtailtv_nseccaml_plat_mmap_alignmentchar_oscaml_enter_blocking_section_no_pendingtv_secmemory_order_acquire/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_plat_barrier_wait_sensecaml_mem_mappthread_condattr_setclockcaml_strerrorgarbage_nextcaml_plat_latch_waitlf_skipcell__value32caml_plat_lock_non_blocking_actualPTHREAD_MUTEX_RECURSIVE_NPtime_tarrived__pthread_internal_list__uint64_tcaml_plat_spin_back_offtop_levelmemory_order_acq_rel__clockid_tcaml_plat_signalcaml_mem_unmap__int128 unsigned_Boolunsigned charPTHREAD_MUTEX_ADAPTIVE_NPcaml_plat_mutex_freememory_order_consumeshort intfile__atomic_exchange_tmpcaml_plat_futex_wait__atomic_store_ptrtimespeccaml_plat_unlockcaml_lf_skiplist_removeruntime/platform.cmmap_blocksheadbarrier_statuspthread_cond_t__atomic_exchange_valpthread_mutexattr_settypecaml_plat_cond_freepthread_mutex_trylockcaml_lf_skiplist_insertlong doublegarbage_headcharcaml_gc_messagecaml_lf_skiplist_findunsigned intcaml_plat_broadcast__time_t__high__elisioncaml_plat_futex__wrefscaml_plat_mem_unmapunreleasedcaml_plat_try_lock__atomic_load_tmpcaml_plat_futex_wake_allcaml_plat_barriercaml_plat_latch_release__spinspthread_condattr_tstat_block__syscall_slong_tcaml_leave_blocking_sectioncaml_plat_waitlf_skiplistcaml_plat_futex_initPTHREAD_MUTEX_RECURSIVEPTHREAD_MUTEX_DEFAULT__nuserscaml_lf_skiplist_initPTHREAD_MUTEX_TIMED_NPlatchcaml_plat_mem_commit__g_sizecaml_plat_fatal_errorcaml_plat_binary_latchcaml_plat_futex_freecaml_plat_mutex_initcaml_plat_assert_all_locks_unlockednext_sleep_nsecpthread_mutex_lock__listattrsense_bitpthread_mutex_unlock__value64caml_num_domains_running__countuint32_t__pthread_cond_sGCC: (Debian 13.2.0-18) 13.2.0zRxA LC AD A~(8C ADA~aEAdlCpA~RBA<JpA~$B ACA~L GAA HCpA~E BAA 0B ACA~L DAC B HAA $lC ACA~MDA(@C AEA~W DAA lHCpA~E BAA HCpA~E BAA HCpA~E BAA $C ADA~QDAPKpA~CBA(<pSpA~CBA$\C ACA~ZCAxUpA~CBA(E ADA~[EA4ADBF FA A AGA~DFA4LD ABDA~U EAD G EAD (@D ABEA~M DAD 0lABB AB A ABFA~HABA, C ACFA~X EAC (F ACA~a EAA     L.<Mby0lH< !`Dk~xHl5GVhH|HH 8PP,hApYnxL-CSh(z@ X()platform.cmmap_blockscaml_plat_fatal_errorcaml_strerrorcaml_fatal_errorcaml_plat_mutex_initpthread_mutexattr_initpthread_mutexattr_settypepthread_mutexattr_destroypthread_mutex_initcaml_plat_assert_lockedpthread_mutex_trylockcaml_plat_assert_all_locks_unlockedcaml_lockdepthcaml_plat_lock_non_blocking_actualcaml_enter_blocking_section_no_pendingpthread_mutex_lockcaml_leave_blocking_sectioncaml_plat_mutex_freepthread_mutex_destroycaml_plat_mutex_reinitpthread_mutex_unlockcaml_plat_cond_initpthread_condattr_initpthread_condattr_setclockpthread_cond_initcaml_plat_waitpthread_cond_waitcaml_plat_broadcastpthread_cond_broadcastcaml_plat_signalpthread_cond_signalcaml_plat_cond_freepthread_cond_destroycaml_plat_futex_waitsyscallcaml_plat_futex_wake_allcaml_plat_futex_initcaml_plat_futex_freecaml_plat_latch_releasecaml_plat_latch_waitcaml_plat_barrier_flipcaml_plat_barrier_wait_sensecaml_mem_round_up_pagescaml_failed_assertcaml_num_domains_runningcaml_mem_mapcaml_plat_mem_mapcaml_gc_messagecaml_lf_skiplist_insertcaml_lf_skiplist_initcaml_mem_commitcaml_plat_mem_commitcaml_mem_decommitcaml_plat_mem_decommitcaml_mem_unmapcaml_lf_skiplist_findcaml_plat_mem_unmapcaml_lf_skiplist_removecaml_plat_spin_back_offnanosleepcaml_gc_logcaml_plat_mmap_alignmentcaml_plat_pagesize  22608 t   2 0    , F20J00L f2Pj0Pl HF2`0`  ! " HF62>0@ \$ 20  &  H F( 22608 B2F0H ( ) *   2000 &2P*0P, 8, f2j0l . 20 0 20 ,2 R2V0X 4 4 4  4 4 P4 2@ 2 2 "0 &0 0= v2 z@ @ 2 0 A 2 0 B 2 0 A R2 V@ r2 v0 xC 20 2H 00 0H = 2 @ 2 0 A E B20 F2 N00 R0 T= 2 0 A G 2 0 $I B2p N0p TA dJ tK 20 2 00 0 = 20 2` 00 0` = M 2 0 N &3&P 30& 83H&P3`&h3x&P3&3&`3&3&3&3& 3 &p(38&@3P&@X3h&`p3&p3&3&3&3&3& p3& 3(& p03@& H3X& `3>&   &*1L6=DRY L`gn u| EA   e joD ". f;Hd"q  ?B)Nv. b,  -: jG T b so| m3 g }%1g> rWcog2g  (n W%9> IJ X_p ;v|U}    l   @#!1 @>K #X@ex   q Xd ,[NmP&~O& &Y4    z2 I Xd 4 j %c#:Qxw| *     &  = Y z O   L & @     " 0 & ( + 6 Y : S S& x \P m q q o w& & &  &  y     & , -& \ I&p _& l }& | & & &0 & &` &0 U & p &  *  / :  >  C& _& u&  &    K A & & &  *& \ ;& H&0 Zo e& p |  r      & P    H D &  & )&?& T&l& (&& && &H&0~& c W(&11= A J N S& 8d&q&R&K     &   - ) G ? f d( v, n5 9 C&@L&@a e n r {&    &X&K   f 4 , ^ Zj z t"- 1 6? SJ N S^ b h&}      ( - +& ; 5&"&9 RD \H TQ&Zr v y{    &&      &(6 CP]i| R&p R ( "&p G A  ( b `& p j&V \&` &@ ' >B  & 1; ? H&4Q` d o&y&\&&4&  &   && &&1&G M&dn r {&  &&&& &    %&.n= =A 9FnO TS L\&e& s q&&0& &   {  &0&P&&@'y6 : E&O&p`&k&@t&`  &&x  c&&+&HUa nSt&  &2 ) #2 C ?&B V R i e&<&#&=&FMU Y b&kX|    &L&&&&,&P  $&d-'< @ K&U&f&q&d&      &  +  '  >  :&D &&'&?&M S&j&{&`7 &P  i  _     & && .  2  ;  ?  D&U& f&|~&&&& v&P    !  %  :&(a&@r& o P +8J& e  "i  r  <v  4&D&D  [  Y&T&0&`&`  j  f   {   y &p &P '&4 A&p \  `  i  m  v     & &    &$&Pp&&&& E& U& & & &P &&'&&p & <Ph P`Dp p@,`@p`  pD p p  .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.tbss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @p &,,00120Ep@@}O`J@Th_h!Z@; k4n~:H $y@HEl0@80EeG @h`0Q 0_$ _D@pc@ j<8printexc.bd.o/ 0 0 0 644 30600 ` ELFp@@|!=")})j)0,)A0A;A||x;|xApx#, @!a#icxH`|=@A<,#@<]x;p?y),)AL; !pAx|)P@@9 9@(pI{>$>?x:_::H@s@x=pax, A|<@@9<!p;;8y)|)@@|9@@apx9#|%H@@ (Q@apsAt~ųx8@~xH`~xH`!x|}xap}C|)P@@HP,=@|capKd```xH`|?@A,#@_xp9 ?pP;xH`|~yAxDxH`0Ax8! |N `;<x8H`ap|capK``|<@@ 9\9 "Ap<`BpaxxH`}<|tx|;H@@~P,4@}<|)@A\!pK8p!x|?H@@9_9 )Ap?`Bp!aK``9)9@"!p}\K```x~xH`apKD``xx~xH`axpK@x8`|exxCxH`K<x8`|exdxCx;H`p?y),)@?q)@?), @H`,A; ;K```!AaH` ```||~xa) :?3 " ^  ^ ^ "^ %^  (h( +0 .8 2r@ 6wH 9^P =^X A` Ch F)p I)x L) P) T) [) ` r) t w) y {  }     )))) p(:0#84id p@pHP(X(`)h)px4>))))pw^ c mhEFG x8H p| @        / 9@w jmpA JBCC | & 22b$jkpl 85 ?5 ? end5 ?5 ? ptr5 ?5 ? 5:(5:0^7 x8 9 : 8< < end< <  ptr< < <:(<:0 D> ?  mem@  maxA 8C C endC C  ptrC C C:(C:0  :^ :p*  :?#   $! p$"5  #:F #. J6buf/ # 07" ptr# end$ % A :8p 9%S  ^ p &) : e  p;} 2p<c ! [%9 my< . / .a :z p .&Jp = >>]'exn* ]\g s }    S m S   S@U1 2T U JS S T U S T Uz S T U m S  [ S1 ;8T OS2 2!pexnp4(msgrs tptp?5'exn5/8 len89 v9@buf: O|A;~res< BiNO ~T U Y  6* U >6*AN"yCR)^D_ kS   S TUV q  OS STU W 6* ST@UV1&AG  +S STAC R)^ _ k  $M6*^J  .S ST   \6* S STU  A:?!-buf-*s-;(len/. O!(Abuf((c(2AE+yval8F y )G : ; 9 I8 I~ !I : ; 9 I 8  :! ; 9!I!8I1B: ; 9 I H} $ >  < 41B : ; 9 I8  : ; 9!1RBUX!Y W !I/ IH}( .?: ; 9 'I<: ; 9 I4: ; 9 I UH}4:!; 9 IB&I4: ; 9 I?<:! ;9 I: ; 9 I .?: ;9 'I<4:!; 9 IB 1RBX!Y W!!.:!; 9! ' !"7I# !!: ; 9!$ :!; 9 I8%.?: ; 9 '<&':!; 9 IB(4:!; 9! I) 1U*% +$ > , -: ; 9 . : ; 9 /&0GI1> I: ; 9 25I3  : ; 9 4 : ; 9 I 85I 6 : ; 9 I 8 7 : ; 9 84: ; 9 I?9.?: ; 9 '<:.?: ;9 '<;.?: ;9 '<<.?: ;9 '<=.?: ; 9 '<>.?: ; 9 '@z?.?: ; 9 'I@z@4: ; 9 IA4: ; 9 IB UC1D41E.: ; 9 'I F G.?<n: ; 5 S n S n S o o n S S n S n S l l m mSloSSlSlo S Siii0olmmmmmSnSooo  ||2usm2_|"|Ygg||Smmmm||Sdd""||kkq ||SSllhhYY(|mmq ||SS)|,08 runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includeprintexc.cmlvalues.hstddef.htypes.hstruct_FILE.hFILE.hstdint-intn.h__sigset_t.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hstdio.hdebugger.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hcallback.hstdlib.hmemprof.hstring.hstdatomic.hbacktrace.h 5!<K ." ;;! ! l. / /=  ~ +     6" [  <&* & *  (.] * ( : ! 1 V  *  3 O.&*. 7$   +  "  / . ^    ". !   !  /g Z=!   ".1!/ /J+ O  / /=  . /.! =/Kf IJ" Y.  < # S.&* & *  &.  & W=!".1!/   % Q 6.* L  <&* & * 6 JJ&* & * XKJyX(.&!f&! <~ /  +     / 0! >%;0!     Jo.fj$2B 005. <@My<0 T # #  #. " ! #! ! /  </ <  #,"# 9!"/>.<%<.=y<}. f__off_texn_handler_chainmemory_order_release__jmp_bufsize_tc_stack_linkdependent_size_shortbufrequested_global_major_sliceyoung_limitmajor_slice_epochgc_policymlsize_tswept_wordssaved_backtrace_activebacktrace_pos_IO_buf_baseheader_tcaml_fatal_uncaught_exceptionlong long unsigned intunique_idmemprofcaml_failed_assert__int64_tsigjmp_buflimitcaml_exception_contextextra_heap_resourcesintbufdefault_fatal_uncaught_exceptionnext_codecvtallocated_words_directintptr_tlong long intsigned char__jmp_buf_tagmark_stackgc_regs_buckets_filenorequested_major_sliceparser_trace_IO_read_end_IO_lock_tlong intmajor_work_done_between_slices_flags_wide_data_IO_buf_end_cur_columnadd_charcaml_debugger_in_usecaml_minor_tables_IO_codecvtextra_heap_resources_minordouble_IO_write_ptris_exception_old_offset_offsetcurrent_stackbacktrace_slotslice_targetcustomcaml_format_exceptioncaml_heap_stateoo_next_id_localbacktrace_last_exntablesbucketcaml_bad_caml_staterequested_minor_gcallocated_wordsmemory_order_seq_cstvaluechar_os_IO_markerinside_stw_handlerlocal_rootsblockunsigned intcaml_custom_eltstack_cachecurrent_ramp_up_allocated_words_diff__int128runtime/printexc.c__valGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_result_privateslice_budgetcaml_ephe_info__sigset_tcaml_abort_on_uncaught_exncaml_stateminor_heap_wszsaved_backtrace_posdatadependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatmemprof_young_triggerstrlen_IO_save_baseadd_stringint64_tHd_valintnatmemcpy__atomic_load_ptr__builtin_memcpy_lockc_stackmemory_order_relaxedstringbufyoung_ptrmarking_donebasetrap_sp_offyoung_startasize_t__mask_was_savedstack_infoatomic_uintnatlong doubleextern_stateat_exitmemory_order_acquiretrap_barrier_offmemory_order_acq_rel_IO_read_ptrsweeping_donecaml_ephe_ref_table__off64_tcaml_callback2ephe_info_IO_FILEexn_bucketextra_paramsfinal_infocaml_stat_freeuintptr_texternal_raisebacktrace_activestderrextra_params_area__saved_mask_mode_markerscaml_stat_alloc_noexchandle_uncaught_exception__int128 unsignedyoung_endlockedthreshold_Boolmemprof_domain_sunsigned charshort int_flags2dls_rootcaml_ephe_ref_eltcaml_stat_block_vtable_offsetFILEexitstat_minor_wordscaml_custom_table/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bememory_order_consumecompare_unorderedntablescaml_callback_resfprintfstat_forced_major_collectionslong unsigned intcaml_intern_statechargc_regscaml_final_infointern_statecaml_memprof_update_suspendedstat_blocks_markedcaml_resultabortcaml_is_special_exceptioncaml_domain_statetrap_barrier_blockoffset_IO_read_base__jmpbuf_IO_save_endcaml_print_exception_backtracesnprintf__atomic_load_tmpallocated_words_suspended__pad5caml_named_value_IO_write_endyoung_trigger_unused2nitemscaml_gc_policyephe_refreservememmove_freeres_bufrequested_external_interrupt_IO_backup_baseminor_tablesshared_heapsize_freeres_list_IO_wide_databacktrace_bufferstartmajor_refaction_pendingstat_promoted_words_IO_write_basecaml__roots_blockcaml_extern_statecaml_ref_tableephelongjmp_bufferGCC: (Debian 13.2.0-18) 13.2.0zRxA A AAEA~CACACF A A A AAAZ[AABAAAAB A~o AAAAAAC XH `A A A A AAAAAAAA$C AHA~    z")2HPWq+J]cprintexc.ccaml_format_exceptionstrlensnprintfcaml_stat_alloc_noexcmemmovememcpycaml_is_special_exceptioncaml_bad_caml_statecaml_debugger_in_usestderrcaml_fatal_uncaught_exceptioncaml_named_valuecaml_memprof_update_suspendedcaml_callback2exitcaml_callback_resfprintfcaml_stat_freecaml_print_exception_backtracecaml_failed_assertabortcaml_abort_on_uncaught_exn ZXC 20   $ < v2~0  x    $  20  2@  20( :ZBXD HC\Cf2hn0h| ! CC2@20" # 2@C($ 628:2PB08F0PH% V28Z2Pb08f0Ph% v28z2P080P% & &3& 3&&   &* /:= ID mP W^kel xVya  ) +c8 .E 7R_l6y $D W]P \  " 0 f<nD;hr jc|P9*>;U[ aqgms|A3f -j,:H VXdr & r >  ~&(6DR`Yn|R x >g  T$ K>1J ,VbnNzuy\  p  + F " .C:;FFRd6nA}      z+"0 : [Dq]Yj}  e7  k % W 2 E 5 Q ^  k y   k  W  x e  & @ Zk g W t    G  0   . % | $` 1  P x  '&  D *  #   C  k 3 < \ n \    c    & 9  =  B L D P @ Y&8 c&8 } W S q i       &H & &h &&#&3&K&0X&Pm&Pz&8&p&P&8&&P&8&& &!&9&0P&^~i&    2 * R P \ Z n d2L P U 6f j s&T} K     K  &&&  [ 6 4 B @& f( O, M5 [9 YC&<M qa qo hs f~& | t p   |  &&&    ! & / 3 8&P&v&     &&   4 0 I C   p l&,&L&V !e i r !{    &&    &         &/&O&Y&s "w   . ,&,&D&,&q!B`l l&&&G&.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@Bp`&,12E0@@H`OJ@I00YT@I`% eRCx!9s@o@0 %0@op0%&4@o0. 0< < @o0=0 @~oprng.bd.o/ 0 0 0 644 6936 ` ELFX@@=4= ںa%Ca) nyy)Geނe)gaa)"|eR|Axe"}H2x|xyJ|Iy}JBx|Z}Jxy(x"G|c2x}#Iy#"|cJxN `|!HH`8!p|N >int,J-.{WJZ.lmX; KELM N  QR S T Udim V  .M4%Cނ a s x . 6 B4b vB$bTSS* v*/ z, q0 q1 st-#: 8 0# < 8 0&x*k1<$ > : ; 9 I :! ; 9 I8  : ; 9 I8  : ; 9! !II.?:!; 9 'I@z :!; 9 IB 4:!; 9 IB 4:!;!,9 I 1B 1:!;!&9 I% $ >  &IGI!I4: ; 9 I!I/ .?: ; 9 'I<IH}I~H}1RB UX Y W 1RB UX Y W .: ; 9 'I SS@S@S@XSXVYsy'SWH %,PThl runtime/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/camlprng.ctypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hbigarray.halloc.h *#$$  ($ "' y u  ! %l       v  !"lj [=  /rotlvalueshort unsigned intproxyuint64_tcaml_copy_int64atomic_uintnatdatasizecaml_lxm_nextlong unsigned intuintnatuintptr_trefcount/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beunsigned char__int64_tdoublecaml_ba_arrayruntime/prng.cunsigned intflagsintptr_tlong long unsigned intGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_ba_proxyint64_tnum_dimslong long intLXM_statecharshort int__uint64_tlong intlong doublesigned charcaml_lxm_next_unboxed_BoolintnatGCC: (Debian 13.2.0-18) 13.2.0zRxA ,4CpA~DBA    4,prng.ccaml_lxm_next_unboxedcaml_lxm_nextcaml_copy_int64  &3& 3 O   &* 1 d8  F M *T [ 3b i p ?w |    $ / ~ g v 8 a =   ! - L9 QF R L^ j )v   - V&37 <&U&c Km&&"?5ge&  pn& {y$ &&0.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@ 0&,601@ `@HB;@0LZ6o0j@0 ~ @H0n0 G  hH@`0   `<roots.bd.o/ 0 0 0 644 16768 ` ELF;@@||wx!A|;x|#x|3y|+x}Cx!AA(Aa,(@\;````,*~;;{$9 @Py)$x|H*|J,$A 7w})WN!A(\;|)PA;{i|)@A,<@\ax&xxDx~xH`8!!A|N  ```|a|;x|#x|~x|3x|+x!aA(X(H|=")| H@L,,)A,Iixxxx}IIN!A(gxxxxxH`8!a|N  <Aint,.W.ZAlmO5X29;> @PA? " JJJ"J%J ((+0.82@6H9JP=JXA+`C5hFpIxLŀPňTŐ[Ř`rŨtwŸy{{} H(08id H@HHPX`hpx)H3=J4 8 + sp 0 J 1 J 3  :H ; 5  < ( id = 0O  p u sp w  x E+ F G@8 Hp 0 @ { {   \:  p:;< =(> H?P@XA `Bh    $ . 8 &PB!koT/{oO""$  fun  val H RR old ! "  -./H0W#A 8 5 5 end 5 5 ptr 5 5  5( 50J  7@ 8  9 # :  8 < < end < < ptr < <  <( <0  > ?  mem @ # max A # 8 C I C I end C I C I ptr C I C I  C( C0J lA    !  "  # l$  {oJK {oOH1T Qf2{ 2,o 2: 3{ 4 5 J% $ lr7"{ i8Hl j9H& sp:J'S STUVW# f${ $,o $:d%O &H(( )+ + * @STU+ fSTUV STUVW : ; 9 I8  :! ; 9!I!8  :! ; 9!I!8 !II~I$ > : ; 9 I  : ; 9! : ; 9 I8 :!; 9 IB < 4:!; 9 IBI:!; 9 IBGI:!;9!I!I/ ( '.?: ; 9!'<.?:!; 9 '@z H}4:!; 9 IB% $ >  5I  : ; 9  : ; 9 I 8 : ; 9 I !> I: ; 9 "4: ; 9 I?<#!I$4G: ; % U& U'H}( )4: ; 9 I*H}+H}PSPgSPTPjTPUPmSmUPVPVPWPiWPXPhXPVPlPd0dkd0oUSnSTmTUlUVoVWkWYY,<!(,@x|pN runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/camlroots.cstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfinalise.hroots.h 5777YK< K!/!!; ! $  "  !  /f ( J' <C7 X u< e. " f.v< prevatomic_uintnatexn_handlerhandle_valuesize_tc_stack_linkdependent_sizerequested_global_major_sliceyoung_limitmajor_slice_epochgc_policymlsize_tswept_wordsyoungbacktrace_posSCANNING_ONLY_RECENT_FRAMESfinalscanning_actionunique_idmemprof__int64_tlimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnextlong long intsigned charSCANNING_ONLY_YOUNG_VALUESmark_stacklong long unsigned intscanning_action_flagsrequested_major_sliceint64_tparentlong inthandle_effectmajor_work_done_between_slicestodo_headextra_heap_resources_minordoublescan_roots_hookcurrent_stackbacktrace_slotslice_targetcustomcaml_heap_stateoo_next_id_localbacktrace_last_exntablesintern_statedls_rootrequested_minor_gcallocated_wordsvaluemajor_refinside_stw_handlerlocal_rootsblockunsigned intcaml_final_do_rootsstack_cache__int128backtrace_activeGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesv_gc_regslong unsigned intruntime/roots.cslice_budgetcaml_ephe_infominor_heap_wszintnatexception_ptrdependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatmemprof_young_triggerlastsweeping_donecaml_custom_elt__atomic_load_ptrintptr_tc_stackcaml_scan_stackyoung_ptrfdatamarking_donehandlerdo_final_valbasecaml_do_rootsyoung_startasize_trunning_finalisation_functionfinalisablestack_infocaml_minor_tablesextern_statetrap_barrier_off/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beitemcaml_ephe_ref_tableephe_infothresholdextra_paramsfinal_infouintptr_texternal_raiseextra_params_area__int128 unsignedyoung_endlockedcaml_scan_roots_hook_Boolmemprof_domain_sunsigned charfflagsshort intallocated_words_directgc_regs_bucketstablecaml_ephe_ref_elttodo_tailupdated_firstcache_bucketstat_minor_wordscaml_custom_tablemagiccompare_unorderedntablesfirststat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infohookstat_blocks_markedupdated_lasthandle_exncaml_domain_statetrap_barrier_blockoffset__atomic_load_tmpallocated_words_suspendedstack_handleryoung_triggernitemscaml_gc_policyephe_refreserveparser_tracerequested_external_interruptminor_tablesfinal_todoshared_heapsizetrap_sp_offbacktrace_buffercaml_do_local_rootsstackaction_pendingstat_promoted_wordscaml__roots_blockcaml_extern_statecaml_ref_tableepheGCC: (Debian 13.2.0-18) 13.2.0zRxA DTC A CDEA~CAAkAAHHA0`C ACCDA~_GA     T-;Oroots.ccaml_do_local_rootscaml_scan_stackcaml_do_rootscaml_final_do_rootscaml_scan_roots_hook  2@ &3&` 3  3 &* 1 6 -D !R hY ` g n Fu v| (    &  n      z  $ 5 \ mg Gr }   l    / g I    -  W   2" - 8 >C N Y yd 4o mz   |  b     P      _  E* 6 B )N :Z Af r ~ C         = !  V  z & 2 > P h uu d   Q  4       1 ;  G cT a n  P (  {  P 0 q  c  U  %  / 9 C hc i p |  \     Y8 E  QX  :d cq  Q~ T   y w    Q  _  & 3 A YM yg w    Q   @  y  w "  /  Q <  Q s X  m  y  ]   & 7 S   s & 3 7 < ! F. J( O Q YN ]D b 4 lv pr u l         &P   &p      & %& R ~ X&` w { !   Q ? 9 ^ X l } w 8   &  &    & A& g& &]&d`.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @<@"x&|,601@#p`@ ;@#LIYZoL0j@:0 ~|%t@:0 0  @:0  "d:/18 0 0 0 644 102000 ` ELF@@|,|#x!A|+xpH`|~yA`=")*| ~<x8:@K~xK<| H@L,,)88xA8!|N =BJ="9)| P@L,,*M |9)(9}@H,*@ }I@L,L !9 !p="),)@ 8!N ="),)@|8p8888`H8!|N `=BJ="9)| P@L,,*M |9)(9}@H,*@ }I@L,L !9 !p="),)@ 8!N ="),)@|8p8888`H8!|N `=")8`,)@xcN `| H@L,,)88xA8!8`|N ```=BJ="9)| P@L,,*A|9)(9}@H,*@ }I@L,@|!9 !p="),)@8`8!N ```="),)@|8p8`888H8`8!|N 8`N ``=BJ="9)| P@L,,*A|9)(9}@H,*@ }I@L,@|!9 !p="),)@8`8!N ```="),)@|8p8`888H8`8!|N 8`N ``?!!j,>A89!9p89ApxA!=")| H@L,,)@a8!N |} 1@L,, Aa`H`,Aa`H`,A88`H`8{;{8|ix9J8`!I`B!A`I!ApI!AhIH`acxH`,@0?}_j*9)*=")| H@L,,)@!Aj$8#8J|cH`KX`<A9 89aP8aX!!8`8!!8p9!9A9!xaapA!="),)@(8! 8`N ```|0="),)@ !X)q*!Ap})t, A, AL, @4!`|t8|88`}$t|4T~h8H8`08! |N )`PiH`a="),)A="),)@|ctP8|i8`8x$|t9J})PP}(QP|t|HKd0|K`|t8|888`HK4|< ?p #$"A?X" ~  ~ ~ "~ %~ (( +0 .8 2@ 6H 9~P =~X A` Ch Fp Ix L P T [ ` r t w y" {, }6   ;        M( M0 E8YidM@ MH P JX J` h p x   V `      M      ~ $$EF G t8H p$@""   $'$1$@$Q$[@%jmpA\B"Ce$9&$:22'p/ 7'p?G H 'pJ       !"#$%&'()*+,-./01 }S'p M       ZP % % # "A  # "A'p   @ $//  'p U3 0[@ (((( ( ( (( 0( 885 :5 :%end5 :5 :%ptr5 :5 : 5M(5M0~7 t8 9 : 8< < %end< < %ptr< < <M(<M0 ?> ? %mem@ %maxA 8C C %endC C %ptrC C CM(CM0 :]  : #~ "A9* #. "A?A$   B! MB"<\ 5"A9F$A.\]buf/5B h;^!M "%& M( * (+ 0, 8- @/ H0 P1 X2 `3 h4 p6 x7 8 9 : 2:=(2'pW W&Z/  b[ M \a ]a f M m M o p r v wf #"A 1)55 M?5!_;Yv~,)qM)p_d?2+G5`#<;  QMMqqvCMC <S )Z ML M5;e M@5) C MWW;DrM)  MW)f MME=5MMMa MMD=E! M%M=)"z MG5=Z ]Mb #Ua;J~<jf*DE E% UG G"H@HHH~ HM L VV _  `  fST7TTU1$#xi61K 6?6K 6f 6Y\S rS6M 6%6K{ 6f 6Y\S @S #8TUS T U G"* * " Mh`4resX~ M |C         5-   -- -,-9-:-F?6S1T4%M0'  M,)P6S1T1V1WP%M00 1 6S1V0W0%M06S1T0V0W0%M0E <-  -- -,-9-:-FS T U *8  " MH@~ MM M6  ` 61 6?6K 6f 6Y\S rS6x 6%6Kc 6f 6Y\S @S50 F, UvS4T0vS2T0_:S mS T U S S S 0 6idx'M 2'  1!  `ci MBST0U-  - - -,-9-: -F6S0T5U0VDW%M01!GszH- ( -!- -,-9-: -F7! %G 81ud# u) MGvalu;"}4bufw# p6S0T4USV1Wp%M0H-  v-"- -,-9-: -F##"A1nD$ n# 5-  o#-#- -,-9-: -FI6S0T3USV0W0%M01gD$g% 5-  h$-$- -,-9-: -FI6S0T2USV0W0%M00 &s ' A $ M -M E&s M (&x &s    " ' ) %&}A&&}A&:;!@&}@A&XL&}LA!a&}aA YJ-&x& DM*H'Z, -  -'$- -,-9-: -F*@(2 "4resX4strP M(0  ( aj(rS(S( S T U **4-T+-`-l)z-q -}-$)---T+,-`! ! !- *{-*J- -,-9-:-F6S0T1U3V1Wp%M0*,z3-+--+D- --$+x---+,-! ! !- ,E-,- -,-9-:-F6S0T1U2V1Wp%M0*,3-.,..QdMJM-T-9!  7- -!7- -!7.!  KL/ M M  / M/  M4 44/644/[SS)S;SUK0*M M  0 M001011L>v>v);SUM11&&!& M&M& MNretMNpid. 1lM!q,&x11! >22, .+ MP2~  . 62S0T1U1V0W0%M0QSTU0e ad3@32 .><43..86t3O6,668445 444448-4.4u..QS T UM4f9M!&&>06. a805l15^11L>v5S #85S 5S 5S 6 S j0616m406K6m;06t (6err4Mgm6!&o &o -$ 9 % % %& %3 %@%Z%f%r%~%%%%%%h%M&7 &%7%%%8%&&8k&&& &,&X8&Y,&e&:8&?&KB8S"TU3$9S T U 9OS T U ,S T U .--9.9..Q--;e--:/- --$:_- P--+,-! ! !- ;2-:- -,-9-: -F6S0T1U2V1Wp%M0--T<-`-l;-q -}-$;- P--T+,-`! ! !- <-<- -,-9-: -F6S0T1U3V1Wp%M0-,D=-  -=a- -,-9-: -F-!l>v ! !- >D->- -,-9-: -F6S0T1USV1W8%M0-0hBO111+171C1N1Y1ed?21j1v01w61~? 6?6K? 6f 6Y\S rS1?116@r 6%6K@] 6f 6Y\S @S1@111@A1F + U]GA6S %AbT U WATBU ASTAS0TU3V1WX0!AS0T%B'T U VBFS BeS S QQI~( 41BI : ; 9 I8 4:!;9 I !IH} 1B 4:!;9 IB : ; 9 I 8 : ; 9 I :!; 9!I!8H} 141:!;9 IB1RB UX YW H} 11RB UX!YW $ > 4:!; 9 I4:!;9 I.?: ; 9 'I<I~  : ; 9   1U U : ;9 I! "!I/ #I$<% : ; 9 I8 &4: ; 9 I'>! !I: ; 9 ( :!;9! I8 ).?: ;9 'I<*.?:!;9 'I@z+ U,41-.1@z.4:!; 9 IB/ : ; 9 I0.: ;9 ' 1.?:!;9!'@z2&I3: ;9 I44:!;9 I51RB X!YW 6: ;9 I7.?:!;9 ' !81RB UX!Y W 9: ; 9 I :4: ; 9 I?<;.?: ;9!'<<.?: ; 9 '<=>.?:!; 9!'@z?GI@ : ; 9! A !!: ; 9!B :!; 9 I8C'D.?: ;!9 '<E.?: ; 9 n'I<F1G:!;9 IBH1RB X!YW IH}J.:!;9 'I K.:!;9! '@zLH}M.:!; 9! ' !N4:!; 9 IO 1UP41 Q.?<n:!$;!R% S$ > T U : ; 9 V&W5IX  : ; 9 Y : ; 9 I 8Z  : ; 9 [ : ;9 \I ] : ; 9 I 8 ^4: ;9 I?<_.?: ; 9 '<`.?: ; 9 'I<a.?: ;9 n'I<b.?: ;9 'I<c4: ;9 IBd.?: ;9 'I e.?: ; 9 'I@zf: ; 9 Ig.: ; 9 'I h1 56S68m88S88m88S89S99m56T67k78T88k88T89T99k67j7788j8899j68099078o88o99o88 1$#88T 1$#88S88S66 99 66S99S66 99 77 99 77S99S77 99 00S44S44q#000T44T44q#800U44U44q#@01o11v13o34o55o14055014055011133Y34Y44 X1& $ &33v3%34y3%44X1& $ &#3%44Z34 33Y34 33Y22Y22~1&44Y55Y55~1&22t22T33114 55 11Y12Y24 55 22Y44Y*+S//S//q#0*+T//T//q#8*+U//U//q#@+.l.../l/0l+/0/00+/0/00,,S00S-/ // --Y./Y..@..S-- // --S//S-- // .. // ..S//S.. // ./0)*1))Y))Y**Y'(S((S((S((S()S'(Z((Z((ZSUSTwTYYSUSYYSUSYYYYSSSSoxo0 YSmSSSSSSS1Z 0X3 YY YSSSSSS0Z 1Yq@qpq@w2 YY YSS  YY S SSS+T+<o<TTT+U+UUU+V+VVV+ u $@L$)+U $@L$) u $@L$)U $@L$),0,DSDn0n411<\oo<\oox  x00&&S&'S''S''S&&T&'T''T''T&&U&'U''U''U&&V&'V''V''V&& u $@L$)&'U $@L$)'' u $@L$)''U $@L$)&&0&'S''0''S''p&'1''1&' '' &'Y''Y''Y Y Y Y Y  Y Y Y 0  0   Y Y%%S%&S%& &&YSmSmSmTTccTcUiUiUiV~fV~V~WjWjWjh  $ & V# $ &hlllnnnoooaaaakkkb~b0bbggg0g0g0SddSdznlllooooaaaa 3$"loa  YY0ZYq@qpq@w2YYY1ZX3YYYYSSUSTwYYYyP X x@ z4@wy3$ YSnS##n##S#$nS##S"m"$m!"o##o 0 !X [ ![!! ## !!S##S!! ## !" ## !"1##1!! ## !!S##S!! ## !" !"0""Y""s1&""s1& $ &7$"z",4448<x              "##!!!!##!!##!!!!!!!!##!!##!!""""""""""%&&&&'''&'''&&'')))))))))))***,,--//--//--..//..//112223445533333366666666996699667799779977888888E runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/types/usr/include/powerpc64-linux-gnu/sysruntime_events.cdomain.hplatform.hstddef.htypes.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hstdatomic.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hruntime_events.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstartup_aux.halloc.hstring.hcallback.hunistd.hmman.hpthread.hfcntl.hstdio.hosdeps.h !K. ..}  ! } .>%)%=>.~  . p}  ! } . 0%*%/>.~  }t2* O  13 $ t w $ < # x$ . w $ X -n.'>'/ *>m  'n * >m    m JJ( .1 r !  v # %"NM%   Ms A   n !MAM -..\/ ".#.MwAM  <. y .  'y   -% !! [0f. < . MT. p.M  X $ z & k "JMV$X.   JX.ZX* } *  f0X .zJ \ .K0<~. ~  - K  ! ;~Jfs f.5tX/5 "5, 02f( X/(>("(0&) XK [J011L1: /= - K  ! ;#1t0~>~... ~...X ## |X x|?  0,0/mH. 4 HLJ H " +F$*6. 0 "% Z4f-$$$.0"+1."&%y.!z"( ((p 0$( %"*w % 'u .# &,'#s ! )X)  .49# 4,&/u.)!)<pJ.  .X< !=T..H>,"# !.<} !K"$}  $} K ><}  .J.~< t.<.<vJ y<<%~%"%,0/LJ"" A%."%, .0/#  I # # /   @G X.Xr.f,.0.   ~X..U ~X<. !f~./ .../ . Y 0f hL L~ ~.J. ~f..iX","< =/!/=..K!sM+!",L Z3=3 . . K'y }   !' x !!./ / 2 .%}p<.fX4 ~  ,! =>}!/T.. .< uJF!0K"K ">.   J4 ~J.<.<E 1/!;=..K!/=Z}.. JJ }...   " v   #450  & E!@  !; M  !  X$}. ...+#! !)!+" !:+ !!.  J f     <.;t" ""W= Xg=-/ .!} }f }. .[|p..}  /}T.f  # +! " .0 w  . s z  J .u.L9 $-! s   y # . .]X  X |..<.__alignstrnleneventEV_USER_ML_TYPE_SPAN__pthread_mutex_swrite_to_ringEV_COMPACTthresholdextra_params__saved_maskEV_DOMAIN_RESIZE_HEAP_RESERVATIONEV_MAJOR_FINISH_MARKINGblock_Booltablescaml_invalid_argumentruntime_warningslength_with_header_tscaml_domain_statelockedyoung_startcaml_global_barrier_and_check_finalcaml_ml_runtime_events_resumeEV_MAJOR_SLICEEV_RING_RESUMElifecycleephe_infocaml__dummy_event_namecaml__roots_list_itemunlinkgc_policycaml_num_domains_runningmemory_order_releasebacktrace_activering_maskstw_create_runtime_eventsEV_C_FORCE_MINOR_MEMPROFlocal_rootsEV_MAJOR_GC_STWmemory_order_acquiremajor_slice_epochnum_participatingnextlengthcounterEV_MAJORvunitEV_USER_MSG_TYPE_UNITcaml_local_roots_ptrcaml_ml_runtime_events_are_activecaml_runtime_events_destroy__atomic_compare_exchange_ptrcaml__roots_event_namebarrier_statuslen_byteschar_oscaml_custom_eltcaml_minor_tablesEV_DOMAIN_TERMINATEcaml_stat_alloccaml__b_421remove_file_datadomain_statedomain_num__atomic_store_tmp__jmpbufmemory_order_acq_relring_data_lengthcaml__b_432EV_MINOR_EPHE_CLEANEV_MAJOR_FINISH_SWEEPINGyoung_limitmemory_order_relaxedruntime_events_metadata_headermemcpycaml_paramsEV_RING_STOPcur_event_nameextra_heap_resources_minorEV_MINOR_FINALIZEDftruncate64mmap64memprof_young_trigger__builtin_memsetEV_C_MAJOR_HEAP_POOL_WORDSdependent_size__owner__mask_was_savedEV_MINOR_FINALIZERS_OLDIFYallocated_words_suspendedEV_C_REQUEST_MINOR_REALLOC_EPHE_REF_TABLE__sigset_tcaml_try_run_on_all_domainsEV_USER_MSG_TYPE_SPAN_END__lockminor_tablesEV_BEGIN__pthread_list_tEV_C_MAJOR_HEAP_POOL_LIVE_WORDSnot_pausedcaml_ml_runtime_events_pausecaml_heap_stateEV_C_MAJOR_WORK_COUNTERcaml_runtime_events_resumeEV_COMPACT_FORWARDcaml_lockdepthEV_MAJOR_MEMPROF_ROOTSEV_C_FORCE_MINOR_ALLOC_SMALLinit_custom_major_ratiosnprintfEV_MINOR_REMEMBERED_SET_PROMOTEEV_C_MAJOR_HEAP_POOL_FRAG_WORDSEV_DOMAIN_CONDITION_WAITcaml_stat_strdup_noexcevent_namedomain_ring_headertypeEV_MAJOR_GC_PHASE_CHANGEtrap_sp_offstat_forced_major_collectionsinit_custom_minor_ratiocurrent_ring_loc_strcaml__dummy_eventcds_fileEV_STW_HANDLERev_runtime_message_typeopen64padding_requiredEV_RING_PAUSE__datapaddingEV_MINOR_FINALIZERS_ADMIN__jmp_buf_tagmarking_doneoo_next_id_localgc_regs_bucketsunsigned charcurrent_user_eventmemory_order_consumeuser_eventsruntime_events_log_wsizecaml_ephe_ref_tablepthread_mutex_tEV_C_REQUEST_MAJOR_ALLOC_SHRrequested_external_interruptruntimeevents_register_write_bufferruntime_events_teardown_from_stw_singledata_offsetinit_custom_minor_max_bszstrncmpEV_C_MAJOR_SLICE_TARGETev_runtime_counterring_tailcaml_ev_lifecycleEV_MAJOR_FINISH_CYCLEexn_bucketinside_stw_handlerruntime/runtime_events.cEV_USER_ML_TYPE_CUSTOM__kindcaml_copy_stringuint64_tEV_USER_MSG_TYPE_SPAN_BEGINget_ring_buffer_by_domain_idtrace_levelexn_handlerEV_MINOR_LOCAL_ROOTS__atomic_load_ptrEV_USER_ML_TYPE_INTEV_MAJOR_MARK_OPPORTUNISTICallocated_words_directrecordcaml_modify_generational_global_rootheaders_offsetcaml_runtime_events_are_activeopentrap_barrier_blockEV_EXPLICIT_GC_MAJORcompare_unorderedEV_FLUSHvaluefinal_infoEV_MAJOR_EPHE_SWEEPstrncpyinit_minor_heap_wszEV_MINORparticipating_domainsnitemsverify_heapEV_C_MAJOR_HEAP_LARGE_WORDSEV_FORK_PARENTEV_MINOR_GLOBAL_ROOTSexternal_raisering_fdcaml_ev_alloc_flushcaml_ml_runtime_events_start__sizeEV_EMPTY_MINORaction_pendingmunmapev_lifecycleEV_C_MAJOR_ALLOCATED_WORKEV_STW_API_BARRIERremove_filesize_t__countstat_blocks_markedcaml_ml_runtime_events_pathEV_C_MAJOR_ALLOCATED_WORDSdls_rootEV_MINOR_MEMPROF_ROOTS__atomic_compare_exchange_tmpunusedalloc_bucketsmemprof_domain_scaml_stat_freecaml_runtime_events_initev_runtime_phasesection_tableEV_RING_STARTcaml_string_lengthcaml__roots_eventcaml_final_infomajor_refcurrent_ring_total_size__int128 unsignedphaseunique_idEV_FINALISE_UPDATE_FIRSTntablesrequested_global_major_slicering_size_elementshead_headerruntime_events_enabledcaml_ephe_ref_eltEV_C_REQUEST_MINOR_REALLOC_CUSTOM_TABLEev_categorycaml__roots_blockyoung_endevent_idcaml_runtime_events_pauseEV_C_MAJOR_SLICE_BUDGET__pthread_internal_list__prevtimestampEV_COUNTERcaml_global_barrier_release_as_finalring_is_active__int64_tEV_LIFECYCLE__uint64_truntime_events_custom_eventsweeping_doneftruncateruntime_events_create_from_stw_singlecaml_time_countercaml__continue_421requested_major_slicebacktrace_enabledmemprofevent_type__valcaml__continue_432offset_indexcontentlongjmp_bufferruntime_events_pathcaml_stat_strdupcaml__dummy_event_idcaml__alone_432/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bepausedcaml_statecustomev_user_ml_typememsetwrite_bufferring_size_wordsnameserializerasize_t__nextcaml_intern_statecaml_plat_mutex_initexe_namecaml_stat_blockc_stackEV_COMPACT_RELEASE__int128backtrace_poscaml__temp_resultallocated_words_resumed__elisionallocated_wordsring_header_size_bytescurrent_stackshort unsigned intsigned charcurrent_metadataEV_EXPLICIT_GC_FULL_MAJORsigjmp_bufinit_max_stack_wszEV_EXPLICIT_GC_MINOR__off64_tcaml_failed_assert__atomic_load_tmpextra_heap_resourcesEV_INTERNALword_offsetcaml_runtime_events_startdependent_allocatedevent_name_lencaml_extern_stateyoung_ptrmemory_order_seq_cstintern_stateminor_heap_wszEV_C_REQUEST_MINOR_REALLOC_REF_TABLEcaml_ev_allocml_event_namecaml__roots_rescaml_exception_contextcategoryclosering_headers_lengthEV_MINOR_LOCAL_ROOTS_PROMOTEproc_self_exeEV_RUNTIMEEV_C_MAJOR_HEAP_WORDScurrent_ring_loclong intuintnatpthread_mutex_locklimitstw_teardown_runtime_eventsEV_EXPLICIT_GC_SETring_ptrepheEV_MINOR_CLEAREV_MINOR_LEAVE_BARRIERcaml_ref_tableintptr_tcheck_err__pid_textern_stateuintptr_tEV_C_MAJOR_EXTRA_WORKsection_table_sizelong doublereservelong unsigned intcaml_plat_fatal_errorEV_MINOR_REMEMBERED_SETEV_C_MINOR_ALLOCATED_WORDSevent_traceEV_C_MINOR_PROMOTED_WORDSinit_percent_freebacktrace_slotEV_EXPLICIT_GC_COMPACTcaml_plat_unlockcharcaml_runtime_events_post_forkmax_domainsruntime_custom_event_index__spinscaml_plat_mutex__nusersEV_USER_MSG_TYPE_INTEV_MAJOR_MARK_ROOTSslice_targetcaml_ev_counterEV_C_MAJOR_ALLOC_COUNTERcaml_alloc_someshared_heapEV_FINALISE_UPDATE_LASTcaml_alloc_smallsizering_headcaml_string_is_c_safecaml__roots_write_buffercaml_fatal_errorEV_STW_LEADERcaml__roots_event_idint64_tmlsize_tintnatEV_MAJOR_MEMPROF_CLEANdoubleuser_events_lockmajor_work_done_between_slices__builtin_memcpycaml_callback2ring_bufferruntime_events_pausedcustom_eventEV_C_MINOR_ALLOCATEDlist_itemEV_C_FORCE_MINOR_SET_MINOR_HEAP_SIZEatomic_uint_fast64_tdataring_tail_offsetevent_type_idlen_64bit_wordevent_lengthpreserve_ringEV_C_FORCE_MINOR_MAKE_VECTcaml_domain_aloneEV_C_MAJOR_HEAP_POOL_LIVE_BLOCKSbacktrace_bufferEV_COMPACT_EVACUATEEV_C_MINOR_PROMOTEDEV_ALLOCbasecaml__dummy_rescaml_runtime_events_user_writecaml__dummy_list_itemEV_USER_MSG_TYPE_CUSTOMcaml_runtime_events_user_resolveEV_C_MAJOR_HEAP_LARGE_BLOCKScaml_secure_getenvEV_EXITtrap_barrier_offbacktrace_last_exnlong long unsigned intoffsetevent_content__atomic_store_ptrmessage_typecaml_stat_stringcaml_ephe_info__listcaml_gc_policydomain_idcaml__framegetpidslice_budgetcurrent_ramp_up_allocated_words_diffactionruntime_events_buffer_headercaml__alone_421caml_register_generational_global_rootev_message_typeGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablespthread_mutex_unlockcleanup_on_exitatomic_uintnatcaml_ev_endEV_MAJOR_MARKextra_params_areacaml_runtime_events_current_locationEV_INTERRUPT_REMOTElong long intEV_USER_ML_TYPE_UNITmark_stackc_event_contentephe_refEV_FORK_CHILDuserEV_MINOR_MEMPROF_CLEANEV_MAJOR_GC_CYCLE_DOMAINSEV_DOMAIN_SPAWNEV_EXPLICIT_GC_MAJOR_SLICEparser_tracestack_cachec_stack_linkindexEV_EXPLICIT_GC_STATcaml_ev_beginring_size_bytescaml__dummy_write_buffercaml_custom_tablestack_infoversiontag_tstat_promoted_wordsring_distance_to_endunsigned intev_user_message_typecaml_runtime_events_user_registerEV_MAJOR_EPHE_MARKcaml_plat_lock_blockinggc_regsrequested_minor_gcstat_major_wordsevent_tagshort int__jmp_bufswept_wordsmmapEV_C_REQUEST_MAJOR_ADJUST_GC_SPEEDstat_minor_wordscustom_events_offsetcaml_alloc_initialized_stringEV_C_MAJOR_DEPENDENT_WORKyoung_triggerEV_MAJOR_SWEEPEV_USERGCC: (Debian 13.2.0-18) 13.2.0zRxA <LC ACA~C\ACACA~T DAD DTX C A CECN A~ ] MADB @<AP C A ABADA~]AAAADA AFA~DAdLpA~CBA(P AFA~VEA$@C AFA~ODA(hTG A E AFA~CAA(TG A E AFA~CAAD$C AFA~OEA(TH D E AFA~DAA((TH D E AFA~DAAHT@BB] BA A ACAA~OBAABCA AFA~EAHDDdNA~EBA$lApF A E AFA~CAA,$hGA~ FAB (T0EpA~p BAA H BAB $FA~NBAJA~4BG AB A AAA~Q BAC BBA4C AHA~y GAA L,BBi CD A AAA~b CAA b AB HAA AFA~E AD D|C ACHA~x IAA N JAD L. Hbh $ (p0 8(1`?   Z~0<.JHdo`xD-Jh @8HPDhDdl '7@GSZ`s0.<PW(y@ X=EMruntime_events.cstw_teardown_runtime_eventswrite_to_ring.constprop.0stw_create_runtime_eventsruntime_events_create_from_stw_single.part.0user_eventscurrent_metadataruntime_events_enabledcurrent_ring_total_sizecurrent_ring_locring_size_wordspreserve_ringruntime_events_pauseduser_events_lockalloc_bucketsruntime_custom_event_indexcaml_global_barrier_and_check_finalmunmapcaml_stat_freecaml_global_barrier_release_as_finalunlinkcaml_statecaml_time_countermemcpycaml_failed_assertcaml_num_domains_runningcaml_runtime_events_post_forkcaml_try_run_on_all_domainscaml_runtime_events_current_locationcaml_stat_strdup_noexccaml_runtime_events_destroycaml_runtime_events_startcaml_runtime_events_pausecaml_runtime_events_resumecaml_runtime_events_are_activecaml_ml_runtime_events_startcaml_ml_runtime_events_pausecaml_ml_runtime_events_resumecaml_ml_runtime_events_pathcaml_stat_strdupcaml_copy_stringcaml_alloc_somecaml_ml_runtime_events_are_activecaml_ev_begincaml_ev_endcaml_ev_countercaml_ev_lifecyclecaml_paramsgetpidcaml_stat_allocsnprintfopen64ftruncate64mmap64closepthread_mutex_lockcaml_lockdepthpthread_mutex_unlockstrncpycaml_plat_fatal_errorcaml_fatal_errorcaml_runtime_events_initcaml_plat_mutex_initcaml_register_generational_global_rootcaml_secure_getenvcaml_ev_alloccaml_ev_alloc_flushmemsetcaml_runtime_events_user_registercaml_string_lengthcaml_string_is_c_safecaml_alloc_smallcaml_modify_generational_global_rootcaml_invalid_argumentcaml_runtime_events_user_writecaml_callback2caml_runtime_events_user_resolvestrncmpstrnlencaml_alloc_initialized_string$! 62>2B@F@H" V2Z@d# r2v@~2@$ 22@@" 2@# 2@2@ % 4% &Z&X&C2@"@(' ^2 j@ 20 ( 22 00 ) 228008) 2262h>0B0hD) f 2j @2@22@@" 2@# @2220@ 0, f2j2r0v0|) 2@2@. 2@R2V2Z0^0h n2$r0$, 220 0 , r2v@z2~02@2(@(  226@:2>02@2(@( 2@ 2( @( N2 R2 V0 Z0 p, 2 @ 2 0 *2 .@ R2( V@( |  2 @ 2 0 2 @ 22( 6@( \  &Z &X &C 2 @ &2 *@ 48 @9 T# `: 2 2 0 0 ) 2 @ 2( @( "2 &@ 22( 6@( T  r2 v@ 2( @(   2 @ 2( @( :2>@R2(V@(| A B 20@02@20C  2 @2 2@"@ 62F0HD ^2b@hE F 2@2G 2@2 0 022B0H IZ2@IXIC2@J 2(@(? 2@HK 20C 2`0`L 2X0XL 2808M 20M 2@20M 2808$O .2204P >2hB0hDQ N20V@0j 2n @v2z02 0 Q 2$200$Q 2@  8 *20.@0X! j2n@$ 2@  2@202(@(r2v@~@202@2(@( T N&ZZ&X`&C2200V 0W HX X H IZIXIC2@IC202@Y 4J r2v@K 22 00 ) 20Z 2`0`L 2X0XL 2X0XZ 20Z :&ZB&XD&C2@ 2(@(| \ 2@2(@( H V2Z2 b0f0 l)  &Z&X&C28:08dH z2~@J ^ _ $` <U 22 00 ) 2X0XL 2`0`L &3&P 30&`83H&P3`&h3x&3&p3&03&3& @3& 3& 3 & (38& @3P& X3h& pp3& 3&03&3&3&@3&3&3(&@03@&0H3X&`3*&@&  t&*1U6 D`W^Le >l s Vz (* 5^=KvP]j(}[+> t < N fl _rsx~%<a  ' 0>2LZdh!v  o . E O ,:H"V!drW  Uc     ,8^D^jfvv Q!C - & *6RB \N SZf4r` TR (2DAMR \/fW RJ #)z/ .5;`AH `flrr ox:~!|  o/p  Fc k     =  & , 2 8k > D J Pn V \ bz hK nf t zw  W  0   > z `  ! m   [ l    4  . K  ! ## ) / 5 r ; A G N ZN h> v  3     > $   c  * % = C I O  V c q  }M     )  D !T   V y 9 -X @ M Z g u  V y 9 X     % ?V Yy f9 sX  m  v _  !    m6TCg|s V9 w   M)D6 PC_P]jQwM#!F)&^&*&0D'&0<& EQ&$Zf&o={&(Y& t&&8&`!i  j@"` w(H $*<)R ! A<]rsf!-]!w W &eH^k>7{A& `R !%*9IY2iqtx} L)'&L31&  &,8&@W&l}&dS?;&lmd`ws&&X&l &x#'0&9JNW[`&q&`|&&&&& &&0#.27B;F5KWb_fUk^{nO& & *.3?|JNS^bgrv&&& 31&=; PN&$&D3MXb\Xa&v&&P&&L(C1<@J&S(d&}&&t& & x&@"*&$+ 6J:D?JjNdS_jnsVu& "-1 7&DLW$[ e&n84&]Ypl&&X&&$  &<!26?CH&Y&`d&<}&p&p&&$&8&P&&$1&;&P& ]&n&&& &X&& S  j & $ 7 ; @& e& n  &   & &(   &! !&!2+!6!!?&!H&!`&!{&!W!U!&!&(!c!_! !!!!& " "x"r"+"/"4"L&"& "& "& "&"""& "&("##p#!& p#8#C#G#P& p#Y& p#u& p#&###& #&(###& $ $& $*$5$9$B& $K& $g& $&$$$& 0$&($#$!$& X$=% %%'n%4%A%N%[%g%s%>% %%% A%%% %% &&&!&- &@&L &Z&f & Z&&&& && &&& &&& ' &'-'+')& '@&('N7'R5'[/'f& '}'G'?'''p'j'''''& ( (((('(+(1(:\(E(I(N& <([& H(s& \(& h(((((& (& (&(M(& ) )))!& )*)2);)? )H& )c&)q)u)& )#)!)6)4)& )))& ))A)?)K)I*& * *& *4V*8T*Ak*Eg*O& 0*d|*hz*q*u*|& `**& ****& *j*j++ +& +-&+;+?+I& +b+f+o +s+}& +++& (++ + + D+ B+& (++& (+ O, M,  d, `,& P,. u,2 s,; ,? ,F& ,{ ~,& @,, , ,& @,O,_, , , , ,& x, 8- -! ---; -G-U-a-r -~-8--w-- --8--. ...$&.;.F .J .O.Z .^ .c.n =.r 5.w . e. ].d. . .K. . . .. . . .. . .&<.9/ -/  )/Z/  >/$ :/- b/1 ^/7&P/D&l/\&/i&/v&(/&</&/&,/$/&@// z/ r/0 0 0 0 0 0 0( 0, 01k0< &0@ 0E0P 0T u0Y0b0m 0q 0z&h000 0 0 0 0&0&0&0&`0g1 11 1,:18 b1Z L1k1x111 11 111&1&2 2&22# 2' 2-222@&2U 2a&2k2u 2y 2&l2&22&2&3  3&33) 3- 33&3A/3F&`3]&3r 3| %3 #33 83 63&`333 D3 @3&33 U3 S34 `4 ^4 s4 q4&4(&4:&4C4R4_ 4c |4l 4p 4v&4&4&4&4 444 44&5 5  5 5&5 5/&5H 5L 5U 5Y 5_&5m&,5&5&<5&5&L5&h5&5&5&6&6 &(662 6L6ZG6u"6 66&P6 6 6*66j6^66667#77Y7S7u7o7(7,75797B7F7O7S7\(7`"7iH7m>7vy7zo7&7n777&77777&788 88&82<86:8?&8TO8XM8aY8eW8p8}c8a88o8m8{8y8&08&(8&8& 9 &9&92&89?&9P&L9a&h9n&9&999999&(9&p999&p:&:&:*:4&:O&(:d&:m:u:&: ::: ::&::&:&::;&;&(;((;,&;3&;j&0;2;0;&0;&;=;;;&T;&(;&|<$< $<&O> >&P>,&(>:>>>E&>{&>/>>>>>4>(>c>_>v>r>>>&$?? ?&D?(?,?7&?@??Q?U?^&?gO?x?|???&?&X?&?Z? ??E?A?&?e@Z@ V@&@u@,@0{@9@=@B&@S&`@^&@w@@@@@&@@@&0@@@@@@@&PA&A&A7&AS&Ac&PA&pA&A&A& A&B&B(&B=&8BG&B\&Bf&Bw&BBJBBF&8V&8~&X&X&8&8&`&`'&D&(&&&(&(&&?&8O&8w&X&X&8&8&`&`&*&(]&&(&( V& |&( & & D& T& & & ,& g& & & &&&&8&8&X&X'&7&a&8q&8&`&`&(&&&Pf&`n&&@\P`Dlp0 @ , X    p 0(X@@00.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@Ҹ%h&, 6 p1@ ;2O"(J@0Y"8BT@0` edxk]s@~( b0@0;I@x0!0J l@`p0 ! Hk/39 0 0 0 644 198840 ` ELF@@|a|wx??|#x|+x!A;;!A,?A8``?U)>, @$?U),)@,?@=B{hd>9J?} B;}Jخ??b( ;{;9JyH${:$~B})R|8@>A````W>{겂,9 W}}ZQ+@@|wR}GB^x|8@@|7@@>8!9)>!Aa|N ``8xxH`K``=BJW|(PAP^ 9){})}?HP9J9}J> ^K<``=BJ|*8@8'dxxH`>K`<8!9)>!Aa|N  ``|=B9Jxd} J9 }J(<|x8 9J!AyH$|Bx $|Z|%8@!p!x!!A!!!@PH``A!|;x|Z|%8@9J9)}J})B8}PP!AD$U*>y(, @U*,*@y)})Y|J|Z|;x|Z|%8@@|% @@L!p8p8 |#x9)!pH`U),)A>y)9)()@{s{޲@x="))|?H@@,="))|?H@@8x#xH`_x;,A\=U),)A=y)9)()@(>;;AH7;As@="))|?H@@,="))|?H@@8x#xH`x;@,AU)|(H@s@?|H@<K`==U)|(H@(s@p?|H@ K`{{$P>, @xK,```{{$P=, @xK```<, A0W>( Ad( A( A$( @T8!N ``{B{޲|<@@|9<!y)$?"Aa?P;9J;H``7;As@="))|>H@@,="))|>H@@8$xxH`^x;`,A=U),)A=y)9)()Ax==U)|(H@`s@>|H@7;@@!Aa8!|N ~{{{{$P=, @xKH```sA,?AH|8, @#U),)@#y)})|cJx|<@@`{,;@H|8!aN HKt```|9@|#x|+x|x!qD$| (@="@_ ?9);x})9J_ 9)})@P?@H`,@t=Bx*>H`,@d8!|N ```<(@U*y),*A9)|)@@<bsc92U{>g*)z[$c9: ::```_3}?J|)@@|IUIU^>|(HA(A; }?|=H@@|=@@,A 5,)@,9@: : z$z$~ڲ}:*58`pxTc !Aa!A|xP|a|ct8!} N `()@0,1y^x@``x}^9RK``yO9/|)@At(Als@99?@\q} CxA0,'A,'@(99),(9)A$yJ}I9) B:0Z8,19;9)9J}/HPZ8:0(9)})z(:@9)}2HP})z:@A1U)>, @81U),)@(1y)9)})}1J|?HAK9 1U*U)>, @*U),)@,9@z$z$~ڲ}:*K``99?K?),)AIi8}IIN!A(sAp<?9,)@~B?8,)AT~ȳx```I_|G| P@L,I|'?9,)@~B?,)@H?,)@;|>@@05,)@<5,)A@=BJ``` :I}*Kx<p`B5,)@; 8|0xZjH`9 Zx5 ???9J? ?(?0?8ZH`,@, @\?U),)@L?y)A?z$_Ry)d9)}?Q*?,)@:Q:U)>, @:U),)@^0>@8}J}@8{UdJ, p!x!A@=BJ};J})R?@8!xAa|} N `a?B:w@zs$ZZjV>H$``I|ji0,1@l0,)A8%xxxH:|x,)@<HA^>X;~C=BJ9)>X{UdJ, AT=BJ};J})R?AT<9`9@xd```99*} y)$|*@|I*A8!xAa|} N `_,:Q@41}>*010Q,:A4K```>PK``<"1_j,1:9IZAjQ#x?="IH`,@\1,)@> ^(9)|)P> @>(=B9 @9JU) zR ?1}J;99JyH$}GR}(HPQB})t^@~>*9Z})|9P@9@QQy)Ud9)}1A*Z@8= |8Pa)xy)8e)p|3xa)9ZA0,%A,%A * |;x* 8,&* A$y} **9J **Bs)?@aK4#xH`,@h?j89)8}9*,)A~9*,1AQ9 V>~$xx}Y*1>1~>*HQ,:AD>?:;:U)>, @(:U),)@Z,:@j#x?9)?H`,A`HD```93p|H*,$@j#x?9)?H`,AH|dExx}YI*0$>$H?#x9)?H`,@8?8Exj|"8xH?|zx,)AI}JI~>*,1A0Q>?1;9|*H@="9)K<, @IUJ,*A<@p=9)=K`A(H `=>9?Q@,>A>=BJ=~Wi{|*H@Wi>, AP=H{]x9)}?HP=H*9)})*=X9)=XH`Kx``>8~),)AIi}IIN!A(K=")))@,)A!Apx=, @?>>>;=;@;::;p:`9,)@(9,)@ W[>,?A(``xxdxH,?@W[>,?A0`?,)@xxdxH,?@;ZWI>, @lpA?";@;`;9H}:KxYW|*HAT{9:;{,>@{Fx=,)@xxxH;8xxHW>;, @,?AA(H `xH`,?A`?<?U)>, @?8),)AIi}IIN!A(xH`,?@8!|N < H`xxH``^ yI 9)})9JB@^ }Iy)$H*s@="))|?H@@,="))|?H@@8$xCxH`?;,)A?, AxxH`#,)@\c:?U),)AD>=BJ9)>?U)|*H@?9_, A?( A;*, A@7yH$y)|*H@@0`*s A(;7yH$y)|*H@AK> ^~| PA}*9)yJ$;> Q*K=y)y)$P?, A<x$H`> ~K``sAX,?A`??B>>">B?>b>:;;Z::1:R;xj;:s:H8``I)|*H@H`,A|<@;A? ,)@?,)@;,)@d=,)AW|)P@>,)@>,)@ =,)@x8DxxH`=I)|*HA`8Dx~cxH`H`,@L8Dx~óx;H`|<@@8;?pcx{:g9c:`;@; 2 ,)A8`)8c,)@xc&H`|nyA,$A =Byd9J}sx9 }sx~*x8`;~ @.:1z1$z$```}=dEE}(9k|+H@@DH```=BJ|*8@E;9JE}(Kx})|+H@AdHUF>UG,@('@yJ8c}*|cR8|R}(J})}(Kx})|+H@@```8,$@4,#A,?Ad9@,8@ H ```|*@;@Xx>,8}JBP@}sxH``|6@9@88`-pH`A~xH`?8`.H`j,&A ?j;8x88H`,&A j888xH`=,)A 8W|*HA x ;HxH`x;;HxHxHxH7@?;,?@H@``,?A,]?U)|*H@8H,?@j?,)A xH8H8`.H`@8`/H`,3A (?;c?{W g;c~cxs=C#9J}=H9)y%$|*|&P@@99&}@Py8p|;xA4,$A ,$A)*|3x}Cx 8,' A$yJ}I9) B#}=H9)[ @x9J})@P[ ;@H`,3@08`/H`@j>,)A W|*HA@,)A<,)A<}~:s|3@Axpx~x~޳xHT`<U?;|'A(3A`|'AT=|)Ah~x~|?@AU>(@U(*A>bs?;|3P@A<|'PA=|*H@;@[08yβ9)9J}0HP}NPP})r8[0;@8Alr ~ x8A<,*A$,*A|;x;9);,);A$z }); B~x~|?@@`pxx]x,*AP}]SxK\``vT>,@lT,'@\x粃A|||&(@A<8|&(@AxUd8|*yŲ~cx8xx$}8H`=:sx})sx8K```,'@K``yɲ})}8J~K```<,)@<W|*H@~xH`,|dx@??}_j,>*9  A4;W xxH`,>@}?j)9)j9@~x?="IH`,|dx@L|:x} 9)} @L,K }sxH`K8x8H`K<sz == szlockunlockWhsize_hd(hd) <= wha->owner == local->ownerIs_block((value)p)POOL_BLOCK_FREE_HP(last_free_block)p == end(all_used && !a->next_obj) || (!all_used && POOL_BLOCK_FREE_HP(a->next_obj))Caml_state_opt != NULL!heap->unswept_avail_pools[i]!heap->unswept_full_pools[i]!heap->unswept_largeOrphan shared heap. Released %d active pools, %d largeReceived %d new pools, %d new large allocs!heap->avail_pools[i]!heap->full_pools[i]!heap->swept_largewosize > 0wsize_sizeclass[sz] >= whsizePOOL_BLOCK_FREE_HP(next_obj)r == NULL || r->owner == local->ownerpool_freelist.free == NULLr->owner == NULL(uintptr_t)end % Cache_line_bsize == 0p >= (value*)POOL_FIRST_BLOCK(r, sz)p < (value*)r + POOL_WSIZEPOOL_BLOCK_FREE_HP(p)p[1] == 0 || POOL_BLOCK_FREE_HP(p[1])(r->next_obj == 0 && local->full_pools[sz] == r) || POOL_BLOCK_FREE_HP(r->next_obj)local->next_to_sweep == NUM_SIZECLASSESlocal->unswept_avail_pools[i] == NULLlocal->unswept_full_pools[i] == NULLp->next_obj == NULLPooled memory: %lu allocated, %lu free, %lu fragmentation!Has_status_hd(hd, caml_global_heap_state.GARBAGE)local->unswept_large == NULLLarge memory: %lu allocated, %lu free, %lu fragmentationlocal->stats.pool_words == pool_stats.allocatedlocal->stats.pool_live_words == pool_stats.livelocal->stats.pool_live_blocks == pool_stats.live_blockslocal->stats.pool_frag_words == pool_stats.overheadlocal->stats.pool_words - (local->stats.pool_live_words + local->stats.pool_frag_words) == pool_stats.freelocal->stats.large_words == large_stats.allocatedlocal->stats.large_blocks == large_stats.live_blocksHd_val(v)Has_status_val(v, caml_global_heap_state.UNMARKED)Compacting heap startheap->avail_pools[sz_class] == NULLheap->full_pools[sz_class] == NULLheap->swept_large == NULLatomic_load_relaxed(&pool_freelist.global_avail_pools[sz_class]) == NULLatomic_load_relaxed(&pool_freelist.global_full_pools[sz_class]) == NULLCaml_state->young_ptr == Caml_state->young_endcaml_mark_stack_is_empty()Unable to allocate pool_stats for size class %dtotal_free_blocks > 0!Has_status_hd(hd, caml_global_heap_state.MARKED)!Has_status_hd(hd, NOT_MARKABLE)POOL_BLOCK_FREE_HP(new_p)POOL_FIRST_BLOCK(to_pool, sz_class) <= (header_t*)next(header_t*)next <= POOL_END(to_pool)Compacting heap completeCycling heap [%02d]Finalise freelist. Freed %d large  >*W!`P|  !%*/5;AIQYclv       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~xWO,: Xint   !V  !i  ,HY ! P   +:(:   3  5#  6#   7(  A i A i  A " | # | $Z( C DEDFDG H+(:' H [ WHZ:lmQO.4i] XEN!pE2E9;\<!=>!?i +(:?]" _d__"_%_ ((+0.82@6 H9_P=_XAC`CMhFpIxLPT[`rtwy{}d A( 08^idA@AHPX`hpxA_ 8+$sp0 _1 _3 :A; . < ($id= 0 dpu$spw x  ECF 3G 8Hyp < H@    R0#$ * /A7 ; <  _`\] )^ )_ )` )be)ce)e Z)g )ir  < < @$jmpA GBC < F&322   2$key# Z Z     ! _@   & : Y # m($ &0%% r8G  HA & H : +G T T T  ?H m ^ 4iJ       !"#$%&'()*+,-./01} wF* +H (:?R   )! A)"`  (:FF R. Gabuf/  -4i e L } G    ! " # 4i  3 3 23 385 5 $end5 5 $ptr5 5 5 (5 0 _7 8 9 : 8<?<?$end<?<?$ptr<?<? < (< 0 >y? $mem@ $maxA 8CC$endCC$ptrCC C (C 0 D  :+_(:4i!0NhS!AS@"#"$ "% "& "' "(  ") ("* 0"+ 8!r3dDE:F FF3H!4iKZb#V!Z+p{(:!k@# { +](:!@# +f(:!@#! $$ $"$%$&  $( $* ($+ 0$, 8$- @$/ H$0 P$1 X$2 `$3 h$4 p$6 x$7 $8 $9 $: ! |3$=( !P8B9 _: c( d:+  123 _4 $sz5 Z e6eBC D EexIKJNK K(Nr0OUp)PUp)Qep QK+Pe(: @R +K(:+(:!Tq I(, _,AfspA , , 2 eI;, ., .I( , , , , ,  1A51%G  q e ]5I 6&+ .g:A5H+ 1Q q e_6)_ll 210l1' q1% q e A6 6Z 5(8 A().A7A1"5NNS r 1SjA!C A 1"4NShAA! A5i6&=A.5eA6a3 -  A" ae s's sssS S ss sssS jSS T-uu.j iwZHSTU xSTU {S jkSSS T U kkSS-k41 l m#F F3G;G';%iKZ0pNK%pPK#< a<'es<<%hd> ;78aKsz,ZsBU v_STU  p8 end8 wh hd& sb's~ssSTU 'S T U 7 - ,+ A.,   K   K Z5 , Kg , K STU STU  STU STU HS T U {S T U STU STU STU $ Z  K  . , k .  .  . ' . j( . ) .0 , p8 end8 wh h" \  ,  J( # pI8 endJ8 whK  K hdN"!0 N!, N!" YK Z_ ]! `_!S T U fS T U b"0" l_ s"Ms1 s&x"kSTS T U ["8"  8S" w" #  sbQ #Qs~ss#S T U R#S T U QS T U QX$ S~$2S TX$JS~$}S T U $S T U XS~%2 Z8W8W8W8W8W8W"T&p laeJ p8s< &ZsWsM&t1&tBtNtOt['sbs~ss9S"'  K& p8hh=h0h#T(j  K  K s's s'ssS S s(Us s(@ssS jST s(tSs(tS s)-tS s)jtS)S )S,)S-)S-)S.*STUW1*;STUW1,*SS,*kS*S.*S/*S/*S *S,+S/+S/+MS T U +kST+S T U +S T U +STUW1,-S T U ,`S T U ,S T U S/  P  K d7m8Wm6u  v0 iy?z??))?O?D?7.?Z<-?[?gSTU ?)?7?O?D*?Z?[?gs< .sW sM&t1. tBtNtOt['sbs~sss< /sW sM&t1/ tBtNtOt['sbs~ss?s0>?x0S T U S T U t1 0 tBtNtOt[S T U  ?s4d??))?O?D?7?Z1m?[?gSTU ?)?7?O?D*?Z?[?gs< 2sW sM&t12W tBtNtOt['sbs~sss< 3WsW sM&t13 tBtNtOt['sbs~ss?s3?x3S T U S T U t1 41 tBtNtOt[S T U t1v4 tBtNtOt[?w??))?O?D?7.?Z<5^?[?gSTU ?)?7?O?D*?Z?[?gs< 6sW sM&t16H tBtNtOt['sbs~sss< 7HsW sM&t17 tBtNtOt['sbs~ss?s7?x7S T U S T U t1 8" tBtNtOt[S T U 7U$9U(K pX8 endY8 whZs<^ 9sWsM&t19htBtNtOt['sbs~ss97/?p/,8 hd1  tag7 :stk?  t@ :_ t#STU 3 tA7: t#STU 3+S T0U0W0> D  K iL?M ??))?O?D?7?Z;?[?gSTU ?)?7?O?D*?Z?[?gs< <sW sM&t1< tBtNtOt['sbs~sss< =sW sM&t1=a tBtNtOt['sbs~ss?s>?x=S T U S T U t1 >v tBtNtOt[S T U >S T U 5S T U <#'?)p'<#?/v/p9%tag  .0?fwdS T U -F3  stF G"@FKGGS( FEF-F!F8t1@tBtNtOt[s< AsW sM&t1A tBtNtOt['sbs~sss<BsW sM&t1BQ tBtNtOt['sbs~ssFVCFWFaCXFbGq GGGGGq GGGGt1 tB*tNtOt[t1 CtBtNtOt[FDDFI tDpt#S T U 3+S TUVWDSTU QDSTES T U ERS T U S T U ESTUVWESTqESXXS # Fost5Fv? Fo0FVstk%i A%f  -Gqv*p=GqGGGGGq GGGG# G v,?stFlFGstF-HL$ S9$H=tag"-hIacch6N sjHs sHssS S slIs sIussS jSST0-`PILaSLbNT#[ I[D7O|K|PrP*KszP7ZTRr gTK6gg gggggKg*gghS T U +KXSS#T7S #0T#G KGA-4Lr4&f49 q4B wh5  p6 8 end7 8J8 hd: sb; Ls~ss8STU090 L029) M )59%  MB%0-TN  sz ZmV_t"N3 VmVzVV.V,NV8SNSSNNWSTUNN|STUS T U 7P3A,sz$Z a K p8 end8whPu hd"O , ",O  8SP  ,  PES T U S T U hJSTU9V_+9Q_ szZ    VQQST"UV1V V RBVVVVsbQs~ss.V0R,V8SS1?KL~XdSeRRSTUSTU Q.o4SAtSTUSfSTU MSTU L YT:* sb?T s~ssS T U ?TkS TUVTS TU0TS T U JTS T U hU.S T U ZUaS T U aUS T U `US T U gUS T U dV-S T U cS T U b# V:p _hd ae% :V9p _hd ae% n|Z2@,sz$Z,A   a K p!8 "8 end#Z wh$ % A s&NY hd0"X_ 0, 0",X A 8SX iL woL sb> Xs~ssY1S T U JYdS T U gS T U ?Y ,hJYSTUZ S T U Z<S T U (ZoS T U S T U  9_ <em6Ftag$4   p _d: sN szZ e d eeeee e c fff f%`fDf7fPfZ.ff\fkfw.f\ffs,]]Zss]EssS.f]ff.f]fff]fff^&gSTU l s^s s^ssj^Sj^Sj^SjS.g_ggg,_=g-g9I_aSTUI_SUV_ST " UV0_S T U S T U  ibij /s`s s`ssS S/sa}s saPssS jahSjSjajaS T0S T US T U gGbglg`gUgyggS T U DVbSTUV0S T U c@S T U csS T U cS T U cS T U S T U S T U dV iA s dosk em deeeSeS TU eDS T U S TU :e5szEae:e4szEZp _ _r K:Kf%0szAZr K:RKgGR8szRIZrT KUA0fX,XK0fY,YK0f^,^K0f_ ,_ K0fb,bK0gj_0g,x ,x K%{,{K#0gr0(Ksz1,Z25 p4 8end5 86 # ha#Ksz0ZsGNp 8end 8wh %hd % , # hJ/ Ksz$Zp $i=2 Ksz$Z si0s sissS S s is sissS jSS T U ;Kj"M3Br K%Bmem CDj~=4j~jiSXSCk=?kS>iZjSTUkSTUk2STUSTUkS T US T UCn=:?A?A"l>iZ/r lr5r)rrA*rMrNqr  r5r)rrA*rMrN" m >ae/sms smssS S/snPs sn#ssS jn;SjS/InISTS TUCr =6?A?Ap3>iZ/r or5r) rrA*rMrN/r or5r) rrA*rMrNpSTUSTU",pY>ae/sps spssS S/K|q&KS0T/sqs sqssS jSqS TUS T U; ArY2src",2dst7,M. NA%Bp Krss ?trBixZxST0U rS `S T UUi;Us<2hdU.2sU9;QAsb2vQ&2sQ0;MAs2hdM(2sM3#sm4s N#sm;s#s(err4AUAstM*A:1t1val1!;+ti2val8%N ,N O?)w?7?D?O?Zt?[?g?)?7?O?D*?Z?[?gs< usW sM&t1u tBtNtOt['sbs~sst1 vMtBtNtOt[s< wsW sM&t1v tBtNtOt['sbs~ss.?sw?xwkS T U S T U S T U OGqxsGGGGGq GGGGOGtxKGPGS(VVI~1B41B : ; 9 I8 H}H}( I 4:!;9 IB  !I 4:!;9 IB 1RBUX YW  1 : ; 9 I 8  :!; 9!I!84:!;9 I4:!;9 I U U: ; 9 I1RBX YW :!;9 IB41 : ; 9 : ;9 I 11RBUX!YW  1UH}: ;9 I:!;9 IB $ > !&I" #.: ;9 ' $ : ; 9 I8 % &1RBX!Y!W! '1RBX!Y!W! (!I/ ) : ; 9 I8* 1U+I, :!;9 I8 -.?:!;9!'@z. 1/1RBUX!Y W 0 1.?: ; 9 '<2: ; 9 I34: ; 9 I?<4>! !I: ; 9 5.?: ;9 '<6.?: ; 9 'I<7.:!;9! '@z8H}9.?:!;9 'I@z:.: ;9 'I ;.: ; 9 'I <<=:!; 9 IB>4:!; 9!IB?4:!; 9 IB@4: ; 9 IA.?: ;9 'I<B4:!; 9 IC.?:!; 9!'@zD :! ; 9 IE:!;9 IF: ; 9 I G'H'II :!;9!J K41L:!;9 IM: ; 9 IN4: ; 9 IO.1@zP : ; 9 QGIR !!: ; 9!S4:!;9 I?<T4:!;9!IU.: ; 9 'I !V.?<n:!);!W% X$ > Y Z : ; 9 [&\5I]  : ; 9 ^ : ; 9 I 8_ : ; 9 `I a : ; 9 I 8 b(c4G: ; d4G: ; 9 e : ; 9 f : ;9 I8 g.?: ; 9 'I<h.?: ;9 '<ijH}kH}l.?: ;9 'I m1X YW n.: ;9 'I@zo1RBUX Y W p.: ; 9 '@zq1RBUX Y W r.?: ; 9 'I@zs.: ; 9 ' C90nn0S  МܜSSМܜ  ȝ  ȝSSȝ  ИSlSSlSS0ܙ Ț XZXXZXZXSXg~Sg~SXTXkTkTXUXnUnUPoogmgghS#hS#iT2$"#  iT2$"#  ooo  oozzSzSzzTzeЈTЈezzUz~g~ЇЈgȕЗgЗ{kЈkЗk~ЅcԊcԊo~mo̒~̒ؒmؒēcȕcЗcoēoЗo؅c؅ScȕcЗc{|1}}~~}}YY}}nЉn}}YÉY~___З_~~Y~~YThgh0ԊhԊm~Z̒~̒ؒZؒܒTܒT{~ȕؕhؕܕ0~~S~SU^SԊ^ؒS^ȕܕ^0ؒ00āoؒ0oȕܕo0؀S؀sSؒ0Sā0āZZȕܕ0ā0ȕܕ0o̊oȕܕoXYX zx"YXX[[ $ &2$" ؒ $ &2$"  $ &2$" ȕܕ $ &2$" ZЀZXYXX zx"YXZЀZЀZ̋h̋ԋgԋh̍ԍgԍhy"Yؒhco ~#̒oؒ $ &2$" Z̒ؒZ̋^^^̒^̋h̋ԋgԋ܋h܋h̍ԍgԍhhy"Y̒h̋^^^̒^ff̒fcxcc̒cw:%ԎWďWW̒~ȎԎVԎ""V̒~ď؏W؏܏ Y02$" y2$" y#2$" #2$" y2$" y#2$" y2$" y#~:%Y~:% c^^ȃ܃1܃܃2܃121oԄԄׄSׄ܄ĄZĄĄĄĄȄYĄĄZĄĄY؅cVyyyȆyȆ̆yysSkȔܔnܔSȕnnܔnȔ  SST    SST  {{eeeeeēԓeܗ1Skkkkkknnnnnn2mmmmmmlo000SSSmmml0j0jj xY YXYXYooxjkkkkkkkkkkkkno000000SSSSSSkkkkkknn0mm0mmmm xY YXYXYoooxmnmo000000SSSSSSmm0ll0llll xY YXYXYoooxl S "k""k!!S!!o!!S!!sy"!!S!"o""S""S!"l""l!!2$" !!Z!!s!!s!!S!!Y!!Z!!YSoSoSoSSoSo S onnnnn nYYYY Y00l0 0nnlloooo ooooo omn0000 0SSSS Soooo omm0k0kkk k xY YXYXYnn nxkrrSrsosySswnxynssSssnttovwoxxotwnxyntuSyySttottmttYxxYuu uuguuYuu uuYuuZuuguuYuuZuuYuu0uvmvvvvmxx0xxmvvhvvhxxhvvhxxhvvnxxnvvnxxnvvhxxhvvnxxnuugvvguvYvvYvvovvmvvYxyyyVyyxxoyyo S o S o S T n sz" U U U U U T T n S o o S o S o S U U U T T n S o oppSppsppSooSopnppSppnoo pp ooSppSoo pp op pp opSppSop pp SoswSSoTu~TUUqPTqPUUty"TWTUT#UT#PU2$"#  PU2$"#  YYYYlmSmn~nnSlmTmnknnTlmUmninnUlls2$" lly2$" lms2$" lmYmmxlnlnnS#mmxmm mmxllSllSkkSklSkkSkkSiklii0iioiiiioijjjjjYijojjY%&S&(g((S()g%&T&(j((T()j%&U&(i((U()i%(d()d&'o''n'(o((o((y"((Y()o&(k()k&&Y''Y&'o''n''o''o((o((y"((Y()o&&Y''Y&'Y''o''0]]S]]m]]S]^m^^S^^S^^m^^S^emeeSehm]]T]]l]^s^^^^l^^l^^y^^l^eleeSehl]]Y]^k^^U^^k^^Y]^0^^0^^S^h0]^S^^n^^n^^m^emeeSehm^^_`^^k_`k^^n^anffn__ __k``Y`dmefmfhm`c 00cck1$cck1$2cck1$2cck1$cc kVcc kVcdk ee 00efk1$2ff 00ffk fg kVgg kghk abjbbkbcjeejffjff0bcoeeoffoabobcefbcnccnefnccoefocc cco)*S*,j,-S-2j22S22S23j33S34j)*T*2T22T23T33T34T)*U*,f,,`,-U-0f00U02f22U23f33U34f)*V*+i22V33V33i*, 8-2 823 834 8)-e-2e22t24e*-o-2o24o*+0+,a--a--o-/a/002a23a33034a*,m,--2m24m*,b-2b24b*+1--0.00120331**s*,,-S#-22333s34++Z--Z--Z// 22Z++o--o-0o01o12o23o++Z--Z--Z22Z01Y..1..!x  $ &2$" "..  $ &2$" x..!x  $ &2$" "..  $ &2$" x./00++ ++Z,,fFGSGJnJJSJNnNNSNOnOOSOPnPPSP\nFGTGJmJJTJNmNNTNOmOOTOPmPPTP\mFGUGJkJJUJNkNNUNOkOOUOPkPPUP\kFGVGOVOOVOPVPPVP\VFIlIJJJT#JLlLNNNT#NNlNOOZlZZZ\lIJoMNoNNSXXoIIGGeOP0VVeGHeJLePTeUVeWXeYZeZ[e\\eGInJLnNNnOOnPVnVXnXYnYZnZ\nHIoNNoOOoVWoXXoXYoHIjNNjXYj[[aGHeJLePTeUVeWXeYZeZ[e[[e\\eGHnJLnPVnWXnYYnYZnZ[n[\nGHaJJaLLaPP0SV0WX0XXaYY0[[0[[a[\0PPeSTeUVeWXe[[e\\ePPnSVnWXnYYn[[n[\nPP0ST0TUaUUTUV0WWTWX0XXaYYa[[a\\0PP0SV0WW0WX1YY0[[0\\1PP"ST"TU " UV"WW"WX " XX" YY " [[ " [\" \\ " PPYPP "PPYST SSSSS TT"TU " UV"WW"WX " XX" YY " [[ " [\" \\ " TTYUUYTT"TU " YY " [[ " TUaYYa[[aTT"TU " YY " [[ " TTTTZTUjYYj[[jUU UV WW [[ UUSVVSWWS[[SUU VV WW [[ UUy"UV "WWy"WX "\\ "UUTWWTWWy"WX "\\ "WWtWWZPQnYZnZZn[[n\\nQQaYZaZZa[[aPQ PPSPP QQ YZ QQSZZSQQ ZZ YYSZZSZZa\\S\\aRRWRSeZ[eRR"RSaZ[aRRjRSSSzSSzSSzSSzSSzSSzSSzSSzRSiZ[iRR x8 RS% "#3$8 Z[% "#3$8 JJ0MM0MMXMMxMNXLL3$LLlLMpNOpLMnNOnLMSNOS"#S#$o$$S$$S$%o"#T#$n$$T$$T$%n"#U#$m$$U$$U$%m## $$ ##S$$S## $$ #$ $% #$S$$S#$ $% EFSFFoFFSABSBDlDDSDElEESAB0BC CC!CD DD!DD <<S0>>k>???kAA0AA0<<0<=z3%=>z3%>>z3%#AAz3%#==V==W==#z3% $ &#3$"==0==T==Y==w=>[=>#z3% $ &#.3$"==0=>T=>Y>>{>?Y??<< AA <<SAAS<< AA ?? @@ AA ??S@@SAAS?? @@ AA ?@n56S6:e::w::S:<e57077g;<059099f9999f:;0;<077077077n77077X77Y7778078W78088X88Y88w99Y99Z57 ;< 66S;;S66 ;< 9:e:: ;; ::S;;S:: ;; 44S45o55S55oS S S ST T T o TU n U U nS S S S SU n n n nT o0 m 0 m m m xY Y o x m X Y X Y o o o S oSoS Tnsz" UU S oSoS UUU TTn S ooqrS,O,  8@L                       """######$$##$$###$$$#$$$%(()&&&'''()&&'')****--224***+++++-0011223****++..00++++,,0044444455566666666666667777;<66;<666666677778;;6777776777777778888888999999::99999:::;;::;;<<<<<<<<<<AA<<AA=============>>>>>>>????@@@@@@@@AA??@@AA???@@@@@@@AAABBBBBBBBBBDGIIIJLNOOOOPPYY\GIJLNOOOPVVXXYYZZ\GGJLPVWXXXYYYZZ[[\PPSVWXXXYY[[[\TTTTTUYYUUUVWWWW[[UUUVWW[[WWWWPQVVYZZZ[[\\PPPPPQ\\PP\\QQQQQQVVYYYYYZZZZZZZQQVVYZZZZZZZ\\QQQQQQQRRRRRRSZ[[[IIIIIIMMMMIIIIMMMMJJMMLLLMMMOO]]]]]]]]]^^^^^^^^^_``aadehaaabeeffaaaaabeebcccefccccccefccccmmmmooooooooooooooppooppopppoppprrrrrrrsssssssrrrrrrrrtwxyuvxxuuuvvvvvvvvvvvxxuuuuvvvvxyyyxxyyzz{{{||~~~~~Ј}}}}~~~~~~~ȕܕ~~~~~~~ȕܕ~~~~~~~~̒~~~~~~~~Ћ܋Ѝ̒~~~~~~~~̍~~~~~~̒~~~~~~Ď̒ȃąЅ؅ąēēȓԓܗȕȔܘĜܜ̜ԜȝȝD  runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includeshared_heap.cshared_heap.hmlvalues.hplatform.hmajor_gc.hdomain.hstddef.htypes.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hweak.hfail.haddrmap.hcustom.hstdatomic.hruntime_events.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hroots.haddress_class.hpthread.hgc_stats.hsizeclasses.hstartup_aux.hmemprof.hstring.hglobroots.hstdlib.hE  EhE,hE,=  K...%-0  .""!!"! .w u.3!" "O  t! u  u   !t  < !- /  l ./"0. X^Xt  t.  3"!-"!! !t< J\< u"0. Xz{  {  ".{  !  {   {  {   %. {J > {N"% v  $!"!!%v!  ! .  3 # v   ./ {../Y{X. JX->>X  ! .x+    1 <. JbX f    2 *3  . /+y   $ !  x.+     / !! !!=     ! f q . rJ  w  $"3.&z  .vJ' 0-!1#.#&z # qt, I $ $"3.! .E' 0-!1#.#!# t ..       V /X X X  "! .x+    1 <. !+x  Z  !V!X X X  "! .x+    1 <./<;./=V /X X X  "! .x+    1 <2 x.+     / !! !!=  ;/< u  J+y   $ ! ;Y W!.J  x.+     / !! !!= < x.+     / !! !!= <l+y   $ ! ;X+y   $ ! ;Xu  ,s W!.  W!.  u . u .  K$.0 %042.vf  #! # t f . X# =ZV /X X X  "! .x+    1 <2 x.+     / !! !!=  #.<X3X+y   $ ! ;X1 !y !y<.dX.'tf .0E< W!. z. y.= yX u .   &X  ! Kg!"/"" .!.. 0w.+     5 w  /   . . . 4 . " w   <  pJ<. v. yt=u!=H  H~  5~./5 /p..~ ~  !!T.~.J yX    X.<.(( 0 ?"Ld0V  ft $z !&# z "  M  /  / /".t !$  s /    . !  / < iJ  f. J . y.   x.D ~D L!/?(Ms# +# #L# I^ $8; 8 I  X  &.Jg  ./ | |   ".  "."   /03C71../!  t f< <<< B<4 Y #. < "y   d    A<./  6  ""8 ?8  !8!?8. /?8 ?8 8!?8 ?8 %"  p ,! ! !# K [  !...1&$.  .5  " 1< ..571.X ?8< u /".t   "  W f )w&$.  .J4~  . Jt    J 6{6 16 1/Dz &z &z .#!!!0"#J)t<t<}<<} .<} < <}r.  }  }  } .}Jw  .}  }= m ;"  !! X! / z& z.x   l  h  -L  !! X! / z& z.t =/u< < = 1V#! !  !   .5 / }. /} ! }J Jz!T..}hJr.f .<.A}tA}<A}. A}.r. <.}f <}! R . O  -L  !! X! / z& z2.Z * N4  I  ->  !! X! / z& z2.V /%<   .=#!# !! !! z 6 1!=V. ~ YJy. }J /}. }  }J <z!V.  ~h"KJ p..  X.XE~E>E1!E%EZE,"E#!!V==/8 !/~ .==tVu<ut::Y!=< !@@!0/X/Y.!(.!!H"//...1 /  "  ." / %!....'!!!,!| .!| t| . .''  . X Y!0I";" .=W!0 ";" 3!!] "^ = !! !!" !# | . !!| <. .'' !!!X"!!!" . J#!! !  !# f"J]1.J<./3!Jy   J < /  C.~p<.~ .~. <~ ~  ~ /V.   ~<!!!!!!H   H  4  5   5      "  #! #u   w  ~  ! ! ! .!#!.t!  !  !   .! ! !.! #Xp<.f /  /!#8 ! !! $ ! / <.../&.!=V. X    .! /V.   tF  * " ! !!"!/V.  N!!!I!0.>#.3. M .<t&M J.. u .fh} !~  ~ "!V. L=wX!! .f < [>/$?y. /2. == + Y0I+ . * K=/H* ./    . c  J' <w !t  t  /:#  #/  <*s =k=KK  /J1=<yJt Xfs   ' ?u tr 5u,y#=#/-#/ .! /Y("(H B  X%w< % / "!  /!! .f%w< % .<#tXt7 =<Z&/9i(/IhI0 !I0   !  ! .! .Jz   z  /f.5.#f N||< |  | |.p.. |  | J/|!/T..J |<.<.'f ./* !"!/Y"/ZY;;;?A<;?  _.;!.0 g ; "B<  ] ;!  _.b Y"/?JA.? "@ !? A.Y>/L  J .   & .   V.0X XY+y .0A K= "x+     / " ,0x+    0   2 = !@ y +y    =!  ,! y +y   .0 L   $"3. ( X   ( j+y    !#===Vft   V.'0!?J#z //.f< .zfu=xJ /!<x <"""0"..$)0/!  "q</!x.   "HL.Do.)>==> .= 1 3 t JZ..)o< Do.).  u  )~  w  )~<  ~  0  v  " 4#! 3, 54  /$"$0%y  '5yJ!!#!"z !. J. /$ !$ 0  o  /       . 0 "% 3% 3%) "   o X! c"<1 .% v g @#! z %!! w B$  D). t2 / u +     / >2 .&  .!/0=v  D 4 v  v<  <   # !< ! #   ! # !  !#  / #  #  #-  #  Jv7 .  v"!!"!!"!.  u.=u  ..9!5!!4J & ! X  3//.t< J   vu+JeJ<<  [  X w< D .=u u <  .t =wr< p   w. .w < #, "= w.<w w  0wV.* T  .f~B$  )N  t1y.\1. &.t"}.t.=u   < <- J4z /<!5v5?5=5/"5&$5)11K0#"#!!/ "%!"!/z!#"#!! "%!"!/zD=!#!XIu!#!XI #iv# v<# v # .v.r.  . v.  .v <  !#" !/  v.< v!!T.. Y vt.<.scanning_actioncaml_memprof_scan_rootsreleased_largec_stack_linkall_usedsize_tallocated_words_resumedmark_stackEV_STW_HANDLERmove_all_poolscaml_collect_heap_stats_sample__kindwosizememory_order_acquireEV_DOMAIN_RESIZE_HEAP_RESERVATIONcaml_accum_orphan_heap_statsdependent_sizest_vglobal_heap_statebacktrace_slotephe_infoEV_FINALISE_UPDATE_LAST__pthread_list_tEV_MAJOR_EPHE_MARKmemproflarge_alloc_finalisepool_global_adoptcaml_cycle_heaphandle_exnpthread_mutex_unlock__nextreceived_l__datareceived_p__prevcompact_update_poolsstatecaml_sweepcur_poolEV_MINOR_GLOBAL_ROOTScaml_do_rootsstatsshared_heapcaml_heap_stateEV_EXPLICIT_GC_FULL_MAJORreserved_t__pthread_internal_listblocklocalcaml_stat_alloc__ownercaml_verify_beginrequested_major_slicecaml_ref_tableUNMARKEDHas_status_hdwhsizepool_blocksephecaml_accum_heap_statsslice_targetheader_tcaml_minor_heaps_endcaml_custom_tablecaml_ephe_infostat_promoted_wordslast_free_blockatomscheck_errlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnat__builtin_memsetEV_EXPLICIT_GC_MINORverify_sweptEV_EXPLICIT_GC_MAJOR_SLICEinit_percent_freeheap_verify_statecaml_plat_mutexcaml_intern_stateWith_status_hdstat_blocks_markedunswept_full_poolsdomainEV_MINOR_EPHE_CLEANPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_sEV_MAJOR_GC_STWheapcaml_cycle_heap_from_stw_singlepool_freelist__nuserscompare_unorderedev_runtime_phaseseenEV_EXPLICIT_GC_SETcaml_minor_tablesntablesorphan_heap_stats_with_lock__atomic_store_tmpcaml_plat_lock_blockingsigned chartrap_sp_offNOT_MARKABLEaction__pthread_mutex_scaml_addrmap_clearinit_custom_major_ratiounsigned charinit_minor_heap_wszoldg__spins__int128 unsignedbacktrace_last_exnnum_poolscaml_custom_elt__atomic_load_ptrcaml_statefinal_infocalc_pool_statscaml_verify_rootcaml_verify_heap_from_stwPhase_mark_final_Boolcaml_enter_global_barriercaml_lockdepthvaluecompact_update_value_athandle_valuecaml_gc_policycharserializeownerswept_largeadoptercaml_ephe_ref_tablecaml_paramssizeclassglobal_largelockcustom_operationscaml_stat_alloc_noexcextra_paramsunswept_large__builtin_memcpycaml_adopt_all_orphan_heapsmemory_order_acq_relmajor_work_done_between_slicesinfix_offsetlarge_allocatePhase_sweep_and_mark_mainextern_state__jmp_buf_tagcaml_remove_heap_statsyoung_startinit_custom_minor_max_bszsamplecompact_update_valuepool_max_wordscaml_plat_unlockglobal_full_poolscompareEV_STW_API_BARRIERmallocsweeping_doneinit_custom_minor_ratiotablescaml_orphan_shared_heapverify_poolreserveEV_MAJOR_FINISH_MARKINGEV_EMPTY_MINORtrace_levelcaml_exception_contextcaml_global_heap_stateunswept_avail_poolsPTHREAD_MUTEX_ERRORCHECK__lockadopt_all_pool_stats_with_lockEV_MINOR_FINALIZEDwsize_sizeclasslarge_max_wordsEV_COMPACT_RELEASEEV_MAJOR_FINISH_CYCLEEV_MINOR_CLEARnext_poolpool_freecaml_atomcompact_pool_statoo_next_id_localminor_heap_wszignoredto_poolHas_status_valEV_STW_LEADERlong unsigned intfinalizeobjsstatuscaml_global_barrierdependent_allocatedstack_lenslice_budgetexn_bucketlongjmp_bufferallocatedaddrmaplarge_allocadopt_pool_stats_with_lockverify_large__mask_was_saveduintptr_t__sizeSCANNING_ONLY_RECENT_FRAMEScaml_mem_mapcaml_gc_logyoung_endcaml_scan_global_rootsEV_EXPLICIT_GC_COMPACTEV_MINOR_FINALIZERS_ADMINexternal_raiseheap_statsEV_INTERRUPT_REMOTEc_stacksigjmp_bufcaml_shared_try_allocEV_MAJOR_SWEEPcds_fileEV_MAJOR_MEMPROF_ROOTSgc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donelarge_wordstrap_barrier_blocksz_classsection_table_sizeGARBAGEEV_EXPLICIT_GC_MAJORextra_heap_resourcesmemory_order_consumecaml_ev_endmemory_order_seq_cststack_handlercaml_ev_begindoublestackcaml_minor_heaps_startinit_max_stack_wszhandlergc_phase_tcaml_plat_pagesizetotal_free_blockscaml_allocation_statusparentcaml_extern_statememory_order_releasepool_live_wordsbacktrace_enabledcountswept_wordsthresholdEV_MINORcaml_finalise_heapwastage_sizeclassunsigned intcaml__roots_blocknext_to_sweepSCANNING_ONLY_YOUNG_VALUESEV_MINOR_FINALIZERS_OLDIFYpthread_mutex_tintptr_tPtr_valgc_regs_bucketsrequested_external_interruptcompare_extpool_acquirepool_initializePhase_sweep_ephecurrent_ramp_up_allocated_words_diffcleanup_on_exitMARKEDoffsetlistcaml_stat_resize__saved_maskmust_sweep_epheEV_EXPLICIT_GC_STAT__jmpbufcaml_mem_unmapexe_namecaml_free_shared_heap__count__jmp_buf__atomic_store_ptrnitemslarge_alloc_sweepallocated_wordsreleasednextproc_self_exeyoung_limitlong doublecaml_redarken_poolPhase_sweep_mainEV_MAJOR_SLICElarge_statsworkentryEV_MAJOR_MARK_ROOTSruntime_events_log_wsizeruntime_warningsadopted_poolunique_idEV_MINOR_MEMPROF_ROOTSevacuated_poolscaml_scan_stackfdataallocated_words_directaction_pendingbacktrace_posPTHREAD_MUTEX_RECURSIVE_NPsizebacktrace_buffermem_statslong long unsigned intcustomtotal_live_blocksmemory_order_relaxed__listwoszcaml_stat_blocklivenew_pfreed_largepoolpool_wordsEV_MAJORpool_releasepool_frag_wordshandle_effectaddrmap_entrymax_domainslive_blockscaml_init_major_heapallocated_words_suspendedEV_COMPACT_FORWARDdeserializeephe_refinside_stw_handlerfixed_lengthEV_MINOR_LOCAL_ROOTS_PROMOTEdomain_statememsetparticipating_countoverheadcaml_failed_assertchar_osplist__int128EV_MINOR_REMEMBERED_SET_PROMOTE__alignverify_pushEV_MAJOR_MARKnum_participatingbacktrace_activeinitcaml_compactions_countpool_sweepstat_major_wordscaml_top_heap_wordsmemprof_young_triggerEV_COMPACTEV_MAJOR_FINISH_SWEEPINGEV_MINOR_REMEMBERED_SETrequested_minor_gcyoung_triggergc_policysection_tableruntime/shared_heap.cPTHREAD_MUTEX_ERRORCHECK_NPtodoPTHREAD_MUTEX_NORMALfinal_funfree_blocksPTHREAD_MUTEX_ADAPTIVE_NP__atomic_load_tmpcurrent_stackatomic_uintnatshort intEV_MAJOR_EPHE_SWEEPrequested_global_major_slicepthread_mutex_lockpool_live_blockssizeclass_wsizeEV_MAJOR_GC_CYCLE_DOMAINSglobal_avail_poolsfull_sweep_workavail_poolscache_bucketcaml_init_shared_heapscanning_action_flagstodopverify_heap__elisionEV_MINOR_MEMPROF_CLEANverify_scanning_flagsextra_params_areatag_tcaml_heap_blocksPTHREAD_MUTEX_DEFAULT__valexn_handlerbsize_32pool_finalisecaml_finalise_freelistlarge_blocks__int64_textra_heap_resources_minorpool_findlast_pool_pmemcpyyoung_ptravail_sweep_workEV_MAJOR_MEMPROF_CLEANasize_tdls_rootmlsize_tstack_infocyclestat_minor_wordslockedcaml_mark_stack_is_emptyEV_COMPACT_EVACUATEEV_DOMAIN_CONDITION_WAITcaml_stat_freeephe_pcompact_update_ephe_listEV_MINOR_LOCAL_ROOTSreservedfreeremaining_live_blocksshort unsigned intmagicexception_ptrbasenewgmajor_refcaml_marking_startedentriescaml_heap_sizeintern_stateEV_MAJOR_GC_PHASE_CHANGEpool_statsHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_addrmap_insert_posevent_tracebsize_64next_objcustom_fixed_lengthcaml_domain_statestack_cacheverify_objecthashcaml_plat_fatal_errorminor_tablescaml_ephe_ref_elt__sigset_tEV_MAJOR_MARK_OPPORTUNISTICcaml_gc_phaserelease_to_global_poolpool_allocateEV_MINOR_LEAVE_BARRIERprevidentifiercaml_compact_heapcursorfull_poolsEV_FINALISE_UPDATE_FIRSTPTHREAD_MUTEX_RECURSIVEcaml_assert_shared_heap_is_emptycompact_update_blocknew_ownerparticipantsmajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA PC A CEHA~A MAC qMA(l|I ACA~CA CAA TDES DD F AGA~EAJ AFA~DAR AFA~EAB AFA~DA0DCI DD A AEA~KBAB0$DCI DD A AEA~KBABdXBCF AA AAAAAABA~AAAAAAAAABA A~BBO BC AF ABACABEA~xAAAABACAAA~LAF ABA~ICADE AFA~DAB ABFA~DAAA~IAA AAHA~MAIAAAA~HAAH$ABBC AAAAAA~qAAAAABAA~0$F AEA~_ FAD |<B D ABDABAB B AA~A CABEAAAAAAAAAAAAAAB A~|D FD AAA B ACACADCA~ABAA A AAAE AABAAAAAAABAAAAABAACFB AADFC A~F0EA~EZADAAA~HC A P A~ MAAB p C AFA~EAC\ AAADAA A`BAAADAAA~CECABALC ADCDGA~~ JAA RJA$DB ACA~ECAH <D ACL FA~GAB ABHAAAAHMAAFB A~FA CnAEtMAAFB A~FPD HCAC ACIH o AA OX pY FG LAAAAAAB \ AA `DC AGA~Y HAA G A A AAA AAABAAGAB 0TC AGA~x FAA  @CCO ABBACCA~TAAAAAAC\P,pC AGA~W EAA $tEA~MGALF ADD FA~aV A LZ JAD HP` 8 D A X F A~  MAFFDA  4H C ACHEA~w LAA JLA,  C AFA~g EAA |60K`Wxp$$|     (x  /F[rH !,3 KZf8PhD < T* 9M^q(P@X$pt-EX jx4 ,Cxshared_heap.cverify_pooladopt_pool_stats_with_lockcompact_update_valueverify_pushcompact_update_ephe_listcompact_update_blockcompact_update_poolspool_releasepool_finalisepool_sweepwastage_sizeclasswsize_sizeclasssizeclass_wsizeatomspool_freelistcaml_failed_assertcaml_accum_heap_statscaml_remove_heap_statscaml_minor_heaps_endcaml_minor_heaps_startcaml_verify_rootcaml_stat_resizecaml_scan_stackpthread_mutex_lockpthread_mutex_unlockcaml_plat_fatal_errorcaml_plat_pagesizecaml_init_shared_heapcaml_stat_alloc_noexccaml_statememsetcaml_orphan_shared_heapcaml_lockdepthcaml_gc_logcaml_adopt_all_orphan_heapscaml_assert_shared_heap_is_emptycaml_free_shared_heapcaml_stat_freecaml_gc_phasecaml_shared_try_allocmalloccaml_mem_mapcaml_paramscaml_sweepcaml_finalise_heapcaml_heap_sizecaml_top_heap_wordscaml_heap_blockscaml_redarken_poolcaml_collect_heap_stats_samplecaml_accum_orphan_heap_statscaml_atomcaml_init_major_heapcaml_verify_begincaml_stat_alloccaml_verify_heap_from_stwcaml_do_rootscaml_scan_global_rootscaml_addrmap_insert_poscaml_addrmap_clearcaml_compact_heapcaml_ev_begincaml_enter_global_barriercaml_mark_stack_is_emptycaml_ev_endcaml_memprof_scan_rootscaml_mem_unmapmemcpycaml_cycle_heap_from_stw_singlecaml_cycle_heapcaml_finalise_freelistcaml_global_heap_statecaml_compactions_count22:0>0202@200@! 2@2@! 22620>0B00D! 20" 2000# 220000! F 2J @ 2 @2200! "2&2.0208! R2V@2200! 2200! |' L' 2200 2 @ 2 @0!  2 @ 2 @! * 2 . @ > 2 B @ \! 2 @ R2 V2 ^0 b0 h! 2 @ 2 @ b2 f2 n0 r0 t! 2 2 0 0 ! 2 2 0 0 ! 2 2 0 0 ! 2 2 0 0 ! 2 2 0 "0 $! 62 :2 B0 F0 H! V2 Z2 b0 f0 h! 2 2 &0 .0 Z 2 ^ @ n 2 r @ ! 2 @2000( 2200! 22&0*04! J2N2V0Z0`! v20z2~000! ! 2200! 220 0 ! >2F02@@ 2200) 2(@(@(* 22628>0B08D! V2HZ0H\+ j2Pn0Pp+ 2022X00X!  b2f2Xn0r0Xt! 20Z 2^ @r202200!  2200! b2f2Xn0r0Xt! 2200! 22p00p! 2200! 2200! $. :/ZB/XH/CL0 220000! 2 0<) N2ZR2V2XZ2H\2Cb2h00H0h2p@p2C" * &22043 ! ! 2200! 2P0P+ 2H0H+ 2"04) N2ZZ2X`2CN2pR@p2C* 2C" 20 @0 <* N2 Z0 \3 2P 0P + 2H 0H + 2! 2 !2H!2h!2!20!>0!F0 !J0H!N0h!! !! !! " ! "j2"n2"v0"z0"|! "2"28"0"08"! #5 # 7 #2#0#2#0$ 2$ @$2$@%V/Z%f/X%l/C% %2%20%00%0%! &2& 0&<: & 2& @&2&@'2'2p'0'0p'! '2'2P'0'0P'! (2(2(0(0(! ("2(*0(L) (^2Z(b2((f@((j2X(l2C(2C(2((@((* (2(0)) )2Z)2X*2C*P *b2*f2*j0*n0*2C** *2C** + 2P+0P++ +"2+&2`+.0+20`+4! +B2+F2P+N0+R0P+T! +b2+f2(+n0+r0(+t! +2C+ +* +/Z+/X+/C+ ,62,:0,B2,F2,N0,R0,T! ,2,2,0,0,! ,! ,2,0,! ,@(,* -4; ->2(-J@(-T2C-b2(-n@(-z2-~2-0-0-! -* -2-2-0-0-! -2-2-0.0.! .2.20.0."00.$! .62.:2.B0.F0.H! .R2(.V@(.b2H.f0H.h+ . /0 /2/@/> 02 2 06 @ 0202002X020000000X000 1( 1V21Z01h3 1~21012010013 2! 2! 2! 2222303 03 ! 3.23223:03>03@! 3N23R23Z03^03`! 3n23r23~0303! 323230303! 3232p3030p3! 323230303! 3232@4040@4! 42424"04&04(! 4:24>24F04J04L! 4~/Z4/X4/C4 4 5> 5`> 52520505005! 6:26J0626072707) 72Z72X72C7" 7* 8"2H8&0H8(+ 862P8:0P8<+ 8R2(8Z0(8I 9*29.29:&29R&09V09b09xI 9K 9L : 2: @:* 2:. @:H! :tM :2:@;2;2;0;0;! ;N ;7 ;7 <2<2 <0<"0 <$! /C> 00>0 >0 >0R >! >! >R ?! ?t. ?2?0@2@@A7 A(S A8Q AB/ZAJ/XALP AT/CAf20Ah/CAn00AK A/CAT A A A A A B B2B0BT Bd/CB| xB xBS BP B2B0CU CS C/CC2 C0 C3 CS D\! D2D2D0D0D! D2D2 @D0D0 @D! D/CD! D! E ! E2 E"0 E$3 E87 E2E@E2E0E2E@F2F0F2F@GV H2H2 XH0H"0 XH$! Hr2Hv2 H~0H0 H! H2H2 H0H0 H! H2H2 H0H0 H! H2H@H2H2 I0I0 I! I2I"2 I20I60 I8! IZ2I^2 If0Ij0 Il! Iz2I~2 I0I0 I! IQ IP IS I/CIQ I2I20I0I00I! J) J&2ZJ*2(J.@(J22XJ42CJ`U Jp2CJ|2CJ2(J@(J* J7 JL J2J20J0K00K! K2K20K"0K&00K(/CK,! K:20KB00KPK Kf2Kj20Kr0Kv00Kx! K2K20K0K00K! K2K20K0K00K! KS K2HK0HK+ K2PK0PK+ L2L2L2L@L"@L&@L*@L.@L2@L^20Ln2 Lz0 L~2L2XL0L00L0XL3 M! M<! M4 M2M2M0M0M! N4 N.2N60ND) NV2ZN^2pNb@pNf2XNh2CN> N2CN2CN* N2 8N0 8N3 N2HO0HO+ O2PO0PO+ &3& 30& 83H&P3`&h3x&3& 3&03&`3&3&3&3 &(38&@3P& X3h&"p3&#@3&.3&4p3&53&53&63&603(&7003@&7H3X&8P`3p&8x3&83&93&=3&L3&LP3&N 3$&%&,&8& <&  o&*/M= KRzYeltxCkmo* 7 DQ^kx2  7!9?EKQW#`eq<z- h; IWe$s 6 kl ^~ T)_70ESaoK}7   %t?7KWcuo{ .m L 67 J& O#/ b;GoSe~]7[)6IlS`wmzE $,N: Q$& 4B P^lznT  YJ$,  % 3 } @ M ` m0 z \     P   % 9   P    1 u     F  A   r / U  | ~   W  D [  & , Q 2 g 8 >J D J Pw V \ b h H n t zF O   ;   >  o   (  C    ! . d Y _ f r 8        } N   a ( 4 A [< u   O x R     <%2 OE Rz< O>#$*0\61<HB HO[gs qj  .^( * (-; S[[@ & b&&4|!. ;H ~Ubo|  tx 4(5K[&]Z&feswe w Wn"./ =Jkx&&([ B   !P.<H sUNbo| "F,hRr `  8 QYhkWU pn4G:&N QY\` e&NJH&N&N  [XT&NP }&O &H&NL,&N6 GKT&N^ os|&O &P&N&N& 8&LP4&  0z$&M I&MDk&L& &M&M&&&Np&L (,2e@M]Y  C&WM~ +/4&Vdhx|!4vp&I&$&L&0&&> D&=[cfjowz~khbXKA," \Z  ie!v,06 ?JNSv^bh&>8u&>&>&>&?&Dd&D+&8&I&D^& @k&|&D&D&E   A)-2]=AO1S-X cNgDlw{{P  $7)~   0  4  0 &@0 4 ? T C F Hv S W ]&@L n y }  0    #    R  P w  |  x  Z   &E!! ! !v!' 8!+ 0!1 !: !E c!I ]!NS!Y !] !b!m !q !v !w! ! !&I!& !&!&I@!& !&!&G" w" ?" ;"$&G". "? U"C S"N&G"l&H"}& "&"&H8"F" i" g"&Hd" " " s"&G## # # &E#* #; #? #H #L #R&H,#g& X#t&#&H#& #&#&H#& #&#&?|#&A$&E,$#& $3&E@$K&It$`& $m&$~&I$& $&$&J$ ?$$ $ $&A$&A$&A% &A%&B%%&B%3&B%R#%V!%[&B<%u5%y-%&B@%&B@%b%`%n%l%&B@%&B@%|%z%&B@&& &&&$&BD&.&BD&C&G&P&T&[&BX&q&B& v&&& ]&&&&Cx& z&"& &/&-&;&9&&C'  'A'M'!E'& v'1t'5r'>&J 'H 'Y']~'f&J 'p '''''&K'&H'&J'&J' '''&J' (!((A( =(%&L(6&P(A&J(V&Jh(o&=(y (h(f(&=(&A0(&A0(r(p(&A@(&B( N))|)&I)2&C)< )M)Q)V&I)k&=|)&h)&=)&=)&A0)&AT)&A*&A*<&B*T&B*l&B*&B*&C*&C*& *&C*&I+&I+&I+0&0+=&+N&J+l&K +&0+&+&K4+&0+&+&KX+&K,&0,&,.&K,C&0,P&,a&K,v&0,&,&K,~,&,w,,,,R----@-*:-.8-7& -AP-MI-QC-Z& -d`-pe-t_-}-{---& (-& d-& d-p---.. ..p.'.+.4& x.>& x.[*._(.m& x.w& x.& x.7.5.C.A.& |.& |.M.K.Z.X/& / & /(d/,b/:& /D& /b& /|n/l/& /& /x/v//////& |/&/&0& 0 &0-&0C& 0M& 0o& 00000& p0&0&0&0)000&1W111%1#!1,@104191L&81r&81|1}1q11111111&L1&L1Q1O2&L2 &L2+&L2@^2D\2Mj2Qh2\&P2f&P2{t2r222& 2& 222& 2& 2& 333!& 3+& 3@3D3M3Q3\3i3m3r& 3&3&3& P3&3&3& 3& 4& 444'4+42& 4C&4P&4i&t4s&t4&t444&4444&44<405w5s555&5=&5c&5m5y5}55 5S5O55r5b5&5&555&5&6&61656>6B6M&6W&6l6p6y6}6& 6& 666& 6& 6& 777& 7& 71757>7B7M07Z7^7c& ,7x&7&7& p7&7&7& 07& 07& 08 -8+89878#& 84&8A&8X8^&08uA8G8A8c8m8]88888&8&88899 &9&9/939<&9Q9U9^9b9m&9w&999%9#9&D99& 9G9-99::: .:"&t:,9:>&:d&:nS:&:&:&0:::Y:O::9::;;;;& L;(;4;8;A& P;K;W;[;d;h;q ;u;~;& ;& ;;S;I;;;;;<<<& <& <6 <: &>&@>(&@>J&@>_>c>l>p>w&h>&>&>&>&>&>&<>&>&??* ?8 ?h ?&?&?&?c?&9??????&9@  @ @(@,@1&9@K&: @U )@f@j@s@w@| )@@@&:P@&:P@&@$@&:P@0@.@<@8@&:A&:AMA"KA0&:A:&:AX&:AmZAqXAzdA~bA&:A&:AnAlA{AyA&:A&:AAA&:B&:B%&:B:B>BGBKBV&:B`&:BuByBBB HBBB SBBB&;@B lBB B#BB lB6C2C &;@C lC'IC+EC4\C8XC= lCG&<\C]&:Cg |Cx |CoCkCC~C&;pC&;pCCC&;pCCCCD DDD&HD&7HfWHjOHs&7H}H{HwH&7HHHHHH&80H&HH&7I&7I II I)&7I3IDIHIQ IU IZ&8DIk&PIv&7I&7II&70II I II J&JJ$ =J( 1J6 tJ: nJI JM JR]Je&JoYJ J J J JYJ!J!J!2J!*J!eJ!]JJ!J!JJ!J!J!J!K& K&0K$&K7&KY&Kj&K}KkKK&60K!K!K"K!KxK""K"K"AK";L "L"L"L""L'&6LB"LF"LO&6LYLj"Ln"Lw"L{"L&6LL&6LL"L"L[L&5LM#M#M (M&5M.M9#*M=#&MCOMI&4pM`Mk#>Mo#<M~#NM#FM&5M#rM#nM#M#M#M#M&50M#M#M&5\N&5 N&5hN4&4NX&4N}&5N&0N&N9N&NN#N#NN#N#N#O#O$O$OO%$<O)$.O9$wO=$sOMO`$Od$Oi&O~O$O$OvO$O$O&XOFO$O$O&OO2O%O%OP %P %P&P(&XP5&PF&|PW&XPd&Pv&P6P&.PP%/P%PP%P%PP&P%PAQ &,Q &$QQ&RQ!&LQ&&.QR&/4Qd&/xQn1Q&pQ&hQ1Q&Q&Q&Q&Q&Q&Q&/Q&/Q&Q&Q&Q&Q&0R&R&R&0,R-&/RG&0`RQFR]'Ra&RfFRx'6R|'RVR(FR(:RkR(xR(rR&1,R&2R&0S(S(S!&0SB&2Sg&2S&1tSS(S(S(S(SS(S(S&1SS(S(T(T(T &3T&T(&T;&1pTP&Tl&1T&0T&3HT&T&T&3hT&T&T&3U&U&U/&3UD&UQ&Ub&3Uw&pU&U&3U&U&U&4U&@U&U&40V&V&V.&4TV?&VL&V`VnVFVLVVFV?W&WW$)W()W-W8)dW<)XWK)WO)WTW_*Wc*WhWs*:Ww*2W*W*wWW*W*WW*W*W+W+W+FW+@WDW+fW+\W+X+XX+X+X"&X7XB,$XF,XKvXV,WXZ,OX`&`XuFX,vX,tX&XX,X,~X-/X-+X&X1X-DX-BX-VX-TX&Y&Y!&Y2&YG&YT&Ye&|Yv&XY&Y<YY-`Y-^Y&Y&Y&Y&Z &Z&pZ,&Z=&ZR&Z_&Zp&Z&Z&Z Z&#@ZZ-|Z-hZZ-Z-Z.>Z.*[[.[.[?[#.['.[5/I[9/A[>[P/h[T/f[c/y[g/s[p&#[z.[/[/[/[/[.[07[0+[0h[0b[0[0~[&#[\[0[0[0[0\\\ 19\1#\&( \"\31\71\@1\D1\I\R2\V1\_2r\c2d\l&( \2\2\3r\3p\&(8\3|\3z\3\3\&)\&)\3\3]&)]&)]/3]33]<3]@3]F&)]_&*]x3]|3]4]4]&*]4]4]4]4]]4]4]5>]5:]]5T^5N^&,^+&*^5^F5r^J5j^S&*^]^n5^r5^{5^5^&*^&*^&+^&-^&*^6+_6!_ 6u_6q__'6_+6_46_86_>&*T_b&+_&+_&. _&_&_&.,_&0`&`&(H`"`36`76`<`E6`I6`R&(H`\`k7`o7`x&(T`2`71`7/`7;`79`&.p`&H`&(T`&(`=`7P`7La&(apa7ua#7qa,7a07a5&+aF&PaQ&(ai&,aa7a7a&-<a&.Pa&a&a&-a&b&b&),b#b47b87bA7bE7bN7bR7bWb`8(bd8bm8bq8bz8b~8b&-b&b&b&%b&%b&0b&c&'c#&pc0&cA&+\cV&Pcc&ct&+|c&(c&c&,\c&c&c&,c&c&d &+<d&`d)&d;dM9dQ9 d[&$dedv&$dd&&0dd9Cd9;d9ld9hdd9d9{d&&Dd&'d&Pe&(e'&e4&eE&,eV&en eeeeweff&f8f[*flfxvffvffvffvf2fggg vg.2g:gH>gmgFgBghvh h$h1ehK~hR&`hihs9hw9h|eh9h9h9h9h&hnh:%h:!h&hh:Jh:Fh:]h:Yi&di&Hi&i5&i?iP:iT:~i]&igix:i|:i:i:i&xi&Pi&i&Li&8i&i1jj# j(&"j?kjI:jM:jR&#jj&#j`j& jkj;j:jj;:j;.j&!j&!k&!k3&"kT&"ki&kv&k&"k&8k&kk&kk;k;k k;k;kl;l;l &|l&< l*<l3&l=]lL<lP<lY<l]<lf<lj<lo]lx<l|<lml<l<l&lxl<l<l<l<lxl=#l=ll=7l=3l&`m=Km=Gm%&m/3m>=`mB=\mK&@mURmf=mj=ms=mw=m|& m&Hm&<m&mm=m=m&mm=m=m>n> n& n&Pn$&n<& DnU&n_nn>Enr>Cnw& n& dn&n +n&nkn>Wn>Mnnn>n>n(o>o >oo >o$>o-&o7oF>oJ>oS>oW>oaoj>on>owo?o?o&oo?%o?#o?0o?.oo?<o?8oo?Po?Lo&p&p4&pP?dpT?`p^&phWpw?wp{?sp&Hpp?p?p?p?p&p&Hp&Dp&pq?q?q &q+&q5qD?qH?qQ&q[(ql@qp?qy@q}@q&q&Pq&q&<q&q&q&q&r r6rB*rZjre&r|kr@?r@7rGr&Tr&,r&r&0r&s ss= sc1s s+sshs s ttt2htPt\vtn& t@dt@\t@t@t@t@tt&Xtt@t@tA0tA&tAXtATuuAsuAgu &hu*&huGAuKAuY&huc&hu&huAuAuAuAu&lu&luAuAuAuAu&u&vAvAv!&v6Av:AvCAvGAvR&Xv\&XvyAv}Av&Xv&Xv&XvBvBv&\v&\vBvBwBw Bw&hw0B(w4B"w9&wN&w[&wl&w}&w&w&@w&w&w&wBHwB>wBxwBrxBx BxBxBx!&x+x7Bx;BxDCxHBxQCxUCxZxd&Txx&8xC5xC3x&8xxxpx?a&s&&H&H&& &P&PZ&Z&4&[&Z&Z&& & & & e& ^Z& & & & & && J& l& Z&&&&H&H&&J&P\&P& &&&H&H&& &P '&P!x&!&"Q& "n& "& "Z&&Z&(Rs(Rs(Z&,& ,& ,& -& -KZ&3&3O&3&p3&3&H4)&4`&5y&5&5&5&5&P5&P6&P6&P7%&7B&H7W&7g&7&P7&P8&8&:,&:<&:d&H:t&H:&:&:&P:&P<1&h&P>)&P>9&P?~&?&?&H?&H?&?&@&P@-&P&&&0&8p (\ 0 `@ "#@H.4p55660`70t78P889 <= L LP N .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rodata.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @O, @PT&Op,O12O ZEZ@@0O^(J@ (xT^( (agPx\@  mFaC={@H *0@@0* 7D@pH0|I0 ( (@P! Zsignals.bd.o/ 0 0 0 644 76264 ` ELF"h@@|!H`H`8!p|N ``|!H`H`8!p|N ``||x!H`9?( ?|~x@ 8!|N |9=B9J}H6} P})Cx} Q@L,H`8!|N ``=")0i|cIN 8c(?M |9=B}69J!|} P})Cx} Q@L,H`8!p|N ```|=")!A(Ii}IIN!A(8!p|N `|!A(H`=")|xIi}IIN!A(=")})j),)AD=BJ,*A 9@I88!|N ```H````|88`A!H`8<=B9 f89J|9```888} !*9) }!*}1*}1*B8jH`8!p|N `||}x|#x!q;;pxH`xxH`x8`xH`=9@{$}I=B9 9J|@*H(```9)|A 9)B@9 9H|@}?Hxx8H`x88`H`8!x|N `||wx!88`?";9!;pxH`?,=@89@9 ~xW78!P!|N A a(;A;`H0;@H``,@A~6;9AxxH`,@|P8} Ȩ|)@ }ɭ@L,@xCxH:}*v, @(,=@|A a(0@HK7~xA a(0@H8!P!|N }=KyA9@LK !|x="),)A(|H8!x|N #9@8!CxN ``|?j!aA(,?A;pH`?8,)A4H`="),)AxH!rax, @=")?;Ii}IIN!A(?,)@D>Ii}IIN!A(H`?_|*H@@`| Kd`8!|N <Ah,)A9@I=")),)Aj?,)A9@IH`8!|N ``,)A9@IK```<K```<K4```<9 x>!8!Aa|N ```!KT``<A9Ap99!;^x!pxH!a, @0a8!|N ```H```< ?< C?a" 5W 5 5" 5% 5 ( ?(+0.82 I@6 NH9 5P= 5XA `C hFpIxLPT[`rtwy { } ^ cW X(0 m8bidX@XHP]X]`hpx w X   5  :  D ?E F (G 8H np S  @       p: ^;9<  =9(> H?P@XA `B ^h y  h  r  |@ jmpAB C  >&+22  b$ j kXl +#W85 5 end5 5 ptr5 5 5(50 57 8 9 : 8< 4< 4end< 4< 4ptr< 4< 4 <(<0 > n? mem@ maxA 8C C endC C ptrC C C(C0 9W C+Z +rC+sC 5 C>*-|=C?K q  L! XL"c=C>!FqK.dbuf/<<"0 he!X9fun val X {{old ! " -./X0fC? . 50 ? ? 5 _3C#,3 ,b 6"C X{{MtX6" X{-g,-7 5# @$#,6@dGt XgXlv='g'qMth-%8 6 M X''6%)d!AAJ A&a !D') ( XCCX X^C-Jq 5$i>A(% X@[j!@-etXo!O!M!P!N!E X&&X) XKXPZ'K'U"(2(G# , ~#XBres,, ~#XCsigXCact X#XkerrD# ,++++),,,), S  S S S S S S )}{ HS} GSTU{+?+,*,), S  dSl*$ * * * *$*$+N+G+++++ -S,S4,c %+$+%,,), dS  S1T0 SAT0 S PS T U   gS1 6S  E X'X2X7act m (X#X**) *n*0o* *  8D ~8e~OUBactq~ G6SKT0U GSKTU0  {S PGG$7stkJ J"#|&Bstk& ` S S`T0 "l(9. &FX3X7i X"H(5.,F X: /X"lCres j " Sp.,6,F8\jj, " SpQ,S,c o "(= *    ! -%, =/,* 9X > pS S T U  ".,S,c F >  X G K+ cS S T U "S "#c pv%*(c! * * * *$*$+9+G!+ ++++ -S%,d!,#{!/#  "!S "9S  "yS T U ` S T U {"MX#y#yP #k#.,pJ,),H,#[,,  EH X#H6 PC#C= 8 $  $S T U  R@%%S$XD $%%#  $S T U $S T U S T U Wq &S)X5 ~5}0 0 Tres 1%& H& S (&*ST +&MS0TU  &uSU  $ &1$# +S2TU0R'O&Ti q&SAT0 ^S #U'0XN+'+ ++++9#'#  rLUD*0 D(h0 %%0 1*)+) * * * *$*$+9+G)+ ++++ -S1#y )/#Q,p$J /,,H,),, 1,S),c   S T UV8*g  V8*  so*2o(X3iq<W= +?X@ @3setB XgXe3iN XG+5O %%O 3jRX_ G+jY%%Yc%%cW2X+3i4 X5 %%5 I+:m4I+:m?EX,:m57rXI,6(t:err4X;,S2 ;,p2G ;(X,2(= + +%%+;tX,2tE + -:+ +++ +*d-* *t*o*) * */S****~$*u+*+ /4+*+.F+ +(&+5+6&+?+@*+L.+Q+]9,` ./,H+j.+k+w  /ST %*ST +S0T0U*h/ * * * *1+G/&+ +&++ + -S#0 v#S 0*0    ! -%, 0,& 9 > "j|1 " S81-,d1yPw~X@%~G2    {S  22S@T 2OST0 SI~ : ; 9 I8  !II41B1B : ; 9 I 8  :!; 9!I!8 H} 41 H} H} : ; 9 I : ; 9 I : ; 9 ( 4: ; 9 I$ > 1RBUX YW  : ; 9 I8 4:!;9 I : ; 9  141I!I/ .?: ; 9 'I<: ;9 I .1@z&I <!.?:!; 9 '<".?:!;9 'I@z#4:!;9 IB$ 1%1RBX YW & 1U'7I(:!;9 IB) U* 1U+4: ; 9 I?<,4:!;9 I-.?: ;9 '<.1RBUX!YW! /104:!; 9 IB11RBUX!Y W 2: ; 9 I34:!; 9 I4 : ; 9 54:!; 9 I6.?: ;9 'I<74: ;9 I8.?:!;9 '@z91RBX!Y W ::!;9 I;.: ; 9 'I !<>! !I: ; 9 =:!;9 I>: ; 9 I ?4G:!; @.?: ; 9!'<A.?: ; 9 'I<B4:!;9 IC4:!;9 IBD E.: ;9 'I F.?:!;9 'I !G H 1I.:!;9!' !J'K !!: ; 9!L :! ; 9 I8M.?: ;!9 '<N1X!Y W O UP.?:!;9 ' !Q1RBX!YW R.?:!; 9!'@zS:!; 9 IBT4:!; 9 IBU.?:!; 9!'@|V.:!; 9! '@zW.?:!; 9 'I !X :!; 9 Y% Z$ > [ \ : ; 9 ] : ; 9 I^'_GI`5Ia  : ; 9 b : ; 9 I 8cI d : ; 9 I 8 e4: ;9 I?<f!Ig.?: ; 9 '<hi.?: ; 9 '<j.?: ;9 '<k : ;9 l1X YW m.: ;9 '@zn1RBX Y W o.?: ;9 'I p : ;9 q.?: ; 9 'I@zr.?: ; 9 '@|s.?: ; 9 ' t1RBUX Y W u 1v1w.1@z '(S..S./q#0'(T..T./q#8(,o,.o/0o).0/00).0/00)+l,.l/0l00l)*2,-1--0//0//2//1++0--1-.2/0 ,,S))Y))Z))l))~1&)* ,- -- // // // 00 )* ,- -- 00 **S,-S--S00S00T**S,-S--S00S00T** ,- -- 00 **2--1--0//0//2//1*+l--l--l//l//l//l** **Y--1//1*+Y++ ++S++ ++0+, 00 +,Y,,S00S/0 00S00 SoSosoSSS""S""S""S1&""0""Y""Y S !S S Y s  zbYYSSSSmm00S 0@Smklklkmkmkmkikmklklkl mk   YYl ooooYYooYYSSSSSSSSYTo TT  $ &1$#U  $ &1$#s  so0YY01nn ZYooYY   Y YYo YYSSYSsSS o o o m m Y m Y m n n 1 $ n 1 $ n 0 0 m m  o    YX   z X       $#@%! X  m Y YTll00Y YZ S s  S!!S!"S!!0!!Y!!Y$$S$%o%%S%%o%%o,xc                    """"""""%&&&(()))))))*,---//////00)*,---00**,---00*+----//////++00++00,,00$ runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/include/usr/lib/gcc/powerpc64-linux-gnu/13/includesignals.cmlvalues.hfail.hdomain.hplatform.htypes.h__sigset_t.hsigset_t.h__sigval_t.hsiginfo_t.hsignal.hsigaction.hstddef.hstack_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdint-intn.hstdint.hconfig.hmisc.hss_flags.hstdatomic.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfinalise.hmajor_gc.hsignals.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hpthread.halloc.hsys.hstdlib.hmemprof.hcallback.herrno.hsigthread.h =//=//i{.  ${{  !J{.. !J{t .7f +$F2f..!-=gi/-!!g<~< ..  !< mX& &!&-/$0$0!$#$t$=#$ $ #$ ##$ "= " /KZ .}    }J!KD D- !D .$.. }!! 1ZX.~frf 2n..M . . / /Q?Ji.?.M !!'g  1 5%v?  / !; !3nXt0,0!""0=//=/.$<=$?!~   1~  -/~  =~!  J  0`~p u !#f.g K !2!=!;!./ %L 1 /  /.2  >~!=T..| ..<.1.\<~p u !#f.g K  *~p u !#f.g K.. /z. K ;! !4J.!!04 XJ  X~XJ K!<~J KJ~J K ".-  }!=T.. }<X}.   <Jsigemptysetc_stack_linkcaml_init_signalssize_tallocated_words_resumedmark_stack__atomic_compare_exchange_ptr__kindcaml_enter_blocking_section_defaultnext_wordmemory_order_acquiredependent_sizebacktrace_slotephe_inforootcaml_record_signal__pthread_list_tcaml_allocmemprofcaml_process_pending_actionssignumcaml_final_do_calls_respthread_mutex_unlock__next__datasigset_tcaml_callback_res__prevcaml_interrupt_all_signal_safecaml_memprof_run_callbacks_rescaml_fatal_errorshared_heapcaml_heap_statesi_codesi_band__pthread_internal_list__ownerrequested_major_slicecaml_ref_tablecaml_release_domain_locksaved_errnocaml__roots_signal_numbersa_restorerepheslice_targetcaml_free_signal_stack_archsigaltstacktmp_signal_handlersis_exceptioncaml_custom_tablecaml_gc_mark_phase_requestedss_spstat_promoted_wordsoldsigactcaml_leave_blocking_sectioncheck_errcaml_check_pending_signalslong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnattodo_head__saved_maskcaml_plat_mutexcaml_intern_statestat_blocks_markedcaml__roots_resdomainpthread_sigmaskPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_scaml__dummy_rootcaml_bad_caml_state__nuserscompare_unorderedsigaddsetcaml_execute_signal_rescaml_minor_tablesntablessigned charfinaltrap_sp_offnsigsaction__pthread_mutex_scaml_enter_blocking_section_hook_boundscaml_signal_stack_0siginfo_tunsigned char__spinssi_statusbacktrace_last_exnexceptioncaml_request_minor_gcsa_maskcaml_custom_elt__atomic_load_ptrcaml_statefinal_inforesultcaml_bt_exit_ocamlsa_handler_Bool_uppercaml_lockdepthtablevaluecaml_gc_policycharcaml_process_pending_actions_res_timercaml_process_pending_actions_exncaml_ephe_ref_tablecaml_process_pending_actions_with_rootnext_bitextra_params__errno_locationmemory_order_acq_relmajor_work_done_between_slicescaml_plat_lock_non_blocking_actualsi_stimesignal_numberextern_state__jmp_buf_tagyoung_startsi_errnocaml_init_signal_stackdom_st_call_addrcaml_enter_blocking_sectioncaml_alloc_smallsweeping_doneupdated_lasttablesreservepthread_mutex_trylock_pkeycaml_leave_blocking_section_hookcaml_exception_contextPTHREAD_MUTEX_ERRORCHECK__lockcaml_raisesi_signocaml_enter_blocking_section_no_pendingsival_ptrcaml_invalid_argumentoo_next_id_localminor_heap_wszcaml_ephe_ref_eltcaml__framesigslong unsigned intcaml_init_signal_handlingdependent_allocatedslice_budgetexn_bucketlongjmp_buffercurrsi_addr_lsb__mask_was_saveduintptr_tyoung__sizeyoung_endcaml_acquire_domain_lock_sigfaultcaml_convert_signal_numberexternal_raisec_stacksigjmp_bufcaml_terminate_signalscaml_set_signal_action__sigaction_handlergc_regs__uint32_tcaml_process_pending_signals_resGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donetrap_barrier_blockcaml_request_major_sliceextra_heap_resourcesmemory_order_consumememory_order_seq_cstdoublefinalisablehandlercaml_process_external_interruptsignocaml_extern_statememory_order_release_addr_bndcaml_leave_blocking_section_defaultdisableswept_wordsthreshold_lowermaskcaml__temp_resultstack_tunsigned intcaml__roots_blockpthread_mutex_tintptr_t_sifieldsgc_regs_bucketscaml_modify__pad0_sigpollrequested_external_interruptcaml_register_generational_global_root__int128 unsigned__atomic_compare_exchange_tmpcurrent_ramp_up_allocated_words_diff_sigchldcaml__dummy_signal_numbercaml_register_global_rootoffset__clock_tfirstblockcaml_get_value_or_raise__jmpbufcaml__roots_root__count__jmp_bufcaml_plat_lock_non_blockingnitemsallocated_wordsnextyoung_limitcaml_rev_convert_signal_numberlong doubleruntime/signals.csi_fdcaml_plat_try_lock__pid_t_killSS_ONSTACKcaml_bt_enter_ocamlcaml__dummy_resunique_idtodo_tailcheck_pending_actionsallocated_words_directaction_pendingbacktrace_poscaml_signal_handlersPTHREAD_MUTEX_RECURSIVE_NPitemsizebacktrace_bufferlong long unsigned intcustommemory_order_relaxed__listupdated_firstsi_sigvalsi_tidcaml_resultallocated_words_suspendedcaml_do_pending_actions_resephe_refinside_stw_handlerhandle_signalcaml_set_action_pendingcaml_process_pending_actions_with_root_ressigactposix_signalssigactioncaml_failed_assertsa_flagschar_oscaml_ephe_infoglobal__int128malloc__aligncaml_sys_rev_convert_signal_numbersi_overrunbacktrace_activestat_major_wordsmemprof_young_triggersival_intrequested_minor_gcyoung_triggergc_policyPTHREAD_MUTEX_ERRORCHECK_NP_syscallcaml_check_gc_interruptPTHREAD_MUTEX_NORMALcaml_plat_unlockss_sizePTHREAD_MUTEX_ADAPTIVE_NPcaml_pending_signals__atomic_load_tmpcaml_alloc_shrcurrent_stackatomic_uintnatshort intcaml_interrupt_selfrequested_global_major_slicesigismembercaml_install_signal_handlercaml_handle_gc_interrupt__elisionextra_params_areatag_t__sighandler_tcaml_sys_convert_signal_number_padPTHREAD_MUTEX_DEFAULT__valcaml_result_get_encoded_exceptionexn_handlersi_addr_sigsys__int64_textra_heap_resources_minor__sigval_tyoung_ptrcaml_local_roots_ptr__uid_tsa_sigactionasize_tdls_rootmlsize_tstack_infostat_minor_wordssigvallockedsi_pidcaml_sys_errorsi_uidsignal_install_mutexfreeshort unsigned intcaml_check_pending_actionsfinal_todosignal_stackbasemajor_refcaml_result_is_exceptionintern_state/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatrunning_finalisation_functionSS_DISABLEcaml_domain_statestack_cacheoldactcaml_plat_fatal_errorminor_tablesss_flags__sigset_tdatacaml_alloc_point_herePTHREAD_MUTEX_RECURSIVEsi_utimelastcaml_result_privatemajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 8CpA~EBA88CpA~EBA0XC ACA~I DAA NDA dJpA~IBALEpA~HBA$EA~[ DAD EpA~`BA,(C ACCA~sGAdXC A EDA~N FAA AACABf AAAAA D AAAAAFAA 0hBF AAA~CCAACC,DC AFA~t EAA ($@D AEA~T DAC ,PB AEA~H CAB MCA,GA~J FAAD B EAA dC ACGA~[ KAA AS D GAHADA~ACP, B ACA~EABWAACFAAA~D AAACAB 8CA~EABWAABBADA~,|B ACA~F EAD CDA \CA~D BAC $lCA~E CAA GDA88LH`dtl |FA~O BAA (G ACA~X DAA ,DA~Q CAD M CAA $DB ADA~BEA80C AJA~ IAB  8/8S0a  x(  .?^H y`dxL 3KWaqhD6 @Oc8yPh Jq|\l8(H @d)XlLp|cjv{D#8ITn  signals.ccaml_enter_blocking_section_defaultcaml_leave_blocking_section_defaulthandle_signalcaml_process_pending_signals_res.part.0posix_signalscaml_signal_handlerscaml_signal_stack_0signal_install_mutexcaml_bt_exit_ocamlcaml_release_domain_lockcaml_bt_enter_ocamlcaml_acquire_domain_lock__errno_locationcaml_interrupt_all_signal_safecaml_check_pending_signalscaml_record_signalcaml_enter_blocking_section_no_pendingcaml_leave_blocking_sectioncaml_bad_caml_statecaml_init_signal_handlingcaml_alloc_shrcaml_register_generational_global_rootcaml_execute_signal_ressigemptysetsigaddsetpthread_sigmaskcaml_callback_ressigismembercaml_process_pending_signals_rescaml_enter_blocking_sectioncaml_handle_gc_interruptcaml_alloc_point_herecaml_failed_assertcaml_raisecaml_gc_mark_phase_requestedcaml_request_major_slicecaml_interrupt_selfcaml_request_minor_gccaml_set_action_pendingcaml_check_pending_actionscaml_do_pending_actions_rescaml_memprof_run_callbacks_rescaml_final_do_calls_rescaml_process_external_interruptcaml_process_pending_actions_with_root_rescaml_process_pending_actions_with_rootcaml_process_pending_actions_rescaml_process_pending_actionscaml_process_pending_actions_exncaml_convert_signal_numbercaml_sys_convert_signal_numbercaml_rev_convert_signal_numbercaml_sys_rev_convert_signal_numbercaml_init_signal_stackmallocsigaltstackfreecaml_free_signal_stackcaml_fatal_errorcaml_init_signalssigactioncaml_terminate_signalscaml_install_signal_handlerpthread_mutex_trylockcaml_lockdepthcaml_modifypthread_mutex_unlockcaml_alloc_smallcaml_alloccaml_register_global_rootcaml_plat_lock_non_blocking_actualcaml_sys_errorcaml_plat_fatal_errorcaml_invalid_argumentcaml_leave_blocking_section_hookcaml_enter_blocking_section_hookcaml_pending_signals   L T  20 226@f2n0 2@( 226@Z%Z^%X`%Cr2v@& ( 22@ 0X) + , - 2@ 2 0P. d- 20- 2@t/ * ^2b@t %Z%X%C 2 2@( >2B@F2J03  2 2 0 04 5 "%Z&%X(%CN 2R @`%Cx8  2 2 0 04  2 2 0  0 4 " 2 & 2 . 0 2 0 44 Z%Z ^%X `%C 8 2 2 0 0 4 8 %Z %X %C 83 & %Z %X %C 2 2 @ ( @%C = > ? R 2 V 2 ^ 0 b 0 d4 2 2 0 0 4 ; %Z %X %C $< 2 2 0 0 4 ; %Z %X%C<< 5  2 2 0 04 ; < L; t< 5 ; < " 2* 0j 2r 0 2 0 2 0J K L @K pK |L   20 00N I 2@P hP  2X 0XN 2@M @%Z %X%C 2 02200S TZTX TC220600D+ dP z20~002@U TCV 2@ R2V2Z0^0dS TZTXTC2200S TZTXTCW 2@8X B2R@TY ^@r 2v 2~ 0 04 TZZ TXTZZ TXTZZ TXTCV $[ 2 26 08\ @5 J 2R 0T\ ^ 2b 0d] &3&@ 30&83H&0P3`&Ph3x&3&3&3&3&3&P3&3 &(38& P@3P& X3h& p3& 3& 3& 3&3&@3&3&3(&P03@&H3X&`3p&x3&3&3&3&36&&&  i&*18? F iMTe q^N  %4:G^Jkx@@  X/ a;mQ^ kt(  , 8+Q^k x 1 Gf  #20K sRYY ` e+z8Eo  r A&f35@MsZg`t+y i   s,2 8> LD9J SRXd;zzt|j? -;IW `es  8J -y]2   )7ES"ao} &= A 7 O !{ - 9 E Q ] i uN  \  >   (  (    Q   ) ; E T a9 n { J     H C y ( 2  ; * 7Y D Q i s : }       Q   Y  )S 64 P j w O  F     4    'O : G. o |4    O  Ss!n>ILW d h b wIt_",: Gna n`&&_&^&&9F &O|\&e]"Wm %  7 H|b E)I_ ^r(^G +b4 ,R`+k& :2,I XRL lh;?)-}=AQUZeiv&&  &0(&bT&"+&/8&BSTWJ`dxi&\z &&&l&&&&&0'/3< @E'N=R5[g_ev&L&l&Fqo&Q &@ &+&D&&&&&& \"'&H9&C&`dm&w& &&&&@&\&3 &@ &Q&,h&ly &  4:R&*${%I)C2&< MdQ`V d&n&{y&& s&&&& 7&pV&c&t &X' &&&&'q2&I 4TXa&$kvz 4&P 4&\ 6- 4;F&h lu&s&&&!&@&@c &P&x1&;&S&W$\&ky& 62& -JH=XRtp&H&HBMOSY&@q& & && &`X&I  X U " .- ? L& ( d& u & & w & -    & @ &  & !%& !/& !J& !d& !yu!}q!!!& ,!& <!& <!!!& P!!& " & ""& ":& "G& l"\ &"i &"z& " &" &""& "& 8""""& 8## ######,& @#E#I#R#V#\& @#l& #zc#####& P#& #& # &$ &$& $  $%&$<R$F&$J$O&L$d$p${m$k$&$&$ &$ &$& $ &$ &$& <% &% &%+%6&%M%W{%[u%`4%o d%~ %%%>%%%%%&%A%%%Q%%%&& &&+&&N&X&v&l& {&&&1&&&&&&`&&'\' &'#{'-3'1-':&p'U&p'o&p'L'J'_']'&'&'i'g'&0'&''&(( &(!K(-&d(B(Lu(Pq(U(_(c(m&(w((&(&(&(&()) ))&,)0&):)N&)X&)u)y)&)))))&)&4))))&)&*&* &* &*1 k*6&@*M&T*Z&\*hz*m&*&*&*** * 4* * ++++)+A-+RU+^ +l+x++++^+x+,x,:,7,G-,T4,d-,q1,,,,,C,-,&0,&0- &0-!`&-/ -3 -?&P-Z !-^ -l&\-v!- >- <-!-&-&- O- I- q- e- - -&P.a. . . v./`&.= .A .Kk.T .X .a.j G.n E.w. Z. V. . {.&.&.&. . . . .&|/&/5&/X&P/&P////`&/ / /&x/& 0& 0* 0. 070I 0M 0_ @0c <0q& 00{& 00 S0 Q0"0 a0 _0& 0&0&0&1 &1$ v1( p12&1M 1Q 1Z&1o 1s 1~&1 1 1&1&1 1 1&1&2 &02&H23&x2P&i&y&&&&&&&&&& & & & &D&0x& &`&`&& &|`&`&S`&`&`& a`& q`& `&&&& 9& <@\0P ,\P(T P   0  @<PPdx 4.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rodata.rela.data.rel.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @x@@x&,@61@;2O`J@ňThxa\@Š0 v2eq@Uh OUW @8b0@0c'ge(@8H0z0v h@  #!hskiplist.bd.o/ 0 0 0 644 19432 ` ELFEh@@|88|x!H`9 8!?|N `,AD}y$H ``I|* @A8iA0}#@*,)@((9@8`N ```8iN ```,AD}y$H ``I|$P@A8iA0}#@*,)@((9@8`xcN ``)8`xc%N #, Ah})8y($H`I|* @A8i}'Kx}#@*,)@((9@,'A '8`xc%'&N 8`xcN ``a|+x|{x!|#x|jx/At|8p9)|#xy)$!d|J``} "|B}*@*,)@$H,``9I|B}*@*,)A|'@A|$@@*,)AI|*A|< = =@a) ;<})A@9)bUU(|P&@``U):xU*;| 8A,;;{$A|(@x8|Ah9%|| yJ$}R8p|P}Q*TA@, @xb}I8})|y($yJ$|B|R9'|A*|Q*BؓxH`,#AP,A\9>8hy) 9q&8@ly)B})9'889)eiB@ 8!08`a|c|N |' x,&q e@K}*9)| yJ$}R}Q*@K8!08`|caN AH8`H`,#A@K<|N runtime/skiplist.clevel < NUM_LEVELScaml_skiplist_insert: out of memory=int*g |Z=mO1!N: 0 !0 "D??=D'u"key ( )  *u?#=& $S%eD&'(ask,`e?.?)(i D ST0 Dtsk,key8t~ef??i DLfi D=? wD(5skw,keyx"*x/zt~e{f{?|D|Li DgiDi D+L ]f S T U4SSH S  `Dsk`0k`<Tkeya(Ua7Vecfc?c ? if D TDskT*keyT6TTEUpV ,V -B skB3keyB? eD fD?. iG D:LLsk:+ i< D ST0U/( Ds r* 0+D1t2T3 4:!; 9 IB$ > I~:!; 9 IB41B: ; 9 I !II :! ; 9 I8 H} .?:!; 9!'I@z U 4:!; 9 II4:!; 9 I U4:!; 9 IB :!; 9 I1B&I :! ; 9!!I/!.?:!; 9!'@zH}H}:!; 9 I 1U:!; 9 I% U$ >   !: ;9 I" : ; 9 I8 #!I$.?: ; 9 '<%.?: ;9 '<&.?: ;9 '<'(.?: ; 9 'I<) *: ; 9 IB+1RB UX Y W ,1RB UX Y W -.?: ; 9 'I . /.: ; 9 'I 04: ; 9 I1.1@z213.?<n: ;  $S$nSo#S$loo(00S08Z8oSSoSoTTTTT$S$LZXhZxZSooDYDSSSYy s (zY0DY<S :7/-7=. ! !.k  < @  2 z   ! $+<  ! zJ  t l  < @  2 z   ! $+< % oJ   !" !O  < Q >   ! $+D13 "  $ ,  $zzz"  J. "I  .! .=    ! .?$z .". .! . ! $!*(!). $ $.<9   3 7 /( --  !/ # 2.!#! <.2#</2!J2-!2#2# "> " ! ! t/.     !$ !$ A ! 8!  !$  w2# !  2#"x. ! l  .  %> " ! ! t. # .   C  <.. "I  .! . =   ! /?$z 6". h..K$$ ="<0  >""!@ !.q.".  .*s  .>".. tg6 Y  !A,6. 7.t ! !. long long int__int128 unsignedchar_ossize_tnextuintptr_tcaml_stat_freeshort unsigned intupdatedatalong long unsigned intruntime/skiplist.cunsigned char__builtin_memsetlong unsigned intuintnatcaml_skiplist_find_ptr__int128random_seed/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_skiplist_initmemsetdouble__uint32_tcaml_fatal_errorunsigned intskipcellnew_levelcharskiplistcaml_skiplist_removeasize_tlastcaml_stat_alloc_noexcGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml_stat_blocklevelshort intrandom_levelcaml_skiplist_insertcaml_skiplist_find_belowlong intcaml_failed_assertlong doubleforwardsigned charuint32_t_Boolcaml_skiplist_emptycaml_skiplist_findGCC: (Debian 13.2.0-18) 13.2.0zRxA $LD ACA~DDA@tThT|(BDh ABAHA~S AAFAA QABEAA~DBh ADA~qDAAGCAA~HAA AAA~$C ACA~XEA    L+2tI0\Hu`(xskiplist.crandom_seedcaml_skiplist_initmemsetcaml_skiplist_find_ptrcaml_skiplist_findcaml_skiplist_find_belowcaml_skiplist_insertcaml_stat_alloc_noexccaml_failed_assertcaml_fatal_errorcaml_skiplist_removecaml_stat_freecaml_skiplist_empty 200  2200 2000   H x &3&P 30&83H&PP3`&h3x&3&3   & -2(@NU\cMjqx}k4l dw $E]gi&>v& !  & 7 7; 1@/J RN PS&Pa&Xz a~ _&&  o  `    H @&6 y: k@&] a g&&   % g h \`     !  &&C 0G .M q^ Gb =h y ~} v& O O    &&&&&&+&06?&P_ c g 0 * O I r n ?  1&  g3 7 @&I /U Y b f k /t x  < 6 / Y UJ& u o  # ' ,&$Mgx&P          ]&8&,S&Hb&X&& &I&\z& &&&&i&&&<&1&H&&&&&P1&PP&ls&P&T&&(&&(&&=&Z&v&&&P&P&h&T& & &P0&@&PP&r&&&&&DPXlP .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @+&,61@-xP;2TOJ@.8[n$i@? 0~@B0 @B@C0#D0& &@@C(( *D/57 0 0 0 644 32408 ` ELFwX@@|9 9@ |#x<||x8!a;t;p!pAtxxH`<xxx8H`!t, MAx, kA@, GA!p8!=|N ```!p8!y)Ud=|N `!p8!y)=|N `!p8!y)d=|N ``|y!qA|?U*>, A9);U*>( JAd=BJy)}*J})R})N DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDt`L8DDDDDD$DDD```, ,;A?, @?U*>, @t|="),)A()At8!N 8pxH=")ApIK<x8HK<x8HKt<x8HK`<x8HKL<x8HK8<x8HK$<x8HK<x8HK<x8HK<x8HK<x8HK<xHK<x8HK8pxHAp=1*})Q|(Kl<x8HKX|D ?  mem@  maxA  8 C C endC C ptrC C  C( C0]9 :!!   " %V& ( * (+ 0, 8- @/ H0 P1 X2 `3 h4 p6 x7 ʀ8 ʈ9 ʐ: ʘQ=(  ? E- / .!  p  p )  < VmN0-*  X1 -!  V2 >F! > p V3 p _ V V4 s V4 ' U '   *VS&T  ( SF T b b4 " l x S  }SpU1 b, " l x S  }SpU1& g53#4@  S        S1        _S $ 6/V7f8p,9p ' S T  'S T   _S @(:opt ;<= # >? S  s( S  S ?(%_.opt_0 &vala `@w .Aw 3ST`3ST #03ST #P3.ST #(3UST #H3|ST #h3ST #`3ST #p3ST #83ST #3AST #3hST #x3S3ST #@3ST`3ST #X _S T  _S 9%PXoptP& varP4R ET&valS[P >ST UV >ST UV$0&3 ''@.@Bm'o .o I~ : ; 9 I8  :! ; 9!I!8  :! ; 9!I!8H} !IH}$ >  : ; 9 I I <  : ; 9! :! ; 9 I8 .?: ; 9 '<( H}4: ; 9 I&I4: ; 9 I?<4:!; 9 I.?: ; 9 'I<.?:!; 9 '@z:!; 9 I41B:!;9 I1RB X!Y W :!; 9 IBGI4:!;9 I?<I !I/ !.?:!;9!'<"1B#41$.:!; 9! ' !%.:!; 9! '@z&4:!; 9 I' (% )$ > * +> I: ; 9 ,  : ; 9 - : ; 9 I 8.: ; 9 I /4G: ; 9 0.?: ;9 'I<1.?: ; 9 '<2.?: ; 9 '<3.?: ;9 n'I<4.?: ;9 '<5 16: ; 9 I74: ; 9 I8.?: ; 9 'I@z9: ; 9 IB:4: ; 9 IB;1RB UX Y W < U= 1U>41 ?H}@ A4: ; 9 IBB.: ; 9 'I  S SYY S o S o S S S S S SSo o`ZSSSlSlSlSlS$T$mTmTmTmT, <          x runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includestartup_aux.cdomain.hstddef.htypes.hstdint-intn.hstdint.hconfig.hmisc.hstdatomic.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hgc_ctrl.hstartup_aux.hcallback.hsignals.hdynlink.hgc_stats.hshared_heap.hosdeps.hstdio.h > /##1- !Kux% %. o%$, %. T$$5 %. U#$< %. ""=  =   X   f<  <!. .12. k =J6J>J7J<JDJBJ=JCJ6J:J<J 9J6J w =#! #.!. /x BJ qJ t $ &$z.",$$"!!"!!  !! " "!#'w !(x !#1$0.A.=  ! #K  $<* =;J.f!-!/&J/] "/!# 1!J9 0n. t!<>.3/! iJ l Y !<. kK !<. f/K4/00.03=/pJ=0/00./Xe.1J"//N//atomic_uintnatexn_handlercaml_finalise_freelistmemory_order_releaseruntime_warningscaml_domain_aloneatomic_boolsize_tc_stack_linkdependent_sizerequested_global_major_sliceyoung_limitcaml_runtime_warningsgc_policymlsize_tswept_wordsbacktrace_postrace_levellong long unsigned intstack_cacheunique_idmemprofdatacaml_executable_ocamlrunparam__int64_tlimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnextlong long intsigned charcaml_init_section_tablemark_stackcaml_free_gc_statsrequested_major_sliceint64_t__atomic_store_tmplong intcaml_runtime_randomizedmajor_work_done_between_slicesallocated_words_direct__isoc99_sscanfunsigned intcaml_minor_tablesextra_heap_resources_minordoubleis_exceptionsscanfcurrent_stackextra_paramsbacktrace_slotslice_targetpoolingcaml_domain_terminatecaml_heap_stateoo_next_id_localbacktrace_last_exncaml_verb_gctablesintern_statecaml_bad_caml_statecaml_shutdownrequested_minor_gcallocated_wordsmemory_order_seq_cstsection_table_sizevalueproc_self_exemajor_refinside_stw_handlerlocal_rootsblockcaml_fatal_errorcaml_free_localecaml_gc_message__int128backtrace_activeGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intslice_budgetcaml_ephe_infonameinit_startup_paramscaml_stateminor_heap_wszintnatinit_minor_heap_wszdependent_allocatedshort unsigned intstat_major_wordsinit_custom_major_ratioallocated_words_resumeduintnatmemprof_young_triggersweeping_donecaml_custom_eltcaml_search_exe_in_path__atomic_load_ptrintptr_tmajor_slice_epochc_stackmemory_order_relaxedyoung_ptrmarking_donecaml_terminate_signalscaml_gc_logbasetrap_sp_offyoung_startasize_tstack_infocustomcaml_stat_destroy_poolextern_statememory_order_acquiretrap_barrier_offdls_root/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beshutdown_happenedcaml_ephe_ref_tablecaml_startup_auxephe_infocaml_free_domainsfinal_infouintptr_texternal_raisecaml_paramsextra_params_areagc_regsscanmultexe_namememory_order_acq_rel__int128 unsignedruntime/startup_aux.clockedthreshold_Boolmemprof_domain_sunsigned charmemory_order_consumeparse_ocamlrunparamshort intgc_regs_bucketscaml_ephe_ref_elt__atomic_store_ptrcaml_stat_create_poolbacktrace_enabledverify_heapstat_minor_wordscaml_custom_tableinit_custom_minor_ratioinit_percent_freeinit_custom_minor_max_bszcompare_unorderedntablescaml_callback_rescaml_init_exe_namecall_registered_valuestat_forced_major_collectionslong doublecaml_intern_statecharmultcaml_final_infoinit_max_stack_wszruntime_events_log_wsizeparamsstat_blocks_markedsection_tablecaml_resultmax_domainscaml_domain_statecaml_parse_ocamlrunparamtrap_barrier_blockoffset__atomic_load_tmpallocated_words_suspendedcds_filecaml_named_valueyoung_triggernitemscaml_gc_policyephe_refreserveevent_traceyoung_endparser_tracerequested_external_interruptchar_osminor_tablescaml_stop_all_domainscleanup_on_exitshared_heapsizestartup_countcaml_free_shared_libsbacktrace_buffercaml_result_privatecaml_num_domains_runningaction_pendingcaml_secure_getenvstat_promoted_wordscaml__roots_blockcaml_extern_statecaml_ref_tableepheGCC: (Debian 13.2.0-18) 13.2.0zRxA TXG AFA~X GAD B HAB B HAB BHAHpABB AAA~jAGAAA~YAA ADA~B A ACA~@UpA~m BAD GA~W DAB @AP C A ACA~r BAD TAA AAA~B A ACA~D X X*  8H`m0@H-F`ITew)@Tx g  startup_aux.cscanmultshutdown_happenedstartup_count__isoc99_sscanfcaml_runtime_randomizedcaml_verb_gccaml_runtime_warningscaml_fatal_errorcaml_executable_ocamlrunparamcaml_parse_ocamlrunparamcaml_secure_getenvcaml_search_exe_in_pathcaml_startup_auxcaml_gc_messagecaml_stat_create_poolcaml_num_domains_runningcaml_shutdowncaml_named_valuecaml_callback_rescaml_gc_logcaml_stop_all_domainscaml_free_gc_statscaml_free_localecaml_free_shared_libscaml_free_domainscaml_terminate_signalscaml_domain_terminatecaml_finalise_freelistcaml_stat_destroy_poolcaml_bad_caml_statecaml_init_exe_namecaml_init_section_tablecaml_params"2*0L V2f0h 2@"2&@L R2V@f20n00p z2P0P 2(0( 2H0H 2h0h 2`0` 2p0p 2808 20 2"0$ .2x60x8 B2F@L V2@^0@` p z2~@2X0X 2H0H 20 2@2h@h2X2H&@X*2`.2P6@HF@`J2pN@PZ2^@pb2f0j@n28r@8x 2 @ 20@022@@ 20 20   2 @ 62:0R2Z0`! j28r08t! ~200" 20 %Z%X%C20"2*0F2J0P& l' v2z0|& ' 2(@(20( ) * + , - . 204/ <0 D* L+ T, \- l1 2 2p0p 2@2@2@2@&3&` 30&83H&0P3`&h3x&3&3&&&& &(#&& &*/v=<D PW^el xiP i5/  S2"j0:F \ht' #T     (3(> &IfT _ju> dT$ }% 0q<HT` l x H4y6Nq F" . :F KR ^Ajvh 89>(}7 (  ,9 F Sf[p a  uy   F  .GsT Ta t 6 $ Ks T L`E Qjs T  YH)w + ~8 ER _ l y    qG 8   H K - 9& K5& T Y `& i u& ~    /   g w   K  "    [ ( ? G `f t\   &    " & ) w  & 1&@ :&@ U Y b! f k&X & &t &t &t + ) > < & & & & (& C& ]J aF h& }& & & & & & & &< &D &L &T &\ &d -&t :& G& X&p c 5 mj  &0 C e Y &h & &| &8&&"&- 3&UYb&k w 0&&&&&&&&&) .&`OSf&P{ H=&P&t&&&&#&/&J&V&q&}&&&&&&& &&(5&B&<]&i&P&d&&t&&&&H&$&4n9&Z^mYqGv &T&&p&o ~  H='X5tA R&2&&&t`0H\.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @B& @, @12 @E `@@RPO 0J@ShY 8T@S q @Ol@T!0 }#@u@0%F0@up0%v@%|@u0,2 )09[ 9|h@u: ?v`str.bd.o/ 0 0 0 644 49776 ` ELFp@@|~x!{{$;}?|}#HP), @8!|cPN `|<p8!||iPxc8cN ||~x!H`|xxH8!x|ct|xcтN `|= a)|cty)e)a)|#H@!AH`8!p|N @AXxxH`,AX8`@ALA8`8!|} N `|exK``8`N 8`K`|# A}&||}x|#x!qH|~xxHx~>@AXxxH`,AX8`@ALA8`8!|} N `|exK``8`N 8`K`|!H,#@8!p8`|N `8!p8`|N |!H,#@8!p8`|N `8!p8`|N |!H,#@8!p8`|N `8!p8`|N |!H,#@8!p8`|N `8!p8`|N |!H,#A8!p8`|N `8!p8`|N |!H,#A8!p8`|N `8!p8`|N |!H,#A8!p8`|N `8!p8`|N |!H,#A8!p8`|N `8!p8`|N ||t|t||f*|t!H`8!p8`|N ``||t|t||f*|t!H`8!p8`|N ``||t|t|i||t!H`8!p8`|N ``||t|t|i||t!H`8!p8`|N ``||~x!;H;pHPX|exx`x8h!pAxH`,A(|x@txH`||xxH`8xx||~xH`xH`8!x|N ``xH`8!|~xx|N H```N N runtime/str.cByte (s, temp - Byte (s, temp)) == 0String.createBytes.create#*:  +int[ $T    )H, -:,T(-T4  | W Z: l m.& C/0gw  X21 NT$;<&>&    : 2 S O 15O%f&~ Ha.O=H./>.@ H>>. 6 5%l 0 3dO&.2O4 eOOOHobv+bv+(52O6' 7buf~nHres 8D' NSfS;ST $ &UV S;STUVT 59T ::Is'0len>I{s{&{/len{={Hus1u'u1s2u=uGnv'ns1n&n0s2n<nFno'i=s1i.s2i8dcs1d/s2d9_s1_-s2_7Zs1Z.s2Z8Ts1T+s2T5Os1O,s2O6I!s1I*s2I4DGs1D+s2D5?7s1?)s2?3(7A QF\fpSS ST/~s1/*s2/4) );res2H*s1**s2*4%s1%+s2%5  /s1 's2 1 /SSTT qs1(s22sz1 sz2p1 p2<e )v=(e v  str'2?b1`b2`b3`b4`b5!`b6%`b7)`b8-`val idx  S   str'2?b1`b2`b3`b4`val idx  S   _ str'2?b1`b2`val idx  QS   str'2 SSTT  str(3res b1`b2`b3`b4`b5!`b6%`b7)`b8-`idx S   W str'2 WSSTT ? str(3res b1`b2`b3`b4`idx $S   t str'2."9DNXS qdstrq(q3ress b1t`b2t`idxu  kp2 strk&k1k>2mWL@b"S _nstr_%_0_=idxa  Zd strZ%Z0\6*A S SMstrS&S1idxU  H` lenH(!JSS1&  S  >`G len>)!@+SS1&  S  5H\ s5-S S 0 s0+2"e+Sv 2S T U,(s(,#*  e s.!!"e"6v 2S T U#>+val8?# # &~O"e+ v 2S T U,d*6AS 2p,@LWbS t".9DNXS 0  /SSTT7FQ\fpSS ST!P0; 7SSTTPX 7SSTTP 7SSTT=PLW 7SSTTH S V1&U"T T1&S"UW1&IHXbnz aS T1&S"TV1&UU1&@oA~SI~1B4:!; 9 IB:!;9 I41BIH}: ; 9 I H} $ >  .?:!; 9 'I@z :!; 9 IB H}:!; 9 IB.1@z.?:!;9!'I !.?: ; 9 'I<.?:!;9!'I:!;9 I !I( 4:!;9 IB:!;9 IB4:!; 9 I U: ; 9 I.?:!;9 'I@z 1U1RB UX!Y W! .?:!; 9!'I !:!; 9 I H}!4:!; 9! IB"1RB UX!Y W! #4: ; 9 I$&I%.?:!; 9!'<&.?: ;9 'I<'4:!;9 IB(1RB UX!YW )4:!;!9 I*% +$ > , - I.GI/&0> I: ; 9 1: ;9 I2.?: ; 9 '<3.?: ; 9 '<4.?: ;9 '<5: ;9 IB674: ;9 I8 9I:!I/ ;4: ;9 I<1RB X YW = 1>.: ; 9 'I ? @.1@zA1F S U n !S!!n!!S!!n m!!m!!q8!!m S !o!!S!!o!!S S !n!!S!!S S !lSmSmSSmToToToTooToSmmSSmSnUnnSSSSSTTSYSSSsxSTTZZx:%XXYSyySsSTT yST"# yT"S# yST"#TT#SsxZTtxXSnSTTUmUy8%y0&y(&y &yH&y@&y8&YzYt1&oT1&oSnSTTUmUyH& x $ &H&y@& x $ &@&y8& x $ &8&XY x $ &t1&oT1&oSmSTTUnU9&U9&1&U1&1&nU1&t1&oT1&oSSTT S nS T T Rz0$z($!z $!zH$!z@$!z8$!z8$!z! Mz0$z($!z $!zH$!z@$!z8$!z8$!{! Ht0$z($!z $!zH$!z@$!z8$!z8$!{! @t0$z($!z $!zH$!z@$!z8$!y!{! ;t0$z($!z $!zH$!z@$!s8$!y!{! Ct0$z($!z $!zH$!z@$!s8$!z8$!{! Zt0$"#($!"# $!"#H$!"#@$!s8$!"8$!{!Nt0$"#($!"# $!"#H$!s8$!"8$!z!{!Xt0$"#($!"# $!"#H$!"#8$!"8$!z!{! z " z "# z "# z "# z "# z "# z "# z "# t1& oT1&o S S T T S n S T T &yH$y@$!y8$!y! !sH$y@$!y8$!y! sH$z@$!y8$!y! &sH$z@$!"#8$!"#! ."H$z@$!"#8$!"#! 8"H$"#@$!"#8$!"#! y " y "# y "# y "# t1& o T1& o S n S T T T T T S n S z8$z!  z z t1& T1& T1& S m S T T U n U U n U T T T S m S t1& T1& T1&SnSTTTTTSnSt1&T1&T1&SSSS1&SS1&SSSS1&SS1&SnSSSSnSSSnSooSsxo(S(DnDLSLnS HoLo S sxoSSSnSooSsxoSnSTTt1&oT1&oSmSTTUnUt1&oT1&o S n S T T z8$z!  z z t1& o T1& oSSTTSmSmSSmToToToSnUnnSSSSSTTSSTTSSTTSSTTSSTTUUVVWWSSTTUUVV,                        M runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includestr.cmlvalues.hstddef.htypes.hstdarg.hstdio.hstdint-intn.hstdint-uintn.hstdint.hconfig.hmisc.hmemory.halloc.hstring.hfail.hstdatomic.h +< ~   ~  !. =< .f//- .N+ ~ . ~  !<=  ! J,<J /=   ! ![v+ ~ . ~  !<= z &Xy.<J /< z   & z &[ g.# /J"-!H0# /G m"-!H0# /G n>0. / !. !2:7 ). / z &. z &2y< >>< /",!. 2+ Xv<  v<< / u.! . 2t<X@2.  /x ! %%  $!6w. t<   t..  / s !  v  v. $&6r.@2.  /! '  "     "   $=< 6u.  @@2.  /!  v # !!  "!  !-  !/!"/"# '=< 6k.X  @@@<  /z  w 'x '. 6t.X@@<  /  %o."v!! x v . 6n.@@<  /"   e.!!! q#! n n n n n . 6b.$X!!+    !+  !/- - . .=;-- --!=;-- ,$H.=--; -  X  @ =! /  !  ! <.// !!y  J  zJ 9 nn/  u !  ! <.// !!y  J. uJ 9 v    \ => />!>W!h  =? /?!?W!h  => />!>W!h  =? /?!?W!h  !'  .//  !&  -// x%s  <s. s  </ 0 .   >  *3  7$/<&J. JJ 6< J.6 . E<.>XLcaml_string_get32memory_order_releasecaml_raise_out_of_memorycaml_bytes_greaterequalcaml_copy_int32size_tuintptr_tofs1caml_create_bytesva_listinitheader_tlong long unsigned intcaml_failed_assertcaml_string_greaterequal__int64_tnewvalcaml_bytes_get64caml_bytes_equallong long intsigned charcaml_bytes_greaterthancaml_fill_bytestemplong intcaml_ml_string_length__builtin_va_listdoubleofs2atomic_uintnatcaml_alloc_sprintfcaml_bytes_set32caml_string_notequalcaml_fill_stringmemory_order_seq_cstvaluechar_osunsigned int__int128GNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intmlsize_tcaml_string_comparevsnprintfintnatcaml_bytes_lessequalsaved_formatsizeshort unsigned intuintnatcaml_array_bound_errorcaml_string_get64caml_string_equal__atomic_load_ptrintptr_tcaml_stat_freememory_order_relaxedcaml_stat_strdupcaml_bytes_get16caml_string_of_bytesstrlencaml_alloc_initialized_stringcaml_ml_bytes_lengthcaml_bytes_setcaml_bytes_set16memory_order_acquire__gnuc_va_list/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beuint64_tcaml_bytes_lessthan__uint64_tcaml_stat_stringmemory_order_acq_relcaml_invalid_argumentcaml_create_string__int128 unsigned_Boolint32_tunsigned charcaml_blit_stringcaml_string_greaterthanshort intcaml_string_is_c_safecaml_bytes_notequalcaml_bytes_compareformatcaml_string_setcaml_bytes_get32memory_order_consumecaml_stat_blockcaml_string_get16long doublechar__atomic_load_tmpcaml_alloc_stringcaml_bytes_get__int32_tcaml_string_lengthmemcmpoffsetruntime/str.ccaml_bytes_set64caml_string_lessequalHd_valmemsetcaml_string_getmemmovelen1len2caml_blit_bytesindexcaml_copy_int64int64_targscaml_bytes_of_stringcaml_string_lessthanGCC: (Debian 13.2.0-18) 13.2.0zRxA 0BBK CB A AFA~EBAB0LBK DC A AAGA~EAAAD0BK DC A AAGA~EAAAD(\C ACA~FFAA`JpA~D BAA `JpA~D BAA ( dC ACA~F GAA (LdC ACA~F GAA ,xpC ADA~H GAA ,pC ADA~H GAA (tC ACA~G GACA (tC ACA~G GACA (0C ACA~U DAA \(pC ACA~` DAA ,C ADA~K HAA ,C ADA~J NAA ,C ADA~J UAA @Th0CpA~BCA0CpA~BCALF ABDFA~S FAAFB DAFBA~FLF ABDFA~S FAAFB DAFBA~F$HPCpA~D CAB ACA$pPCpA~D CAB ACA$PCpA~D CAB ACA$PCpA~D CAB ACA$PCpA~D CAB ACA$PCpA~D CAB ACA$8PCpA~D CAB ACA$`PCpA~D CAB ACAHHpA~CCAHHpA~CCAHHpA~CCAHHpA~CCA<(E ACA~f GAC D HAA H\   -C0XH\nu``x`ddppt)t: L\8mPh0 0(3:@MXPbpPvPPPPPPH0H*HH:A`HRx(eostr.ccaml_string_lengthcaml_failed_assertcaml_ml_string_lengthcaml_ml_bytes_lengthcaml_string_is_c_safestrlencaml_create_stringcaml_alloc_stringcaml_invalid_argumentcaml_create_bytescaml_string_getcaml_array_bound_errorcaml_bytes_getcaml_bytes_setcaml_string_setcaml_string_get16caml_bytes_get16caml_string_get32caml_copy_int32caml_bytes_get32caml_string_get64caml_copy_int64caml_bytes_get64caml_bytes_set16caml_bytes_set32caml_bytes_set64caml_string_equalcaml_bytes_equalcaml_string_notequalcaml_bytes_notequalcaml_string_comparememcmpcaml_bytes_comparecaml_string_lessthancaml_bytes_lessthancaml_string_lessequalcaml_bytes_lessequalcaml_string_greaterthancaml_bytes_greaterthancaml_string_greaterequalcaml_bytes_greaterequalcaml_blit_bytesmemmovecaml_blit_stringcaml_fill_bytesmemsetcaml_fill_stringcaml_alloc_sprintfvsnprintfcaml_stat_strdupcaml_stat_freecaml_alloc_initialized_stringcaml_raise_out_of_memorycaml_string_of_bytescaml_bytes_of_stringV2Z2b0f0l 2200 2200  (  2808  2H 0H  @ p   ( \    @    @" ` !  % < P$    `   * * <*   / ` l / . \. . . L. . . <. : : @= = @ 4A D `@ lB C D &3& 30&P83H&P3`&`h3x&3& 3&3&3&p3&3&`3 &(38&@3P&X3h&Pp3&`3&3&3& 03& 3& 3& 03(& `03@& 0H3X& `3p& Px3& 3& 3& @3& 3& 3&03& 30&83H& P3`&ph3x&3&3&3 1  l&* / h= D "W ;c Rj q *x } s  b  ]    / J )   o ' 5: S Y _ He k q z D        ( 2      6 '< b     X = R   3 U 6p  &     1 Z R  y  &0# . 2 7&<O&Lg&h&t&&& % = J Mc {  ` y   y  @> d 6 q   " KH S& 0t x  1 %& 0  i _          & d& p& 8 ] g     &    ,  ( & 0 f ;& 0 \ L ` > o  s        #  & < & <   & <       #  .& L 7  C  G  P  Y  ]  f  j  r  |&           ) ' 8 6 G  E  V ! T / d 3 b A r E p S  W ~ f  j  y  }  & & $  &         "    C ! ? / d 3 ` A  E  T  X  g  k  p& &h 7 &`         , ( H  D  f " ` 1  5  :& R& `  j&P      &T T &      & '  +  9  =  K  8O  4]  Ra  No  ls  h                &&$&D &  #  ( 2  6  ;&X b&  0  *   M  I  k  _                     &%&H2&h@ J&`k  o  t ~  6  2&p   N  H  p  j                 && / e o&p           % &  D > c ]      &#&3 (M X o dy&     & H   %  b D >& & 7 N ~X&y l} h   ~&&&H &`     &,&=&8H R&q u z& &, &P  &P  M E  q m&P =& * 3 =< @ I M T&e&r& k ] }&   ]  &        # , 0 7&tH&U&f  x @&   / +&  @ >  J H V T!&2&?&T& o ds ^|  }  &D&x&        &,&d1&L IP CY f] bf zj xs w     &&H&     & & `- 1  : [> OG K T X a e j& & & &     &  & & * 3 7 <& ]& @x 0| , F B& P&  \ X r n& &  ) - 6 : C G P T Y&&       "  8 4&H &&\& & ` & 9& @ s& & & &PP`$ P|p`4`tP`D 0X l  0 ` 0L t P   @ < d0 p L`.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@qph&P,P12PUE@@xOh'J@X6[1i5J~J0y@0 KL" @0X`0`L `ll@f msync.bd.o/ 0 0 0 644 49416 ` ELF@@C$8`|*H@A8`@8`|cN ```cN ```C$8`|*H@A8`@8`|cN ```cN ```|Aa8|#x!a8pH`|}xcxH`|xxH`||x|c8c;|cH`dxEx|~xH`9 : x|}:.H`xH````|!xH`xH`8!|N `|!xH`xH`8!|N `|iyM |!, AHH````|!H`8!p|N |!H`8!p|N |!a;pxH`,|xA , AT<8H`8xH`,|x@H8`(H`|}y@DxH`H````xH``xH`KxxH`,|x@xH`A9@9!p8>ApAxxH`,@08!8`|N ``H`xH`|}xH`,A, A<x8HH```<A9!p8A888>x8`*pH`H`xxH`|xH`,A0, A<x8H`H```8`*H`8!8`|N ```<  W. ZA l m?/ AA / 7 k k X (X  !7 3 5# 6#k 7k(  H k H k  H " y # y $0 ^ `_ a_ b c dk  ek$ f(kA  " #HA $ ) + ,H -( C4 E F4 G .DA' H0 K} M N} OOA/ PP@ O5 X(N(2(9 ;A > *A?B" "% ((+0.82@6H9P=XA`ChFpIxLPT[`rtwy({2}<A      H( 0 K8CidH@ HH P PX P` h p x   \ f      H       EF xG 8H p@((   F-7FWa@jmpA sB(C k)&*D220   @     # ($ 0%% 8 *H  *  0    *   )* . A?1 ;  2! H2"E  LA)F ;1. sFbuf/ L Y85 5 end5 5 ptr5 5 5(507 8 9 : 8< < end< < ptr< < <(<0 > ? mem@ maxA 8C 'C 'endC 'C 'ptrC 'C ' C(C0  : VA3k0  hD s      3kJ      !"#$%&'()*+,-./01 }  H&H' &! e H__+_a H_m HdD+,I,HX Hd+] H _ H 4 4, eIIHn Hee H a : HeHj HeGS : H 8"" C H> HUHhg +5 05 H5Ifp2 B H! 8 4 ( @ L X d p !T  p/ ( i! 8 4 ( @ L X d p !T  P-:" (& H  #mut 5 $    ST$ 4s 4 ( @ L X d p !eST   S* &  S*,S T U(,   !!%!!!, S0 ST0S ] 4 (% @ L X d p !NST  S T8U0V1')' H4%)69T   7L+!   SS-#mut !U >!c  -  4 (% @ L X d p !T  zpz+ |#mut} !< D!J '! 8 4 ( @ L X d p !T  i i)"k k(&k kH l#mutm 5 w$!U p!c S$!ns!|>S$ 0u 4 ( @ L X d p !ST   &  ,S T Uk],](#mut_ ` !bk!%!8!P!J!9!9! S ST2 S( N S %S N=S jUTNS b 4 (% @ L X d p !ST  S T8U0V1XH0:mutX- -!<Z !J'SSSH0:mutS+ -!nU !|>SS'C%C%'< H4<%6<5T > ? 77L 7'!!9!!  SSK" }L"&Hmsg"<err$buf% }"&H"&Hstr'  MArH cr0 mr> mH cm5 hH ch2 `H!c`3 rcbHUH!7resU4!7rcWHcX  NH!UmN. IH!nmI/ AH!mA, 9H!m9/ rc;H H!res 0!rc"H"#m$ .5.3.1 ; #: ( 4 @8 Lw X d p "SSTwU  "S "S  #"STU ##%S"TU $ &US; 4# ( 4 @ L X d p !#SSTT N I~ : ; 9 I8 ( 41I !I1B : ; 9 I 8 :!; 9!I!8 H} : ; 9 I H} 4:!; 9 IB$ > :!; 9 IB.?: ;9 'I<H} : ; 9  : ; 9 I: ; 9 I.?:!; 9!'I@z.:!; 9!'I !I!I/ < : ; 9 I8 4: ; 9 I1RB UX!Y W 41B&I : ; 9!  .?: ; 9 'I<!1RB X!Y W!"4: ; 9 I#4:!; 9!IB$1RB X!Y W % U&4:!; 9 I'.:!; 9 'I@z(:! ;9 I): ; 9 I *'I+7I,.?: ;9 '<-1RB UX!Y W . :!; 9!/ : ; 9 0'1 !!: ; 9!2 :!; 9 I83>! !I: ; 9 4.?:!; 9!'<5 6:!; 9 I7.:!; 9! '@z8419 1::!; 9 IB;.1@z<% =$ > > ?GI@&A5IB  : ; 9 C : ; 9 I 8D4: ; 9 I?<EI F : ; 9 I 8 G.?: ; 9 '<H.?: ; 9 '<I.?: ; 9 '<J 1K.?: ; 9 ' L: ; 9 IM!I/N.?<n: ; SSs SSSSSs SSSSSq#0TTq#8m0olo1lo o S S S 0 o 0   S S n S o o   0 nSS`lSlSdZhYSSo S S s S S S S s   S S S S S S S S s s  S S SS S q#0 o o 0 mm m 1m m  mSS000mSSSS<SoSSmmSm     <o0SSSSSSSS@DSDTS S 4S4Z4YSSoSSTkSmSo~SnSSSSTTTT, 0              runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/caml/usr/include/powerpc64-linux-gnu/bits/typessync.csync_posix.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hatomic_wide_counter.hthread-shared-types.hstruct_mutex.hpthreadtypes.hmisc.hmlvalues.hdomain_state.hdomain_state.tblminor_gc.hmemory.hfail.hcustom.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hplatform.hsync.hpthread.hruntime_events.hsignals.hstring.halloc.hsys.h <!! ..  ! t!! 2.  ! t w  <w   t .!  = > !&  #  # / -!/!;!/KN  /=.K  /=i/y '...*fl o<.wt  w<. w8Hf./. t./!! / . .nX ><n =!! /r: v!=!-/!. 0g#Y <%5 fzJ/N J1//fJ.XXO+. U .0/I.iA:. F .>1/#d/f !f.f< .//=! G v!t %.G =/-//. /!]//!!// X/~/tI> J sX  XX.  ./I .  ./I__value32sync_mutex_createc_stack_linkcaml_plat_condsize_tallocated_words_resumedmark_stackEV_STW_HANDLER__kindpthread_cond_tEV_DOMAIN_RESIZE_HEAP_RESERVATIONdependent_sizesync_mutex_destroysync_condvar_waitbacktrace_slotephe_infoEV_FINALISE_UPDATE_LAST__pthread_list_tEV_MAJOR_EPHE_MARKmemprofcaml_raise_out_of_memorypthread_mutex_unlock__next__data__prevEV_MINOR_GLOBAL_ROOTScaml_ml_condition_waitsync_condvar_createshared_heapcaml_heap_stateEV_EXPLICIT_GC_FULL_MAJOR__pthread_internal_listcaml_alloc_custom__ownerrequested_major_slicecaml_ref_tablecaml__dummy_wcond__value64epheslice_targetcaml__roots_wcondcaml_ml_mutex_newpthread_cond_broadcastmsglencaml_strerrorsync_mutex_unlockcaml_custom_tablecaml_ephe_infostat_promoted_wordscaml_leave_blocking_sectionlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatEV_EXPLICIT_GC_MINOREV_EXPLICIT_GC_MAJOR_SLICEsync_retcodewcondcaml_plat_mutexcaml_intern_statestat_blocks_markedcaml__roots_wrappercaml_ml_condition_newEV_MINOR_EPHE_CLEANPTHREAD_MUTEX_TIMED_NPcaml_final_infomemprof_domain_sEV_MAJOR_GC_STWcaml_condition_compare__nuserscompare_unorderedev_runtime_phaseEV_EXPLICIT_GC_SETcaml_minor_tablesntablessigned charcaml_raise_sys_errortrap_sp_off__pthread_mutex_sunsigned char__spins__int128 unsignedbacktrace_last_exncaml_custom_eltcaml_statefinal_infopthread_mutexattr_init_Boolvalueerrlencaml_gc_policyerror2error3charserializepthread_condattr_t__highcaml_ephe_ref_tablecustom_operationscaml_stat_alloc_noexcextra_paramswrapper__builtin_memcpymajor_work_done_between_slicesattrcaml_alloc_string__lowextern_statedouble__jmp_buf_tagcaml_condition_opsyoung_startcondcaml_condition_finalizecaml_enter_blocking_sectioncompareEV_STW_API_BARRIERsweeping_donetablesreserveEV_MAJOR_FINISH_MARKINGcaml_mutex_lockwmutpthread_mutex_trylockEV_EMPTY_MINORcaml_exception_contextPTHREAD_MUTEX_ERRORCHECKsync_condvar_broadcast__lockEV_MINOR_FINALIZEDEV_COMPACT_RELEASEEV_MAJOR_FINISH_CYCLEEV_MINOR_CLEARsync_mutex_lockoo_next_id_localminor_heap_wsz__g1_startcaml__frameEV_STW_LEADERlong unsigned intfinalizedependent_allocatedpthread_cond_initslice_budgetexn_bucketlongjmp_buffer__mask_was_saveduintptr_t__sizecaml_check_erroryoung_endEV_EXPLICIT_GC_COMPACTEV_MINOR_FINALIZERS_ADMINexternal_raiseEV_INTERRUPT_REMOTEc_stacksigjmp_bufsync_mutex_trylockEV_MAJOR_SWEEP__g1_orig_sizecaml_ml_mutex_try_lockEV_MAJOR_MEMPROF_ROOTSerror1gc_regsGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donesync_condvartrap_barrier_blockEV_EXPLICIT_GC_MAJORextra_heap_resourcescaml_ev_endcaml_ev_beginruntime/sync.cmut1mut2caml_extern_stateswept_words__wrefsEV_MINORcaml__temp_resultunsigned intcaml__roots_blockEV_MINOR_FINALIZERS_OLDIFYpthread_mutex_tintptr_tgc_regs_bucketscaml_mutex_hashrequested_external_interruptcompare_extcaml_condition_hashcurrent_ramp_up_allocated_words_diffcaml__dummy_wrapperoffset__saved_maskblockEV_EXPLICIT_GC_STAT__jmpbufthreshold__count__jmp_bufnitemswrapper1wrapper2allocated_wordsnextyoung_limitlong doubleEV_MAJOR_SLICEcaml_ml_mutex_lockEV_MAJOR_MARK_ROOTSunique_idEV_MINOR_MEMPROF_ROOTSsync_condvar_destroyallocated_words_directaction_pendingbacktrace_posPTHREAD_MUTEX_RECURSIVE_NPsizebacktrace_bufferlong long unsigned intcustom__listcaml_stat_blockpthread_cond_signal__g_sizeEV_MAJORpthread_cond_destroy__atomic_wide_counterallocated_words_suspendedEV_COMPACT_FORWARDpthread_mutexattr_settypedeserializeephe_refinside_stw_handlerfixed_lengthcaml_mutex_finalizeEV_MINOR_LOCAL_ROOTS_PROMOTEcaml_mutex_compare__g_refscaml_failed_assertchar_os__int128EV_MINOR_REMEMBERED_SET_PROMOTE__alignEV_MAJOR_MARKbacktrace_activecond1cond2stat_major_wordsmemprof_young_triggerpthread_mutexattr_destroyEV_MAJOR_FINISH_SWEEPINGEV_MINOR_REMEMBERED_SETrequested_minor_gcyoung_triggergc_policyPTHREAD_MUTEX_ERRORCHECK_NP__wseqPTHREAD_MUTEX_NORMALPTHREAD_MUTEX_ADAPTIVE_NPcurrent_stackatomic_uintnatshort intEV_MAJOR_EPHE_SWEEPrequested_global_major_slicepthread_mutexattr_tpthread_mutex_lockEV_MAJOR_GC_CYCLE_DOMAINS__elisionEV_MINOR_MEMPROF_CLEANextra_params_area__pthread_cond_sPTHREAD_MUTEX_DEFAULT__g_signals__valexn_handlerbsize_32strlen__int64_textra_heap_resources_minormemcpyyoung_ptrunitcaml_local_roots_ptrpthread_cond_waitcaml_ml_condition_broadcastEV_MAJOR_MEMPROF_CLEANasize_tdls_rootmlsize_tstack_infostat_minor_wordscaml_ml_mutex_unlocklockedEV_COMPACT_EVACUATEEV_DOMAIN_CONDITION_WAITcaml_ml_condition_signalcaml_stat_freeEV_MINOR_LOCAL_ROOTSpthread_mutex_destroyshort unsigned intEV_COMPACTbasemajor_refintern_stateEV_MAJOR_GC_PHASE_CHANGE/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-besync_condvar_signalparser_traceint64_tintnatbsize_64caml_mutex_unlockcustom_fixed_lengthcaml_domain_statestack_cachepthread_mutex_inithashminor_tablescaml_ephe_ref_elt__sigset_tEV_MAJOR_MARK_OPPORTUNISTICEV_MINOR_LEAVE_BARRIERidentifiersync_mutexEV_FINALISE_UPDATE_FIRSTPTHREAD_MUTEX_RECURSIVEcaml_mutex_opsretcodemajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA 4,@4T$hF AE A~ LDA~HCA LDA~HCA4C AApBA~0CpA~CBA0CpA~CBA$4,FA~{FA,\ C AFA~V FAC pCpA~RCA(CpA~F CAD I CAD $FA~R EAC 0PC AGA~s GAD 4pCpA~RCATpCpA~RCA4+04BHV`nxLL@  @ #94Jc0s0, 3E Xcy p8PhP/=O[ptpsync.ccaml_mutex_comparecaml_mutex_hashcaml_condition_comparecaml_condition_hashcaml_check_error.part.0caml_condition_finalizecaml_mutex_finalizecaml_condition_opscaml_mutex_opscaml_strerrorstrlencaml_alloc_stringmemcpycaml_raise_sys_errorpthread_cond_destroycaml_stat_freepthread_mutex_destroycaml_check_errorcaml_raise_out_of_memorycaml_mutex_lockpthread_mutex_lockcaml_mutex_unlockpthread_mutex_unlockcaml_ml_mutex_newpthread_mutexattr_initpthread_mutexattr_settypecaml_stat_alloc_noexcpthread_mutexattr_destroypthread_mutex_initcaml_alloc_customcaml_ml_mutex_lockcaml_statepthread_mutex_trylockcaml_enter_blocking_sectioncaml_leave_blocking_sectioncaml_failed_assertcaml_ml_mutex_unlockcaml_ml_mutex_try_lockcaml_ml_condition_newpthread_cond_initcaml_ml_condition_waitcaml_ev_beginpthread_cond_waitcaml_ev_endcaml_ml_condition_signalpthread_cond_signalcaml_ml_condition_broadcastpthread_cond_broadcast   4 H d p  ! " ! L `P$ |& ( *  2 0 `(+ @, T- \$ t! - . - 20/ 1Z1X1Cd2 3 & 4  28 08 `$  2 2  0 0 5 0( J 2HN 0HP ``$ 2  2X 0X `$ H, \9 r20/ !  2h 0h `$ 1Z1X1C; 3 < 4  2 0 `$ = " 2& 2 . 02 0 45 `? z 2~ 0 `$ A  2 0 ` $ &3&@ 30&`83H&P3`&h3x&3&3&03&p3&3&3&3 & (38&@3P&0X3h&p3&P3&3 &&x&0&H &&&&   L&*1,68DR Y `+gn iu|  vpO*@]L[ `,lyvh q9   =(;5gBO\ i Fvd O Oo (OE Yoe qOx'8+6 DR` 'n|qv n    0W / $ W2B@?N \ :jx5 }e SG&& 2>XJd !p/| l^&L X$0 <AH T b`2lx8A W v  =.8KGSX (bl5[v   % 2 ?+ L Y f s    ! . Y M Z y<   R  D = g  R r  ) C ]R j wD f  f    R  D /& 6A ; c4 i o uW {B   N  )     l ~    1     W  N " ( + . 4 : @ F L q R X ^L d j3 pl vZ |  (  } v  b ~    H  /     y \   +&4@&Ij    y!'- Ok"o (S?Vh:&E  &,$0"5&G&P&f/j-sFw@& && &PE`\&Ptr&h-&h6&hLP}Y]{& &&&tr yK'+0:> LPU_"c h&} W,*&&75A?&&&KI^#\A&\ &f&t&&&&&< &  & &0j f%E/~3|8BFO&0Xrgkpry}&P&d&&p" *&E &hO&^&o& &E62|&` LH v ] [|f d&+&BELqPmY&b&x|&& &E&\(,1&C&LgW[d hmg& &X&]& E#;5 S Q& Q.^2\7&8I&8R&8hilguyz&T &H&h &Er& >049CGUY^&ts W}&`&`&l&&&& &;?H%L#j& &8&&&&  &  &&1-"K&C+E5m9kB&K"Z}^uc"lp&&p&&0&H&\&|&&>&V&p&\y<#ZT<& &&d&&$&EvIrR&[fjo&d&p&p & &@E &0&G QUZ g quz #&E&&& &   ) Y e     B!!=!V !o7!! !}! !!"&"""""+8"/4"8K"<G"N\"RZ"[h"_d"h}"ly"q&"&"&"&<"&P"&l#&&x#?&0#Z#^#g#k#&P#&X##M6 & &R &77 &h &h &X &Xp &H &8* &: &J &&&& *&0@D`Xl0p8` 08PX.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.data.rel.local.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ 0@g& p, p6 p1@p`;2 O @J@s`d 8@_@tP` | x#w@t@8 0:5@;0@0<< @H0FT0[Q [tp@]0 dsys.bd.o/ 0 0 0 644 101216 ` ELF @@||x!H`,ApxH`|xH`8pxH`|~xH`xH`,aA,8!|c|N H`9 #8`K```||x!H`,@ 8!8`|N `xpH`|~xH`|xxH`,?A0xH`p8!|N ``pK```||}x|+x|#x!qH`,@08!x|N ```<xx8xH`8!x|N ``|?j!_aP,*A8p9 8P99A!!!!!xpAH`88pcHP|~x,?AxH`|}xxH`|x|}8cH`PxaH`!9@: xx}_K.a8c|cH`aH`H`aK<A8="))q)@HH`88`H`="))),)@XH`xH`8apH`>Ap})@P,*})t!`BAA`B!*,)Ad!`B>,)A$!`B!x*,)*A!`Ba!A(JR@,}?j),)A,}?j)i8H`x|,>@,}?j),)Aj?i8H`|~x^<8`8`BH`^<8`8`BH`x<8`8H`^<8`8`BH`=")||(@L,<8`8H`=")<8`8H`<8`8H`<x88`H`<x8`8H`KH`KyIyJB})Sx!`B*Ky*y)B}JKxA`B*Ky*y)B}JKxA`B*Ky*y)B}JKxA`B*K<A9!p~889>9A9! xapxA!H`,AaH`<8|}xaH` |xH`tg|xH`|xH`xH`,Al~8!{8ca|N ```<A9!pa9@9>ApAxH,AtTi&8`, @A 8!|N 8!8`|N <A9!pa9@9>ApAxH,A9@Ti&aJ8`| PA(8!|N ``8!8`|N <A9!p9@9>AxpAxH`,AaH`|xH`xH`|}xH`xH`,@X8!8`|N <A9!p9@9>AxpAxH`,AaH`|xH`xH`|}xH`xH`,AX8!8`|N <A9!p899A>9!xpx|tA!H`,AaH`|xH`{ xH`|}xH`xH`,A\8!8`|N `<A9!p9@9>AxpAxH`,AaH`|xH`xH`|}xH`xH`,AX8!8`|N <A9 8p<989A!xAF!!pjH`8|ix8`!H`!a#`B!=BJIa8!|N ```<A9!pa9@9>ApAxH`,AaH`|}xH`xH`|xH`xH`,A|s8`@ W88!|N `<J{ZH{{H{H;88apH`Ax!pY}>*H`|~*H`|~*8!!Aa|N ``,'x@(KP``A9!p99A8>A9Ap~p9 8p9^9A!xa!!!!xpAH`,A;82xH`apH`|}xH`xxH`||xH`xH`,A8xH`aH`8|ixx!H`~a8!@a|N <">: ~ -i    _$ (0 8@VHVXVhJxJJJ JJiJ35#6#7( s _ C _ C  _ " X # X $( C  E F G w>J' Hs l! k    KfE"*~WwZJl*m6LN<_|M(* w+-/1 w2-57 w8-;= w>-B&D wE-HHJ wK-NjP wQ-UW wX-[] w^-ac wd-gi wj-mo wp-u6w wx-|X~ w-!$&| (08@&HHPjX`hpx6+ _ONC4XZ4N>"2O[y5\_5]_5^ yP}&4249B;BQ>N?CJ?R" G &  G  G " G % G ( ( +0 .B8 2 @ 6 H 9 GP = GX A +` C 5h FNp INx LN PN TN [N `B rN t wN y | {  }  B B    B N N N N & _( 0 8Sid_@ _H P .X .` Nh Np Bx B B   N N N B N _ B B    G 8+ sp0 G1 G3:_;  < N(id= 0 Lp u spw x   E +FG8H$p # 0@ | | B B  :# # # # # @ jmpA B |C # 6&%22  <C a6* nw ~J?=   a>! _>"T ~ J6F =. Ubuf/  % N%!(2"h#+J#.fd#/_#0end#1 9#2 9max#3 9 #4 (#5P#5X#6 N`#7_h#8 9p#9 9x$%/&85G5Gend5G5Gptr5G5G 5(50 G78 9 : 8<<end<<ptr<< <(<0L>$? mem@ maxA 8CCendCCptrCC C(C0:9 GJ  ! " # $$ $"$%$& $( $* N($+ N0$, N8$- N@$/ NH$0 NP$1 NX$2 N`$3 Nh$4 Np$6 Nx$7 N$8 N$9 N$: N">%$=(.")%%=@&#&$ B&% B&& B&' B&( B &) B(&* B0&+ B8 &7&8 &9 &: &; `&D&E&F? f/J"+/  V  ') __(3 b _C&e _k_&a _(1)nQQ??*C _*'s_'_(4.Y _X+$ _&J. G(8IINW],$Ht&Y G(,(?)U+9@k'9 9'c _#, _?' _V- _q'Z _A,_~*'f __q_,S-. A__7-.(G_:PX+} c_-.m-/E,% Y08&_719 N 18 N ,&T@mZh2+'(0=pT2k(2[3% _&e_-z _97\2 __9 V8H V-kS .JdJ( 8` 8& fd:_ ret; r N .N | :~_ @  :~ _(tbl!C p"  ret#_3 ?[%.?hSBSLST2:STSST0ST1#S T U @ST1? |    *N |h` :_k3S OS3T0S T U  N /N | :_X(effPH :~_  @! :1U@kkS0S0US T U  p >kk.2.3/2. 1  G .  ~ 0  .  //! 0 ! + !~ n_ res !! i _!!SST0B!J y_# y"# n{ C|# }_(tv!" fd _"S T0U0"TU<S"ST<l#ST0aVB5#0J q# q$ #s #$B$k${C8$~9$S0T~/m.$m$ g4$k g5$k$]SS/=.$=5Dru@XDsecA . @&( .N | :_ _ _ buf! !%i4:%S%S&S T U ??]l& $ $ Q]&SSTT.&TS  d'( -k @'l /k @' +tS TS ' $ ) (N |h(res` :_(k(S2T0S T U  H)0var* res ))ySS <)0var& res ))SSE*0var res  p val *S:*S*S*SkS +0var- res  p val +eS:+}S+S+Sk+S `,x & ,x_ ret ,LST k,dS?S12,FJ | .= |%~N~ |~ :~_ p  ret_-R ?[-?h-SBS: -S-S./S T U ~? l@0 l% l1nNn |n :n_ po  retp_q_/.y ?[r/?h/lSBS:#/ST/S0S T U n? ] 1 ]%_N_ |_ :__ p`  reta_0i ?[b1;?h1&SBS:?1mS1S1S T U _? J3 J& J5L M  retN_ ?[O2?h2SBS ?[P2?h2SBS:3S:3/SV3ZST3S3S? ; 5Y ;&=N= |= :=_ p>  ret?_4nG ?[@4?h4SBS:q4S5S5KS T U =? /6R //1N1 |1 :1_2_!6576DS T U 1? #7K #,%N% |% :%_&_!6)77=S T U %? P7 +_7SSE _8  %(st~~ p  ret_8.S:8FS8rST~8S1h9B2vfd% fd_ ret_9'S1&?1;[$$$0$>'N |+ :_3fd_ __3p !:B^?[:?h:SBS::T :ST@?$!U;S;MS T U?1$;$$;SS1&:?V$"_' ;s~ <"'?VN!>...BB<'?VN=S T U=4S T U=ZS T =S T U=S T =S T =S T >&S T U>RS T U>S T US T Us>S3T1cP?S?S~kS T U&_ ?u`':tD?2argt)??S:^PA2arg^&'`N'` |+` :`_3erra 9;bufbAv;strcP+c :~c_hAKijT@S=@S'AS"#D"A0UD"TUAAxTvU kS T U`>AFJ1F9B$F%_2bufF49$F@3resL_BcSTUSTU V)?[8B?h?S)$kCQ${8$~9$C6S0TS T)#C$B$k${C8$~9$S0T~) C )D"a5I~ : ; 9 I8 H}IH}4:!;9 IB !I: ; 9 I :!;9 IB : ; 9 I 8 :!; 9!I!8 .?:!;9 'I@z 4:!;9 IB : ; 9 IH}4:!;9 I : ; 9 .?: ; 9 'I<.?: ;9 'I<( 1B4:!; 9 IB$ >  : ; 9  : ; 9 I8  I8 4:!;9!II !I/ :!;9 I 1RB UX!YW ! U"&I#<$:!; 9 IB%4: ; 9 I?<&.?: ;9 '<'4:!; 9 I(4:!;9 I).1@z*7I+4:!; 9 I,.?: ; 9 '<-.?: ; 9 '<..?:!;9!'I/.?:!;9 'I !0:!;9 IB1.?:!; 9 'I@z2:!; 9 IB34:!; 9 IB4:!;9 I5 :!;9 I8 6: ; 9 I 7841941B:.?:!; 9!'@z;4:!; 9 I<> !I: ; 9!= !!: ; 9!> :!; 9 I8?.?:!';9!'I<@.?:!; 9!'<A.?: ; 9! n'I<B1RB UX!Y!W! C UD4:!;9 IE.:!;9 'I@zF!I/G% H$ > I J : ; 9 K&LGIM( N> I: ; 9 O : ;9 P4: ;9 I?<Q5IR  : ; 9 S : ; 9 I 8TI U : ; 9 I 8 V4G: ;9 W'IX.?: ;9 '<Y.?: ;9 '<Z.?: ; 9 '<[.?: ; 9 'I<\.?: ;9 n'I<].?: ;9 '@z^1RB UX Y W _.: ; 9 ' `: ; 9 Ia.?<n: ; EESEESDDSDESDDsDD1AASCCSCCq#0ACkCCDDkBC0DD0BC0DD0BBSBCmDDmBClDDlCC@CCSBBSBBoDDo??S?@S@@S@AS?@o?@0@@h@@S;<S>>S>>q#0<=m=>>>m>><>0<>0==S==T==S=>S>>S::S:;S99S99S99S99S99S99S88S89S77S78S78o88o78S77088 x#3%#88 x#3%33S35n55S55n55X56n33056033044 q44 q44 q55 q55 q55 sq"56066066l66S66S66m22S23S22S23S23123 33 .!."00S01S,,S--S-.q#0,-l--..l,-0..0--o..o--8&--S--m..m++S++S++T++T++U++o++U**S**S**S*+S))S)*S))S))T))S))S))S&'S'(S((S()S'(o'(0((`((S&&S&&S&&S&&S%%S%&S%&SSoSoSSooSnnS$$S$%o%%S%%S%%o%%S%%n%%S#$S$$S$$S$$S!"S##S##q#0"#l####l"#0##0""S"#o##o"#m##m##1""S""o##oS!!S!!q#0T!!T!!q#8 l !!!l !0!!0 S !o!!o m!!m m!!m !1 S o!!oSSq#0ll00Soomm1SooSnSnSnToToToSnnSoommSnnooSSq#0ll00Soomm1SooSSq#0ooo00SSSSSSq#0ooo00SSSSSSSSS8o8SoS8?S?xoTtnSoSs1&1&S1&ooSSq#0TTq#8UUq#@kk00oo@?$@?$!T@?$!@?$llSmm1$#SSooSSSmSmY ??? >>> == sy" ll nn USoSSq#00SnSn0SmSoSmSmSToSoSUnUnUSSSo..S..o.0S./ //!/0P00qP00!11S12S12112 22 .!."88S88S::S::S,"   !!""""##----111111122222236666667888==>>AABBDD runtime/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/types/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/sysruntime/camlsys.ctypes.hfcntl.hstruct_timespec.hstruct_stat.h__sigset_t.hstddef.hthread-shared-types.hstruct_mutex.hpthreadtypes.htypes.hstdint-intn.hstruct_timeval.hstdint-uintn.hstdint.hconfig.hstruct_rusage.hresource.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hresource.hdebugger.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hgc_ctrl.hsys.hplatform.hio.hstartup_aux.hstartup.hgc_stats.hunistd.halloc.hosdeps.htime.hstdlib.hstat.hstdio.hsignals.hcallback.hruntime_events.hshared_heap.hstring.herrno.hstdatomic.h w  X./.=/ Y/=+ .!(yf..8.? \.. q  rX.@ ." /0 @ %1/  #K/  !<,f=! / !J !i=;/!..u!0 .  J*$  <x..X0  f=;/!..u!0< .  JF$  <x..X0  f=/-/!.. ~J = ~ ..K/ K/=/ J u..X.. ] ~J ~J.. ~ <. K  =/ Y/==!"< .. y=/-/!.. ~J = ~ ..K/ K/=/ J u..X.. ]=/-//.. ~f 1/ ~ ..K/ Y/=/ J t<  X.. ]=/-/!.. ~J = } ..K/ K/=/ J u..X.. ] 2 2.2/  /V O j./N ." // @< %r.*X="2G.P="= ."=;/ .0/,!0.! = ! ! /!!.= .<yX.X X.i/ //,!; / /wJ1 $ 2./f y w X/ X " ,"/<f=/-/!.. u .2 K2 K/=/=  < jJ.X3 ./ .X ]$w 3K< !"<  !/<!  ! # ctY!! ! ! dJ !>! d  !  $i = 0*O**V **V.=< ! < .!+ U<!<!! ""[zO/Q /Q.=< ! < .!/<!! " &=yCy ... '  '  ' .' #5!$/$! x K!!$.!.!!nX '    z<g!  yJ!? !fy_. ## /t./</.-X -  J,/ / -< k x x x w v  v #" - / 1 q<1x=!-/!. !I/W!0/L-2 +#! "- 0 . !!1.! 0" "> < xJ%  %0 < mf.XX=;/ .! L 0 Z /! ! /!" !!." $ .<sX.XX=/!/!. z /; z  /;!/ z ..YK/ Y/=2K = ! !/ .. k<.X..K Xx.$ $ .2 #X $k   $  20__ru_inblock_word__aligncaml_sys_const_ostype_unixcaml_sys_const_int_size__pthread_mutex_sru_nivcswthresholdextra_params__ru_nswap_wordcaml_ext_table_init__saved_maskstdlibcaml_raise_sys_errormkdirblockcaml_paramssys_getenv_Booltablescaml_enter_blocking_sectionruntime_warningscaml_domain_statelockedyoung_startcaml_sys_const_standard_library_defaultephe_infocaml_sys_getcwdgc_policypool_live_wordsisattymemory_order_releasebacktrace_activelocal_rootsmemory_order_acquireru_nsignalsmajor_slice_epochstack_handlernextcaml_sys_random_seedcaml_sys_chdirpool_frag_wordsst_sizecaml_local_roots_ptrcaml_sys_get_argvp_newgetppidcaml_runtime_events_destroypool_live_blockscaml_sys_unsafe_getenvlarge_blockschar_oscaml_custom_eltcaml_minor_tablescaml_sys_getenvru_isrssdomain_statest_blksizesys_open_flagsru_msgrcv__jmpbufmemory_order_acq_relcaml_debuggeryoung_limitmemory_order_relaxedmemcpycaml__roots_namest_gidgc_statscaml__dummy_dirnamegettimeofdayextra_heap_resources_minorforced_major_collectionsmemprof_young_triggercaml_runtime_standard_library_default__syscall_slong_tdependent_sizest_nlink__owner__mask_was_savedCODE_LOADEDcaml_sys_file_existsst_ctimallocated_words_suspendedcaml_top_heap_wordscaml__dummy_str__sigset_t__lockrenamecaml_raise_sys_blocked_iominor_tables__pthread_list_tBREAKPOINTminwordscaml_heap_state__ru_oublock_wordst_atimcaml_secure_getenvinit_custom_major_ratiosnprintfunlinktrap_sp_offvstdlib_defaultstat_forced_major_collectionsinit_custom_minor_ratiocaml__roots_path__uid_tcds_filecurropen64mode__datareadcaml_sys_time_unboxed__jmp_buf_tagmarking_donefile_offsetoo_next_id_localgc_regs_bucketsunsigned charmemory_order_consumecaml__roots_argruntime_events_log_wsizecaml_ephe_ref_tablepthread_mutex_trequested_external_interruptrootinit_custom_minor_max_bszcaml__roots_dirnamecaml_sys_erroroff_texn_bucketinside_stw_handler__kindcaml_copy_stringcaml_sys_argvuint64_t__mode_ttrace_levelcaml_sys_const_word_sizeexn_handlertv_usecp_oldEVENT_COUNTallocated_words_directstackcaml_modify_generational_global_rootbuflen__ru_msgrcv_wordopentop_heap_wordstrap_barrier_blockcontentscompare_unorderedvaluefinal_infoinit_minor_heap_wsz__suseconds_tnitemsverify_heapexitflagsexternal_raise__sizemutexsizeru_minfltpromoted_wordssize_t__countstat_blocks_markedcaml_alloc_2dls_rootmemprof_domain_sru_utimecaml_stat_freecaml__dummy_arg__jmp_bufTRAP_BARRIERcaml_string_lengthcaml_final_info__xpg_strerror_rmajor_refru_msgsndcommand__int128 unsignedcaml_sys_get_stdlib_dirsunique_idntablesrequested_global_major_slicegetrusage__pad2caml_gc_messagecaml_alloc_stringcaml_unix_random_seedcaml_ephe_ref_elt__nlink_tst_inost_modeyoung_endcaml_leave_blocking_section__pthread_internal_listcaml_stat_string__prevostype__int64_trefcount__uint64_tcaml_sys_modify_argvcaml_read_directory__glibc_reserved4__glibc_reserved5__glibc_reserved6__ru_maxrss_wordsweeping_donecaml_strerrorlarge_max_wordscache_bucket__rusage_whocaml_sys_temp_dir_namechdir__ssize_tchanneltimespecrequested_major_slicebacktrace_enabledcaml_sys_system_commandmemprof__valcaml__roots_block__rusage_who_tlongjmp_bufferruntime/sys.ccaml_stat_strdupPROGRAM_STARTcaml__roots_result__ru_nivcsw_wordcaml_copy_doublest_uid/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bestdlib_defaultrusagecaml_statecustommagiccaml_heap_sizeresultgetentropynamecaml_sys_time_include_childrenstat64caml_sys_file_modeasize_t__nextcaml_intern_stateexe_nameunitcaml_stat_blockru_ixrsscaml_sys_const_backend_type__time_tcaml_sys_check_pathcaml_sys_close__int128ext_tablebacktrace_poscaml__temp_resultallocated_words_resumed__elisionallocated_wordsbuffstrerror_rsystemcurrent_stackshort unsigned intsigned char__blksize_tevent_kindsigjmp_bufheap_statsstatusinit_max_stack_wszcaml_sys_getenv_opt__off64_tcaml_failed_assert__atomic_load_tmpextra_heap_resourcescaml_init_exe_namecaml_minor_collections_countdependent_allocatedcaml_extern_stateyoung_ptrmemory_order_seq_cstintern_statecaml_sys_is_directorycaml_standard_library_defaultcaml_sys_rmdircaml_sys_read_directorypathalloc_statscaml_sys_executable_namecaml_sys_io_errorminor_heap_wszroot_dirRUSAGE_CHILDRENcaml_exception_contextcloseproc_self_execaml_sys_const_ostype_win32long intuintnatlimittimevalcaml_shutdownephe__ru_idrss_wordcaml_ref_tableoldnameintptr_tcaml_sys_remove__pid_textern_statearg_lenuintptr_tsection_table_sizelong doublec_stackreservemajwordscaml_sys_const_big_endiancaml__dummy_resultlong unsigned intru_nvcswcaml_sys_timeevent_trace__ru_isrss_wordinit_percent_freecaml__dummy_command__errno_locationbacktrace_slotchancharnreadDEBUG_INFO_ADDED__ru_ixrss_wordmax_domains__spinscaml_sys_is_regular_filecaml_terminate_signalscaml_plat_mutexaction_pending__nuserscaml_sys_proc_self_exelarge_words__dev_tRUSAGE_SELFhandle_effectcaml_raise_not_foundpool_wordscaml_do_exitcaml__roots_commandslice_targetstrlencaml_alloc_somebuffercaml_sys_io_buffer_sizeshared_heap__ru_nsignals_wordcaml_sys_time_include_children_unboxedcaml_alloc_smallcaml_string_is_c_safecaml__dummy_vstdlib_default__ru_msgsnd_wordru_stimecaml_sys_get_config__ru_majflt_word__ru_nvcsw_wordcaml_xdg_defaultscaml_sys_const_max_wosizeint64_tcaml__dummy_exe_namecaml_sys_const_ostype_cygwincaml_copy_string_arraymlsize_t__ru_minflt_wordintnatcapacitynewnamedoublemajor_work_done_between_slices__builtin_memcpyhandle_exnheap_wordsst_rdevcaml_compute_gc_statsst_devssize_tinclude_childrenargvcaml_sys_initcaml_ext_table_addslice_budgetdatacaml__roots_vstdlib_defaultvflagsmain_argvbacktrace_buffercaml_sys_openhandle_valuecaml_convert_flag_listpool_max_wordsbasecaml_sys_exit__gid_tgetcwdUNCAUGHT_EXCtrap_barrier_offtv_secbacktrace_last_exnlong long unsigned intparentoffsetcaml_sys_isattyru_inblockcaml_ephe_info__listcaml_gc_policyst_blocksgetpidru_nswap__blkcnt64_tPROGRAM_EXITcaml_verb_gc__ino64_tcurrent_ramp_up_allocated_words_diffru_idrssnew_argvdirnamecaml__dummy_namegetenvcaml_register_generational_global_rootGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablescaml__roots_exe_namecleanup_on_exitatomic_uintnatcaml_ext_table_freecaml_major_cycles_completedru_oublockextra_params_arealong long intru_majflthandlermark_stacktv_nsecephe_refcaml_locate_standard_librarypermru_maxrssmajor_wordsvpermcaml__roots_strparser_traceerr_lenstack_cachec_stack_linkCODE_UNLOADEDcaml_sys_mkdirretcodecaml_sys_renamesection_tableminor_wordscaml__dummy_pathcaml__framecaml_custom_tablestack_infotag_tstat_promoted_wordsunsigned intgc_regsrequested_minor_gcexception_ptrstat_major_wordsst_mtimcaml_alloc_arrayshort int__atomic_load_ptrprevswept_wordsstat_minor_wordsstaterrnumyoung_triggerrmdirGCC: (Debian 13.2.0-18) 13.2.0zRxA ,B ACA~FRB DAA 8HB ACA~E DAB BO ACAC A4C ACCA~E FAD HFA PC AF A~8B ACA~DB ACA~( C ACHA~L$EpA~0dC AHA~x IAD $hB ACA~M CAA $PCpA~D CAB ACA4C AEA~W DAA B EAA 4 C AEA~Y DAC B EAA 0X C AGA~f GAA ,C AEA~d EAA 0 C AGA~f GAA 0@C AGA~m GAB 0$ C AGA~f GAA X`E!A~J CAA (|C ACA~T DAA <CpA~D BAA HCpA~HCA(C AEA~h DAD (@FpA~CCAH@FpA~DBAhdJpA~EBA$lB ACA~OCA0@C AGA~j FAB 4D AEA~Y EAA MDAI4CpA~DBA<DA~NBA\DA~XBA8|F AGA~s IAC $EA~^ DAA 0DXl$pFpA~D BAD FBA8C AFA~| EAB G EAD (C AEA~h DAD 4$C AHA~A GAA $\`CpA~G CAC ACA8EpA~CBAAgnu`8  5 $D Ndu0 HP/:ATfmxD <Jaw$hP, E8 U\Pelh u{@ `<H ,(:@@OtX@pdl@CM4l}0H`+xC]u  p38LivPh`*8Asys.ccaml_sys_file_modecaml_sys_check_path.part.0sys_open_flagsmain_argvcaml_string_is_c_safecaml_stat_strdupcaml_enter_blocking_sectionstat64caml_leave_blocking_sectioncaml_stat_free__errno_locationcaml_secure_getenvcaml_copy_stringcaml_strerror__xpg_strerror_rsnprintfcaml_sys_errorcaml_statestrlencaml_string_lengthcaml_alloc_stringmemcpycaml_raise_sys_errorcaml_failed_assertcaml_sys_io_errorcaml_raise_sys_blocked_iocaml_verb_gccaml_minor_collections_countcaml_major_cycles_completedcaml_paramscaml_do_exitcaml_runtime_events_destroycaml_debuggercaml_terminate_signalscaml_compute_gc_statscaml_heap_sizecaml_top_heap_wordscaml_gc_messagecaml_shutdowncaml_sys_exitcaml_sys_opencaml_convert_flag_listopen64caml_sys_closecaml_sys_file_existscaml_sys_is_directorycaml_sys_is_regular_filecaml_sys_removeunlinkcaml_sys_renamecaml_sys_chdircaml_sys_mkdircaml_sys_rmdircaml_sys_getcwdcaml_sys_unsafe_getenvcaml_raise_not_foundcaml_sys_getenvcaml_sys_getenv_optcaml_alloc_somecaml_sys_get_argvcaml_alloc_smallcaml_sys_argvcaml_sys_modify_argvcaml_modify_generational_global_rootcaml_sys_executable_namecaml_sys_proc_self_execaml_sys_initcaml_init_exe_namecaml_alloc_arraycaml_register_generational_global_rootcaml_sys_system_commandsystemcaml_sys_time_include_children_unboxedgetrusagecaml_sys_time_include_childrencaml_copy_doublecaml_sys_time_unboxedcaml_sys_timecaml_unix_random_seedgetentropygettimeofdaygetpidgetppidreadcaml_sys_random_seedcaml_sys_const_big_endiancaml_sys_const_word_sizecaml_sys_const_int_sizecaml_sys_const_max_wosizecaml_sys_io_buffer_sizecaml_sys_const_ostype_unixcaml_sys_const_ostype_win32caml_sys_const_ostype_cygwincaml_sys_const_backend_typecaml_runtime_standard_library_defaultcaml_sys_const_standard_library_defaultcaml_sys_get_stdlib_dirscaml_locate_standard_librarycaml_alloc_2caml_sys_get_configcaml_sys_read_directorycaml_ext_table_initcaml_read_directorycaml_ext_table_addcaml_copy_string_arraycaml_ext_table_freecaml_sys_isattycaml_xdg_defaultscaml_sys_temp_dir_namecaml_standard_library_default , 8 H T `     $ 8! # 20$ >&ZF&XH&C " ' ( ) * ,* 8+ @! R2V2(^0b0(d,  %  % . *&Z6&X<&CV 2Z @h4 x5  2 @6 7 8 t&C&C9 &C&C: 2@0@; 2X0X ; 2p"0p$; 22:0H; R 2V @n2v0x;  2 @20; 20; 20; 20; < 22(00(, 22(00(, 22(00(, 3 >&ZJ&XP&C   2 0?  @  $ r2 v2( ~0 0( ,  ` %  B  % , ~&Z &X &C  "2 &2( .0 20( 4, H% n&Z r&X t&C  "2 &2( .0 20( 4, H% n&Z z&X |&C    G   B2 F2( N0 R0( T, h ` p%      I     L `P% X `~&Z&X&C   K    R2V2(^0b0(d, x `% &Z&X&C    , <M H T 22(00(,  `% &Z&X&C4 H T `O l x 22(00(,  `%  Q  ! @% h | S  ! T  T , <W ~&Z&X&C 2 @! Y 2@R2V2(^0b0(d, 2@20\  2 @! " 2& @H! PW `  2  @ a 220@b &Z&X&C` t  d   22(00(,  (% 0% lf z 2 0 2 0f le ph f  2 0 2 04f B 2N 0R 2V 0h l xm n o 2 0 @ Hp XB k Y v2z@!  2( @(! &Z&X&Ct ~ 2 @~ ! ! W   R2V2(^0b0(d, &Z&X&C2000! Y b2 f2( n0 r0( t, &Z &X &C! !0 !< !H !X !d !p ! ! ! !2!2(!0!0(!, " `" " % "D "28"08"! &3& 30&83H&0P3`&h3x&3&3&3&03& 3& 3& p3 & `(38& `@3P& X3h&pp3&3&3&3&P3&3& 3&p3(&03@&H3X&`3p& x3&3&3&@3&`3&3& 3& 30&83H&PP3`&ph3x&3&3&3&3&3&03&P3 &p(38&@3P&X3h& p3&"03&"3&"3/&0&1&2& !&({&   \&*18?RF>MTe[l iz |=cP    q)" Z.fA&KW ldqy   U [^<(5B O \ s  > f 2 [@PM  m%2?L^Yf}_ ;)%D+7'CO` 0pvAA wB& M0<>R ^t ,V*O@_L 3Y f s! 8 ip"'3DR H_lC$fC# 1?DM[iPwKC ?  Z  - ; I Ww e s       u  { S 9 m )  ' i 3 ? K Wx c@ oD {     * t   u      , # /* ;s M ff s  #  H   V    "   1 ; H% U s b  o    u T G Q    *  } +3 1a 7  =6 C Ir O1 U [ b  `       % d>XNr B% s &- #Pi - H:XM Zgt<Pi HX%2PLifs HXg JEnY)61CEPm]jw [ wR4@@MZAgtN  WK5GA &JW&j&s  2Wbmf  D =/^u\Xk $@ TW"rh  S *; Q !dlt~  c)( > UQl2  =&"b$( -&">&8I_Xbep&"0!&":8FD&"L& UOfu o%,5@DI X hsw&!&!&!&" /&!8M&!DZ&!Pg&!`&!l&!x&!&!&!&!&(&$&"A&"$T*_&vbfCA  b MK& 4 ZV&*&04& P& |a&(n& P&pjf 8& 6AEJ UY^Vmx|&|&&&&&&$&l0&(=&OOZ&pqb|&&bb|b b o & 3b > B Hq S& jb u) y% 5 & b ? ;  &p b U Q i b! *!&!,b!7k!;g!@!Y!]}!m!q!v!!!&!&! !&!""" ""h",+"70";"O"b"f"k&"& "&P"&`"&"&#&#&#1#<& #Sb#^#b#k& #t###& #######&<#&#k$b$ $&`$1$<'$@#$E&p$^&x$l$|$ $&$ 6$?$9$f$$_$Y$0%%{%w%%$%(%-%8%<%L%P%U%^%j&h%w&|%&%&%&%&%& %&(%&&&&&,&&4&)&1&&Hn&S&W&\Y&g&k&p&{&&&&&&&&&&&& &b'' '&P'&X')'4&'Kb'VF'ZB'_&'m 'x&''^'X'&'&''&'b'{'w'{(&p(b(*(.(3f(>(I(M(RY(pb((((&$((((&(&(&l(&()&))"& )D)H)X)\)a&0)z&D))&)) )") )&)&)*&*&4****:d*>^*L*Pz*`*d*i&*&*&*&,*&@**&P+ +++#+1+5+E+I+N&p+f&+~&+&+&+&++&+b,,, -,% ,),.&,M&(,e&D,,&,,,,f,,>,8,,,,Z,V- q-k- -$-)&->-I-M-W&4-`-p-t-y&<-&-&P-&\-&h-&t-&-&.&(.&.0&.>.I&.`.k.o.tW...f....,..#..:.4.T.P.<.g/c/&d//%x/)v/3& /</L/P/U&/m&/&(/&4/&D/&P/&\/&/&(0&0&0 ?0+&p0B0M0Q0Vf0a0l0p0uu000000 0 0&(00 !0 0&01 01  *1&1'&|1<&1I&1V&1n&1{& 1&l1&(1&1&11& 12 R2 F2 2 2 2-2) 2- 222= 2A 2Q 2U 2^& 2gg2w 2{ 2& 2&P2& 2w2 +2 '2& 2&\3& 3& 30& 3=& 3[&3h&3& 3&T33& `3 3 @3 :3f33 `3 Z34 4 |4 x4( 4, 4< 4@ 4E& 4Z4e 4i 4s& 4|W4 4 4& 4& l4& 4& 4& 4& 5& 5& \5.&(5;&5L& t5Zf5e& `5| 5 5 5f55 5 555 #5 5Z5 85 45G55 K5 G6& 6& <6'&(64&6E& L6S6^& p6u 6 `6 Z6f66 6 z666 6 6Z6 6 6766 6 6& 7 & <7 &(7-&7>& L7L7W& 7n 7y 7} 7Z7 7 7& 07%7&7 7 7 7 -7 )8 :8 88&8/&48G&@8T&P8s&\8&h8&88& 8 F8 @8 e8 _8 8 9& 9& 9(& 95& 9C9M&09d9n 9r 9w9 9 9W9 9 9f99 9 9,99 9 9 29 .9 &9 K9 A:<:  : : :! :&,:/:9 := :G&:P:` :d :i&:& :&:&: &:&:& :& ;& ,;& ;1&(;>&;N& ;\U;f&;}; ; ;&;#;&;;; ;/;&T<<<"< <# <,l<60<:*&>'&>C&>S&>h&(>u&>&>&(>&>&p>&>&>&?&?&?(&?9&(?F&?\?i ?v?{&???&?&?&??&0?@@f@@@, @6@:@I@M@o]@~@ @@&@z@-@)@@@@<@&@&@&A& A1&4AL&AY&Ay&@A&HA&lA&(A&A A&AAYBOBBBB$B(B7B;B@&Bd&B&B&BBB&B&B&@BB C4C*C&tC7&CV&CqiCueC~&CC}C{CCCC&C&PCCC&DDD#D'4&&&&p&"L0$Ph0   p$ `\ ` p(\P p,Ll @ `@` Pp  4H\p0Pp( `"0"".symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rodata.cst8.rodata.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @"@#&#(,#(6#(1@H ;2'9O)00J@T)`a)p$n)D.i@hx` zmdt&0@}0+C@}`0Y0U x@~Xo,@  `_ unix.bd.o/ 0 0 0 644 44536 ` ELFx@@||3x|+x|x!qH`xxxH`|xH`8!|N ``|||x|+x|3x!qH(`H`/;#, @@@A,xpx8!|N xH`pxKruntime/unix.cretcode > 0 || retcode == -1./0- 8A.int udn-AAAA..H/...!. nEl-  9 0]]] ] W. ZA l m        H$ ( 0 8 !@ gH gX gh Ax A A E1H:      !"#$%&'()*+,-./0123456789:;<<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2    ] z ! :3n4A5DIR67 Nn8 [\H]H^  ;:E  E `E 8 s5E iJ L H 5= 5HHH. H * H HA! H ,[ , gE Hd  H ^ ^  c H     H dd  ^ :  ^ d"RE @ i < H  8 ,dH  # Bd9S T  H si x  s  # H! b H    # d e d H "% HzO H5# sO AH5# /xI?d?d:$4 E E E:I4 Y%e%o PSS J hS  BS } S3TU V s ST0 B S S `S BS S&Ez*d'dir E'resEhmem -  SSTT S T U @mem#0 (    SSTTU0V2W X0\mem"/ p (    STTU3V2W X0&;mem+ 5Hu`ou! u+Hw  memx  S0TSUT0)3V"W X0mL SN_Hdfd_H)wbp SST @thUpH PP)tMgp S1Tp5E0var5'd 1SSH8+EG d! ^e#*rc. H JS  coS HS  SS HS E0 8v $d<v   S0TS=++/d>0  SSl` E (H LSST  T2  6 El 7dres # ,S SE" 9  Lddird E?st~,$pd* i H } TST B SuEtblu9  uEEpw EqwEnx 5 ST S`Hfd`H `Hbuf`-n`6HbH,c A STU  S T UqWHxfdWH WHbufW,nW5HYH A }STU @v0   SSTT( I~I : ; 9 I8 : ; 9 IH}H}$ >   !I .?: ; 9 'I< 1B H} :!; 9 IB:!;9 IB.?:!; 9 'I@z.?: ;9 'I<.?:!;9 'I@z4:!; 9 IB:!; 9 IB:!;9 IB4:!;9 IB7I4:!;9 IB&I : ; 9! :! ;9 I8 .?: ; 9 n'I<:!;9 I.?:!;9!'@z4:!; 9 IB4:!;9!I?< .?: ;9 '<!".?: ; 9 'I<#.?:!; 9!'<$ U%41B&.:!;9 'I !'4:!;!9 I(1RB UX!YW )4:!;9 I* +:!; 9 I, :!; 9!-% .$ > / 0&1> I: ; 9 2 : ; 9 3I4!I/ 5: ; 9 I6<7: ;9 I8 : ;9 9.?: ; 9 '<:1RB X YW ;: ;9 I<1RB UX Y W =.?: ; 9 'I >.?: ; 9 '@z?4: ; 9 I@.1@zSSSSToTToTUUUnUnUlUlSoSoSoSmmSSSmSlSSTTSSTT0TTSSSoSTToS3TTSoSTSTyTSTSSSSSS S S T n T n T S o o S Y sm Y S S T S S T S 0 S S S S S S T T T TS SSoSoSSSSmSSmSTlTTlVlTTSoSoSTzZz0nnnSnSnSTTSTSlSSToT0SlSlTTUmUmVnnnooSo+S+DoDxS+T+xT+U+`n`xU+V+\m\xVDdodxS S S T T, 8S  AT runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/sys/usr/include/powerpc64-linux-gnu/bits/types/usr/includeruntime/camlunix.cstddef.htypes.htypes.hclockid_t.hstruct_timespec.hioctl-types.hstdint-uintn.hstdint.hconfig.hstruct_stat.hdirent.hmisc.hmlvalues.hmemory.hplatform.hlibgen.hstdlib.hmman.hunistd.hioctl.htime.hdirent.hstring.hdlfcn.hosdeps.hstat.herrno.hsignals.hconfname.h / g/J w 3. &z 3<z / g/ ./J .,22K s..!2?.,<.  "==! u = < << .n  .i !O !O<!X /(!.  = -! vtZ""p0 0 :!<! /! 0"% ".0$z..t. J < [[/ #<H  /<k ,t ! /  = s ==/w =/wz.   *.  =/$txn/K >!1! !f(  %1K.K. ".(.2.v  < := !< w >.w %3=). u  u  k #!*2 !./ & p 3!3/1..01 !y $. T 20 # 1.,JX.(J!U(X../ R..<<[J3M 3JM.21w=.0Wu'YX<..<<  ."fY ..! .= /!!{y '!0/ 0K 11%. <y.J _SC_LEVEL3_CACHE_SIZEcaml_stat_stringst_ctim_SC_INT_MAXsize_t_SC_MAPPED_FILES_SC_CHILD_MAXsecure_getenv_SC_CLK_TCKst_blksizest_blocks_SC_SIGQUEUE_MAX__ssize_t_SC_THREAD_ROBUST_PRIO_INHERIT_SC_DEVICE_IOrootcaml_write_fd_SC_LEVEL4_CACHE_ASSOC_SC_JOB_CONTROLfullname_SC_CHAR_MAX__gid_tpathwrite__clockid_tst_mtim_SC_TRACE_INHERITcaml_plat_pagesize_SC_XOPEN_VERSION_SC_GETGR_R_SIZE_MAX_SC_PII_SOCKET_SC_SAVED_IDSws_ypixel_SC_SCHAR_MAX_SC_ARG_MAXstat_SC_TIMEOUTS_SC_CHAR_BIT_SC_AIO_LISTIO_MAX_SC_MB_LEN_MAX_SC_THREAD_PRIO_PROTECTdirname_SC_PII_INTERNETnot_found_SC_THREAD_PROCESS_SHAREDssize_t_SC_TRACE_NAME_MAX_SC_PII_SC_AIO_PRIO_DELTA_MAX__dev_tcaml_search_exe_in_path_SC_MEMORY_PROTECTIONcaml_secure_getenv_SC_OPEN_MAX_SC_THREAD_THREADS_MAXcaml_leave_blocking_sectioncontents_SC_READER_WRITER_LOCKS_SC_STREAMScaml_decompose_pathlong int_SC_MQ_OPEN_MAXunit_SC_FIFO_SC_DEVICE_SPECIFICuintnat_SC_2_C_VERSIONcaml_plat_mmap_alignment_SC_THREAD_ROBUST_PRIO_PROTECTcaml_num_rows_fd_SC_BC_DIM_MAXcaml_stat_strconcatcaml_time_counter_SC_THREAD_ATTR_STACKADDR_SC_V7_ILP32_OFF32_SC_UINT_MAX_SC_V6_ILP32_OFFBIG_SC_2_PBS_LOCATEsigned char__blksize_t_SC_LEVEL1_DCACHE_LINESIZEst_uid_SC_TRACE_EVENT_FILTER_SC_NL_LANGMAXcaml_plat_mem_commit_SC_V6_LP64_OFF64_SC_NL_MSGMAXunsigned char__int128 unsigned_SC_PII_OSI_CLTSst_rdevcaml_globalsym_SC_LEVEL1_ICACHE_ASSOC_SC_DEVICE_SPECIFIC_R_SC_NZERO_SC_XOPEN_XPG2_SC_XOPEN_XPG3_SC_XOPEN_XPG4caml_plat_mem_unmap_SC_ULONG_MAX__syscall_slong_t_Bool_SC_XOPEN_ENH_I18Nd_typemmap64value_SC_INT_MINchar_SC_2_UPE_SC_PAGESIZE_SC_FILE_SYSTEMcapacity_SC_2_VERSIONd_name__errno_location_SC_RE_DUP_MAXcaml_init_os_paramslibname_SC_LEVEL3_CACHE_ASSOC__mode_tflags_SC_2_FORT_DEV_SC_CHAR_MINprot_SC_IOV_MAXstrcmpcaml_dlsymstat64_SC_THREAD_CPUTIME_SC_SYSTEM_DATABASEmmap_SC_PII_INTERNET_DGRAMcaml_plat_mem_map_SC_FILE_LOCKINGcaml_ext_table_add_SC_SCHAR_MINcaml_search_in_system_path_SC_UIO_MAXIOV_SC_VERSIONcaml_search_in_path__blkcnt64_t_SC_SPIN_LOCKSrealpathclosedir_SC_LEVEL1_DCACHE_SIZEst_gid_SC_RAW_SOCKETS_SC_THREADS_SC_THREAD_SAFE_FUNCTIONS_SC_WORD_BIT_SC_REGEXPreaddir_SC_ASYNCHRONOUS_IO_SC_CHARCLASS_NAME_MAX_SC_LEVEL1_DCACHE_ASSOC__dirstream_SC_LEVEL3_CACHE_LINESIZE_SC_THREAD_STACK_MIN__uint64_tlong unsigned int_SC_XOPEN_UNIX_SC_NL_TEXTMAXmunmap_SC_PII_INTERNET_STREAM_SC_SIGSTKSZst_sizecaml_read_fd_SC_V7_ILP32_OFFBIG_SC_SEMAPHORES_SC_LEVEL4_CACHE_SIZE_SC_MINSIGSTKSZ_SC_MULTI_PROCESS_SC_NPROCESSORS_ONLNuintptr_tcaml_dlopen_SC_USER_GROUPS_SC_2_LOCALEDEFws_xpixel_SC_LINE_MAX_SC_PHYS_PAGES_SC_XOPEN_REALTIME_SC_MQ_PRIO_MAX_SC_SIGNALS_SC_MONOTONIC_CLOCK_SC_RTSIG_MAXruntime/unix.c_SC_FILE_ATTRIBUTES_SC_USER_GROUPS_R_SC_XOPEN_XCU_VERSION_SC_PII_XTI_SC_XOPEN_REALTIME_THREADSGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long int_SC_XBS5_ILP32_OFF32_SC_LONG_BIT_SC_XBS5_ILP32_OFFBIGext_tabledouble_SC_UCHAR_MAX_SC_PIPE_SC_TYPED_MEMORY_OBJECTS_SC_LOGIN_NAME_MAX_SC_THREAD_KEYS_MAX_SC_ADVISORY_INFOdlopencaml_stat_strdupreadwinsizeunsigned intstdlib_defaultioctlintptr_t_SC_COLL_WEIGHTS_MAX_SC_PII_OSI_M_SC_2_C_DEV__pad2_SC_SYSTEM_DATABASE_Rreserve_onlycaml_sys_const_shared_libraries_SC_TRACE_EVENT_NAME_MAX_SC_USHRT_MAX_SC_IPV6_SC_HOST_NAME_MAX_SC_BC_STRING_MAX_SC_THREAD_PRIORITY_SCHEDULINGdlclosedirent_SC_POLLagainexe_name_SC_2_SW_DEVst_nlink_SC_REALTIME_SIGNALS_SC_XBS5_LPBIG_OFFBIG_SC_2_PBS_ACCOUNTING_SC_THREAD_DESTRUCTOR_ITERATIONS_SC_TRACE_LOGlong double__ino64_t_SC_MEMLOCK_SC_PII_OSI_SC_DELAYTIMER_MAX_SC_2_FORT_RUN_SC_V7_LP64_OFF64_SC_NPROCESSORS_CONFresolved_candidate_SC_SHRT_MAXopendir_SC_AIO_MAX_SC_BARRIERS_SC_REGEX_VERSION_SC_LEVEL2_CACHE_LINESIZEst_devtimespec_SC_SHARED_MEMORY_OBJECTSsize_SC_XBS5_LP64_OFF64long long unsigned int_SC_V7_LPBIG_OFFBIG_SC_NL_ARGMAXcaml_stat_block_SC_SINGLE_PROCESS_SC_SS_REPL_MAX_SC_AVPHYS_PAGES_SC_XOPEN_SHM_SC_THREAD_SPORADIC_SERVERreaddir64ws_col_SC_NL_NMAXcaml_ext_table_add_noexc__time_tclockid_tcaml_dlclose_SC_XOPEN_LEGACYcaml_failed_assert_SC_2_PBS_MESSAGEws_row_SC_SEM_NSEMS_MAXchar_os_SC_T_IOV_MAX_SC_PRIORITIZED_IOglobal__int128__off64_t_SC_V6_ILP32_OFF32_SC_STREAM_MAX_SC_TZNAME_MAX_SC_2_PBS_CHECKPOINT_SC_SPAWN_SC_MEMLOCK_RANGE_SC_BC_SCALE_MAXsysconf_SC_TRACE_SYS_MAX_SC_SYMLOOP_MAX_SC_2_CHAR_TERM_SC_SHELL_SC_FD_MGMT_SC_XOPEN_CRYPT_SC_LEVEL1_ICACHE_LINESIZE_SC_C_LANG_SUPPORT_Rname_SC_TRACE_USER_EVENT_MAX_SC_TIMER_MAXdlerror_SC_2_PBS_SC_CPUTIMEcaml_dirname_SC_SPORADIC_SERVERcaml_enter_blocking_section_no_pendingshort int_SC_CLOCK_SELECTIONuint64_t_SC_NETWORKINGcaml_plat_mem_decommit_SC_LEVEL4_CACHE_LINESIZEtv_nsec_SC_ATEXIT_MAXd_offdlsym_SC_PII_OSI_COTS__glibc_reserved4__glibc_reserved5__glibc_reserved6_SC_SEM_VALUE_MAX_SC_C_LANG_SUPPORT_SC_TIMERS_SC_PASS_MAXcandidate_SC_FSYNC_SC_SELECT_SC_TTY_NAME_MAXd_reclencaml_read_directorycaml_locate_standard_libraryalloc_szst_mode__uid_t_SC_MESSAGE_PASSINGmap_fixedd_ino_SC_LEVEL2_CACHE_ASSOC_SC_BC_BASE_MAX_SC_LEVEL2_CACHE_SIZE_SC_EXPR_NEST_MAX_SC_SYNCHRONIZED_IO_SC_XOPEN_STREAMScaml_stat_free_SC_SHRT_MINcaml_dlerror_SC_2_PBS_TRACK_SC_NGROUPS_MAX_SC_V6_LPBIG_OFFBIGfreeshort unsigned int_SC_LEVEL1_ICACHE_SIZE_SC_EQUIV_CLASS_MAXhandle_SC_BASE_SC_PRIORITY_SCHEDULINGclock_gettime/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beintnat_SC_SSIZE_MAX_SC_GETPW_R_SIZE_MAXst_ino_SC_THREAD_PRIO_INHERIT__nlink_t_SC_TRACE_SC_NL_SETMAXtv_sec_SC_2_C_BINDretcodest_atim_SC_THREAD_ATTR_STACKSIZEGCC: (Debian 13.2.0-18) 13.2.0zRxA (xC ACCA~KFA0DC ADCA~Y GAA @xADB AAABA~cAADAAAD\C AEA~Q GAD DACBBb AAAAB AAAABAEA,lB ACA~E CAC DCAL$`lDpA~F BAD EBA0CpA~CBA0CpA~CBA8EpA~CBA0CpA~CBA08C ACA~r FAB DFA<0CpA~CBA\PDA~GDA |dFA~H CAC LDpA~GDA`KpA~CEA$\F ACA~CEAB@GpA~CBA$(hCpA~E BAB HBAPPxB ACA~DNEDADA~AAg AAACAA DAA   x<A]k|0H `l#>x^lcj0ow0|808 08P Pd*0C\hLpx`\@hxunix.ccaml_read_fdcaml_enter_blocking_section_no_pendingreadcaml_leave_blocking_sectioncaml_write_fd__errno_locationwritecaml_failed_assertcaml_decompose_pathcaml_stat_strdupcaml_ext_table_addcaml_search_in_pathcaml_stat_strconcatstat64caml_stat_freecaml_search_exe_in_pathcaml_search_in_system_pathcaml_sys_const_shared_librariescaml_dlopencaml_dlclosecaml_dlsymcaml_globalsymcaml_dlerrorcaml_read_directoryopendirreaddir64caml_ext_table_add_noexcclosedircaml_secure_getenvcaml_time_counterclock_gettimecaml_num_rows_fdioctlcaml_plat_pagesizecaml_plat_mmap_alignmentcaml_init_os_paramssysconfcaml_plat_mem_mapmmap64caml_plat_mem_commitcaml_plat_mem_decommitcaml_plat_mem_unmapmunmapcaml_locate_standard_librarydirnamerealpath$ 8 D     .222:0>0@    2028"08.00X h  ! D $ $  & <( t( + - . p / 0  0 2 T4 6 : 2@"2&@|< < ,< \@ 2 2@ 0 0@   X dB l | 28 08  C   D  &3& 30&`83H&`P3`&h3x&p3&3&3&03&`3&3&3 &(38&@@3P&X3h&p3&P3&3& 3& P3& 37&8&   C &* 1v6;D CR Yu`KqU};  8H(W x;".: Pr\h`ty& L Z  $ %Y28? L@Yf]s l {G'Zl~ I$*S0o6"<B=HLNTZ`flrx~BzP i d K  u & d,28>D JPV \ Jbh nt=z " zsI[ t# TF g #G  ?X" ( q.4.:@tF L URX"^djpZv|/I  $t o-S k d  $*06 < (B {H NTZ`fklGrx~ 2 q  >%- p'Z  ; : a 1&,28>VD[J*PV\2b hantOzg^Ft?    }da  V z2"(. 4 ; InV=cp5} 5 C    $ 5a @ K5 aF t4  s n <    2a I= d_ .  B  Y C   - C U \@ ~!     5  ! B H S& j u  y  ~ C 7 5  t L        "  & P & P  <  8 " R & N / e 3 a 8& ` Q& l i& t v& & &8 & & & &  & 5& (JwZ0{& P x t  & d& &@&& 8 < AL P Y& b <n r {    & 4&    & " < 8%&. ': P> NG ]K YT sX o]&d&P   )  7  / 3 8&pv&&&  &5&@7&\Q\&~  &$&5  5 7 - g a  } &* . 3& K&xX&p&&&&&&t&`-# ' 0&h9 E I R V [&|w5-&  & .&   $ @( 8-&M&a 6k&p g c&-  y  &&L &`+05 9 >-H  L [ N_ Ldn `r VN&    &  &`&p&&#b-&`N R W0a e r @v : ^ V } {&&&      , 0 5? C H M&V&c&p&&&H&& & < 6 S O g$ a1 5 z:D H M&,Z&@~&L&0    &D&c&&H|`` Ppd0` @`@P  , PT .symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.toc.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ 8 @``H& x, x6 x1@f;2 pBO J@j0Y T@j9x e'&s+30@@03W4E@p00| H@L,_|)PA=")), @H}=*=BJ|)PA4q(@,=|)@@@h=|)@@@T8!N ``|<xc 8H`|KH`` ,A,=)U)|(H@}]*\K yy$}(HPK``|<Ax9!pa9A89>9!xAx!pHaxH8!8`|N `<AIUJ>| 8AixcH`aaxHA<|{P*|#HaA pi|ix@C, ATC;, @tcxcx$}?HP!K\``I>})Rxy6A} CxK``=")), A,j8,)A|dx8}#KxH`aaH`aH`:a8!p!Aa|N ```8`K<| P@=, AD=^;~})Rxy)@ =( Aĉ=8;, @=y6Bz$xjxxH`,7APH$```x:H`;;y)|6H@@8=")|*), A8~xH`K!|JK`>y6z$xKT<a07, A |9@A6A0:|P~??{{$z$;;`:8`H```(A8c=| H@L,\|)PA!};J|*|(@L,<|%HA$x~x:H,6:@t0|8`A8! !aN ```;?B}?{9$;;Z`!{$8`JH```(A8c=| H@L,\|)PA|*|(@L,<|%HAx~x;H|;@;9@x08`|A8! !aN H7a, @H|9@@K`xxc H`K,```Dxxc H`K ```8`H``8c|(@L,<|%H@(@Dxxc H`K`8`H``8c|(@L,<|%H@(@xxc H`K|<ptr == tbl->limitephe_ref->offset < Wosize_val(ephe_ref->ephe)is_marked (child) || is_not_markable (child)offset >= CAML_EPHE_FIRST_KEYIs_block(from)Is_block(to)Tag_val(from) == Tag_val(to)Tag_val(from) != Infix_tagWosize_val(from) == Wosize_val(to)Weak.createWeak.setWeak.getWeak.checkWeak.blitcaml_ephe_await_key4G U:Vint [8T ,`W  W` Z: lI mIJ   0: *:  $XO.>|b     XY?NT8?2?9;Y<>?|Bu 0 *:?Z" fiff"f%f (p(+0.82z@6H9fP=fXA`ChFpIxLPT[`rtwy{[}eji H(%0t8[idH@HHPyXy`hpxHf ' k' u p!EFGy8H p ' !@    !0#[$ * /H7 ; )  ' ` ' o' ' !@%jmpA~BC ' @& +22 @*0`*:?KF L! HL" \W*:@FFK.~]buf/W d>|   ++2+3!85@5@%end5@5@%ptr5@5@ 5%(5%0 f!7y8 9 : !8<<%end<<%ptr<< <%(<%0 E!> ? %mem@ %maxA !8C C %endC C %ptrC C C%(C%0 :0f *:D!E F F F +H! >|K ^++J8 M9 f: _ AOAHAO8 M0 *:B! M & M ' C,  (+   .(?  ( 5  `"(, X  C/ t  C^ y(: ($  ad Obe O H (=  H .(a & %c| B | B  es& ofs0 ed ofd' len2SSTTUUVVWW  es + ed 5dv / //)N/5/A/M1/X&3,3V/6//)/5/A/M1/X3S,YST1U XvTU0 S T U x es* ofs4 ed* ofd4 len?   3c=3s 3333c=-3s 333 SF:-!`lex~///)/5/A/M1/X&31@41[1O1e1q"14221,2" &T111112+2G2;2Q2[2\2hO1@PU 1[ 1O1e1q"14M221,2" &T 11111,STf1@1[1O1e1q"14221,2" &T111112+K2G2;2Q2[V2\2hO1@PU 1[ 1O1e1q"14221,2" &T 11111,ST///)/5/A/M1/X&3 S T U  S Pes$21ed$212DHDDEi`DEi`# $ e,SST1LQ e' n0Q law3c13s 333)3SSTT1&# S 3e+n4 F e&G2-H7vP-~HQ[.tTT S T U  e/SST1@ e*%SST1Lm e* n3m }3c1+3s 333)OSSTT1&# S 3e.n7 Fh# eh)Gh5jj-j~jH7resk7valk-k-k~kHl foutg93c&3s3333cz 3s 3333c 3s 3333cB3s 333,3V ######3cQ 3s 3333cQ p 3s 333# #$ $ $ S:3Va  XSTU03c_![ 3s 3333cT ! 3s 333G!ST "S T U Q ";S T U P "nS T U ^ "S T U M "S T U O S T U N& .#*T X#AU0& & 5 #S T U j S T U hI $$2I(toI4EiK ^#` #cc@L%R ar@% n@/%RB %m%b%x3c:1%3s 333)%%4SSTT1&# S 37%e7)n729 F"'Y e"$G"0$$-$$H7res%H7elt%@-%~%HQ&l4,3V- .&TT X&U0 =&ST0& 5& 5 ')S T U $ S T U .' e,i' ('*SST13( e*el3x*R ar% n/ el8*R *x*m*b*R )Q*x*m*b* **** S * *** ****3c1*43s 333*TT1&#3 *e 'n 0el 93*e+n4R*e)n2el; j,4e$S04el>5B5H9+5.+T,+T S T Uk .4e S,4val:;fp9,5.5.<......"3.u3=323&3I3c~-3s 3333Dr.-3&323=3I S T U~ t.ES8 S T Uw S T U =.e,68vF#.old = /e 6,l/yv H .hd m#.i#.f= /e&62.elt H[/4len[(/SSHDp04lenD(5F ;resG H9x0;iU 0ST&  0S T UH S H:[X1@;e<[ S0R2162!i2/4|4|B4 n1 #.v5 #5.510[1*:81P|2"23|23|locI Bo(/Q2v6Q"iQ0.vS #S .S 2v/eH2ve'/aH2va!/]H2v]#/QH2vQ&sQ0 /MH3hdM(sM3 =r3VtblrE ars/6s<upH/+3val8# 3 i/;//)/5/A/M1/X"3c4L3s333/`8/a/k5/l"35 3= 323&3I"3r53& 32 3=3I STU~3c~5|3s 333 t5S8 S T Uw STU"2+ 7$2G 2;2QT1@U 6 1[ 1O1e1q"146221:2" &T111112[2\2h2 862$2^ 223cR 73s 333$2R 33$3c23s 33329 2$2b 2 23cR 9R 3s 333$2R 332}: 2$2f 2 23cR :L 3s 333$2R 333c2:3s 333 S T U.>./. ;/.$///)/5/A/M1/X3SS</y///T1@= 1[ 1O1e1q1<1111<14221:2" &T 2 > 2$2^ 2 23cR = 3s 333$2R 333c+>r 3s 333 S T U1@?1O1[1eq1q1?+1111<14221:2" &T /$?//)N/5/A/M3SS*L@****3c1@3s 333)*@SSTT1&#UU S *TB *** * ***3c1A3s 333)*ASSTT1&# S *RxC*b*m*x*R B*x*m*b* **** S * *** ****3c1C3s 333*TT1&#'DP'(*SST1UT%RLE6%b%m%x3c:1D3s 333)%ESSTT1&# S mLF}3c1E3s 333)FSSTT1&# S QLGalw3c1F3s 333)FSSTT1&# S rI~1B41BH} : ; 9 I8  : ; 9 I 8  :!; 9!I!841 1  !I :!;9 IB 1 I UH}: ; 9 I: ; 9 I$ > 1RBX Y W : ;9 I1RBX!YW 4:!;9 IB4:!;9 I4: ; 9 I 1U1RBUX!YW .?:!;9!'I@zH} 1U1RBUX!YW .1@z ( ! : ; 9!"1RBUX Y W # $1RBX Y W % : ; 9 I8 &H}'<(.?: ; 9 'I<)H}*!I/ +4: ; 9 I?<,1RBX YW -4:!;9!I.4: ; 9 I/.: ; 9 'I !0I1 12: ;9 I3.?:!;9 'I !4:!; 9 IB54:!; 9 IB6: ; 9 I74:!;9!I8&I9 :1RBUX YW ;4:!; 9 IB<1RBUX!Y W =.: ; 9 ' >>! !I: ; 9 ?:!;9 I@: ; 9 I A :!;9 I8 B4:!; 9 IC.?: ; 9 '<D E4:!;9 IF.:!;9!'I@zG:!;9 IBH.?:!; 9 'I@zIGIJ : ; 9 K !!: ; 9!L :!; 9 I8M4G:!; 9!N41!O1X!Y W! P.: ;9 'I Q UR.?:!; 9 'I !S:!; 9 IBT1UX Y W U% V$ > W X&Y5IZ  : ; 9 [ : ; 9 I 8\I ] : ; 9 I 8 ^(_ : ;9 `.?: ; 9 '<a.?: ; 9 '<b.?: ;9 '<c.?: ;9 'I<d4: ;9 IBe41f : ;9 g : ;9 h.: ;9 ' i1RBX YW j.: ; 9 'I@zk.: ; 9 '@zl.?: ; 9 ' m : ; 9 n4I4o.: ; 9 ' p.: ; 9 'I q41r.?<n: ; $99S9:S99T9:T99U9:U99V9:V99W9:W88S88n89S99S99n99S88T88o89T99T99o99T89n99n88S99S99n99o990/0S06S67S77qh77S77S77S/0T06T67T77T77T77T/0U06U67U77qp77U77U77U/0V06V67V77V77V77V/0W06W67W77W77W77W/1i13T1&#33i34T1&#45i56T1&#67i///0j01h12j23V1&#33h34V1&#45h55j56V1&#66j67h77/1m13W1&33m33~34W1&45m56W1&67m//S//sx//Y//U//ux//Y01m12W1&33m33~34W1&45m56W1&67m00j01h12j33h34V1&#45h55j56V1&#66j67h00U67U77qp01i12T1&#33i34T1&#45i56T1&#67i00S67S77qh02n34n46n77n06077000S44S0203607700112f2222f55f66f77f7711i55i11m1111011S55S12 55 66 11 55 11 55 11S55S11Y11Y55Y11m11m55m11Y11Y55Y22 T1&"#66 T1&"#22Y226622U66U22m66m22U66U66S66 66 66 66 66S66S66U66U66m66m66U66U34 V1&244 tV1&244 V1&356 V1&233h55h3333033S55S34 56 33 55 33 55 33S55S33Y34Y55Y33m33m55m33Y34Y55Y44T1&V1&"56T1&V1&"44m445544U55U44m56m44U55U56S55 66 55 66 55S66S55U66U55m56m55U66U55S550..S..S..S..S..S..S..T..T..T..S..S..S..S..T..T1&#..T..T1&#..S..sx..YS S q#0To T T T !o n 0 0 S--S--S--S--S,,S,,S,,S,,S,,T,,T,,T,,S,,S,,S,,S,,T,,T1&#,,T,,T1&#,,S,,sx,,YSSq#0TmTmTmTmTiii000000o00SyxSSXxxZZZ8YmmXm0ff0f0f0mxYkZZTfTkYkY++S++S++S++S++T++T++T++S++S++S++S++T++T1&#++T++T1&#++S++sx++YSSq#0ToTTToTkkk0000HSHS**S**S** **S**S))S))S))S))S))T))T))U))U))U))U))U))U))U))U))T))S))S))S))S))U))U))T))S))U))T))S))T1&#))T))S))U))T))S))T1&#))S))sx))YSSq#0TmTTmUUq#@o01SnSSnSnTmTTmTTmUoUUoUos"" T3$" T3$S"s""s""" T3$" T3$S"o T3$S"UoUoUoTmTmTTmSnSnSnXXXXmmTnn88ny8xh8Y8nm&&S&&S##S##o#%S%%S%%o%&S#$S$%%%S1&#%%S%&$%S$$1$$&1#-(w#$$$1#-(w$$&1#-(w#"#SS n S n S nYoYoY Y Y yz Y o Y Y01 0:% j j :%j jSsxj j2` ` 2oo o8 8 8yzhlY` `YoYxY Y Y Y yz Y S       S S Y Y c c Y Yc cYoYxY Y Y Y yz YYZYYyxYZY Y yx Z X yx Z X Z   yx Y   Y Y yx Z S S S lSlSl T T T m TTm 1 S S S S 0 m TTTTm S lllSlY SS Y YY T3$" T3$" T3$" Y YY        S SSXyxYXYyxX!!S!"S!!T!"T!!0!"Y!!S!"S!!o!!o!! T3$S"!"o!!S!"S!! !" !! !" !!Y!"Y&&S&&S&&S&&S&&S&'S&&T&'T&&U&&U&'U''U&&T&&T1&#&'T''T1&#&&S&&sx&&Y''S''S''S''S''T''T''U''U''S''S''S''S''T''T1&#''T''T1&#''S''sx''Y((S((S((S((S((T((T((U((U((U((U((U((U((T((S((U((T((S((T1&#((T((S((U((T((S((T1&#((S((sx((Y**S**S**T**U**T**S**S**S*+S**T*+T**T**T1&#**T*+T1&#**S**sx**Y+,S,,S,,S,,S++T+,T+,T,,T1&#,,T,,T1&#++S++sx++Y--S--S--S-.S--T-.T--T--T1&#--T-.T1&#--S--sx--Y, L                             !!!!!!!!!!!!!!!!!!""!!!!''''''''(((((((((((((((((((((((((((((((())))))))))))))))))))))))))))))))))))))))++++++++++++++,,,,,,,,,,,,,,..............///23447///002344700004402556711111155111155111111111111112267112222666766662244345633335533335533333333333333445633444455665666455588888899, runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/include/powerpc64-linux-gnu/bits/typesweak.cminor_gc.hmlvalues.hplatform.hweak.hshared_heap.hmajor_gc.hstddef.htypes.hstdint-intn.hstdint.hconfig.h__sigset_t.hmisc.hdomain_state.hdomain_state.tblmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdatomic.haddress_class.hstring.halloc.hsignals.h t //k t. XY .!.=J).    K!><#!!!!+>  @ .  '/. d.J} . !<    <.tx+)< U +  ^, ,X& .Tt&,J  &~..kJD <} !&,.Xt K .!<0 fH    /!> /!!!+>  @ ."<!    / !  /)<C<)= ? !! .Y& tX = <X s<+     /!5k , < ! .//'J <~<J }J}/3 ...)~+   2q /  CJ Y<x<  #.XY @ o<+    .k+    uf !)^+  2 /   f ,H.J0@  < t/ }J} <.>!J3.XX.f  .JX}=Q s<+    >/!& $ +1  +M (  <y   J=!!//..ZL"!K J.7   J/X=///!. !!;!"! $;!0! " ,""#}.=..= K !#/ ...vX (/ ...of  X Xt;=/=g!. /I/-!  Jw ! 2 N g!J. / X+~   . / ! U= " " "$ &z &Cp  /+~   ! +~X  +  ) ~.<} . =. . Y  !  T./ / .X B.  X6.   !/ K=+~  + . 0? Y  $.%M% /! N!. +~    }. .!}=X.<+~   '<* tL<t%to.t"=!!/!. />/#;/"!!.!.   JzX  X|X" !"f/ }J}><<  ...}"0/ !u%?%#%#%1 0 #!Z ?+!! ".Y./7.. !7..!.!7. /.!7.7-.7-.7-.# /X%o<.X4 <<   6<.Jf" "+.  1$ 1 $ 2.Pv   t.""+.  1$ 1 z &z.. fq "  !r  n  +  1$ 1 J vx (t.  u  u.txq "  !ur  n  +  1$ 1 J vx (t. l  l.t ! \y JJ" !+.  1$ 1 # 1.Pw "!+.  1$ 1 z &z..J" !+~.  1$ 1 # 1.5Ox "!+~.  1$ 1 5 5%). J .j .f" !+}.  1$ 1 # 1.Pw "!+}.  1$ 1 z &z.. J . f!&!!0## +}   2= & M+}.  2= & ^J%.[ .. ." <}.}  <4 !. X f| | ! J}/ }J < | |    K .(,"(!f.r <  J<|-!X}/ }J < | |  .= .,"#<w.  b} } <J ..J ..J}J }K,}3 ...}J }K,}3 ..     XJ   .. X}J} .}<< !K|= <.NXJ v}tt X  caml__roots_escaml_weak_blitc_stack_linksize_tallocated_words_resumedmark_stackrelease_datamemory_order_acquiredependent_sizeephemeron_againcaml__temp_offsetcaml_plat_spin_stepbacktrace_slotephe_infocaml_allocmemprofcaml_process_pending_actions__func__caml_alloc_ephe_infocaml_ephe_get_keyextra_heap_resourcescaml_ephe_blit_datacaml_ephe_await_keyshared_heapcaml_heap_statemax_spinsblockcaml__dummy_vrequested_major_slicecaml_ref_tableUNMARKEDHas_status_hdepheslice_targetheader_tcaml_minor_heaps_endcaml_custom_tablestat_promoted_wordscaml_marking_startedlong intlocal_rootstrap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_ephe_set_keycaml_intern_statestat_blocks_markedcopycaml_final_infomemprof_domain_scompare_unorderedcaml_minor_tablesntables__atomic_store_tmpsigned chartrap_sp_offNOT_MARKABLEunsigned char__int128 unsignedbacktrace_last_exncaml_custom_eltcaml__temp_valcaml_statefinal_infocaml_ephe_createPhase_mark_final_Boolfromvaluecaml_gc_policycaml_ephe_unset_datacharephe_get_fieldcaml_ephe_ref_tablecaml_process_pending_actions_with_rootcaml_plat_spin_back_offcaml_stat_alloc_noexcextra_paramscaml__roots_e__builtin_memcpymemory_order_acq_relmajor_work_done_between_slicescaml__roots_vPhase_sweep_and_mark_mainextern_state__jmp_buf_tagyoung_startcaml_alloc_smallfilesweeping_donetablesreservecaml_exception_contextcaml_global_heap_statefunctioncaml_weak_get_copycaml_invalid_argumentcaml_weak_createoo_next_id_localminor_heap_wszHas_status_valcaml__framelong unsigned intcaml_ephe_lockedcaml_ephe_get_datastatusoffset_ddependent_allocatedoffset_sslice_budgetexn_bucketlinelongjmp_buffercaml_weak_getruntime/weak.c__mask_was_saveduintptr_tyoung_endcaml_alloc_someexternal_raisesomecaml__1000_52c_stacksigjmp_bufcaml_weak_checkspinsgc_regscaml_realloc_ephe_ref_tableGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecaml_ephe_nonetrap_barrier_blockGARBAGEcaml_ephe_infomemory_order_consumememory_order_seq_cstdoublecaml_minor_heaps_startchildgc_phase_tcaml_extern_statememory_order_releaseswept_wordsthresholdcaml__temp_resultunsigned intcaml__roots_blockintptr_tgc_regs_bucketscaml_modifyrequested_external_interruptPhase_sweep_ephecurrent_ramp_up_allocated_words_diffcaml__dummy_ecaml_ephe_blit_keyatomic_valueMARKEDoffset__saved_maskmust_sweep_ephe__jmpbufephe_modify__jmp_buf__atomic_store_ptrcaml__dummy_esnitemsallocated_wordsnextyoung_limitlong doublePhase_sweep_maincaml__spins_52Ephe_keycaml_darkencaml__dummy_resunique_idallocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustommemory_order_relaxedcpu_relaxlengthcaml_stat_blocklivecaml_ephe_set_datacaml_ephe_get_data_copyallocated_words_suspendedephe_refinside_stw_handlercaml__roots_resdomain_state__atomic_load_ptrmemsetcaml_failed_assertfieldchar_osclean_field__int128backtrace_activeis_not_markablestat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policyephe_blit_keystodocaml__loc_52global_heap_state__atomic_load_tmpcaml_alloc_shrcurrent_stackatomic_uintnatshort intcaml_ephe_get_key_copyrequested_global_major_slicecaml_ephe_set_key_optionis_unmarkedatomic_intnattodopcaml_ephe_check_dataextra_params_areatag_t__valexn_handlercaml_weak_setephe_check_field__int64_tcaml_plat_srclocextra_heap_resources_minormemcpyyoung_ptrephe_write_barriercaml_local_roots_ptris_markedcaml_ephe_unset_keyasize_tweak_dummydls_rootmlsize_tstack_infoinfix_offscyclestat_minor_wordslockedcaml_ephe_check_keycaml_ephe_cleanephe_set_fieldshort unsigned intephe_copy_and_darkenadd_to_ephe_ref_tablebasemajor_refintern_stateHd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beparser_traceint64_tintnatcaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tcaml_gc_phasedo_check_key_cleancursorephe_get_field_copymajor_slice_epochGCC: (Debian 13.2.0-18) 13.2.0zRxA lCDMGL AAA~GAKADCBCAA~HAA AFA~DAAAC A AFA~EABBD AAABABA C A C ACA~BB ACAAAAAAAAAAAAAAAAAABC A~nAAAAAAAAAAAAAAAA[ AFA~DA<TJEj DC A ADA~DAX AFA~DA,C AGA~Z FAB @C ADEA~{ GAB F GAC DC AG GA~o LAD ,PC AGA~b EAC ,BDQ BC A ADA~EAXDpA~LBA,pC AGA~{ EAB $(LNpA~@TPpA~XxYpA~pxYpA~LNpA~LNpA~LNpA~LNpA~$8LNpA~PLNpA~h|xABCCHIACV AA DA~F C pAAAACAAAADD A~m CAAAAAADA J H\ SAA AFA~EAA A~AAAAA AB A B AAAAA~,PC ADCA~V FAB +07HF`Uxi z     4BN_|Xp 0FW$g Ly8TPxhxLLLL&9(Q@LeXLupx  weak.cephe_modifycaml_ephe_clean.part.0clean_fieldephe_set_fieldephe_get_fieldephe_get_field_copyephe_check_field__func__.0weak_dummycaml__loc_52.1caml_minor_heaps_endcaml_minor_heaps_startcaml_statecaml_realloc_ephe_ref_tablecaml_failed_assertcaml_global_heap_statecaml_plat_spin_back_offcaml_gc_phasecaml_darkencaml_alloc_smallcaml_process_pending_actionscaml_alloccaml_alloc_somememcpycaml_modifycaml_ephe_await_keycaml_alloc_ephe_infocaml_stat_alloc_noexccaml_ephe_createcaml_alloc_shrcaml_process_pending_actions_with_rootcaml_invalid_argumentcaml_weak_createcaml_ephe_cleancaml_ephe_set_keycaml_ephe_unset_keycaml_ephe_set_key_optioncaml_weak_setcaml_ephe_set_datacaml_ephe_unset_datacaml_ephe_get_keycaml_weak_getcaml_ephe_get_key_copycaml_weak_get_copycaml_ephe_get_datacaml_ephe_get_data_copycaml_ephe_check_keycaml_weak_checkcaml_ephe_check_datacaml_ephe_blit_keycaml_ephe_blit_datacaml_weak_blitcaml_ephe_lockedcaml_ephe_none&2*@:2>@n Zr Xt C! "2(&2@.0(20@4" F2(J2XR0(V0X\" 2200"  Z X22(2X"2&2.24 CZ0^0f0(j0Xn0r02@! z2~@" 2@2@*2.@$ " 22(62@>0(B0@D" 2@2@2@2200" 62:@z2~@ 202@2@*2.@>2B@v2~0$ 2@2200 " > ZF XL C 0 2200"  Z * X 4 C  0 2 @ 2 @ C & ' ( T( 2 2 0 0 " 2 2 0 0 "  Z  X ( C 2 0 )  0 2 @ C & * ( J2 N2 V0 Z0 \" C + (, F2J@h& 2200" 228008" 2200" 2200" &2*220608" F2J2R0V0X" f2j2r0v0x"  Z X C 02"@b2f2n0r0t" 2020$ P/  Z X C1 202 2200" 2`0`3 0 "2&@4 p Hz2p~0p3 2@ H2p0p3 0 HF2J@V2pZ0pd3  H2@2p0p3  H"2&@, H` `j2n0x3  `203  x 203 P xZ2^0h3  ` x 203 0 :2>0H3 d  Z X CV2Z@22000 2200, x  $ $  $ p$ 2200" 203 2@D V ZZ X\ Ct&   2200" E &&#&%&&3& 30&p83H&0P3`& h3x& 3&3&3&@3&3&3& 3 &P(38&@3P&X3h&p3&3& 3&@3&3&3&03&3(&03@&H3X&`3p&`x3&3&3&3&&&& ]&*/+=0DW%cSj q _xf A   %   &p> "D^JbPV\sej v q     S& 4EBP ^ l z 3 .\Jg >  "20 x>L ZLh\v  *  / r J ,rF R^5j vwv*I* K Mh*46BN \Zlv?  J  N& 7uO ' X4 AN1ap~|\ 7 ,9 X;e k g:y& 3|FR_ lz9:y |  ': A [y h u|  ! t  H f    G  Y % B 3  @ N \b i v x & I& H&  >    6 >Q Y ud M      't H R& s w & " < 8 R N h d & J & ( ,z ; ? N R [& e u y ~ & &H &H & & % # /-"&7&HZ&|w&&& &F8  !`%T*59>mIMR A]axj&t&&&&&# '2&<3L"PY]lfjswQKHtl&`bb&|r#'0&:J+N'W>[:`iUmOvrzl&&&& ( ,9&CS:W6`cd]irv}&0&` &`$&`9&xR&Dgkt}($;7&4RJ& !*.7&A#QU^ b k .o *x&&&3 C =C _ Y { u&S     S& * 3c@ D M Q [&{  &s ' # L H e a&&&(& x t(~1 5 > B L&0k&u    &&&&&& .GmT Aa=m$y ( &`   &h%F/&O S a e n&x   . & Y Q& &   &      &44&PE&Rx  &     =$      *5 9 >GR V \&u&|&& p& , (&S& B! >&&AK&0k \o T}  &4      &@&@  &@  ! % ,&TP&pa&n  8&  &   R @=$   " & IX g r v {  &  & & "& a53aA?M K+& `5& `V& `pWtU& & a_& ki{u& &   & +/8<G& Q& j& ttll& & MK& W U c a & #& D& Ym ]k fy ju u        &0 &P  &p!&4!&4!/&4!D!H!Q!U!`&!j&!&!!!!!& !&!&8!&" &"&"+&"<&"Q&"^&"o&@"&"&"&`"&"&"&"&"&#& #& #+& #B& #O& #\& d#q&#~&#&#&#&### # $ $$%$/&$P$T$b$f$o&$y$'$%$:$2$$e$]$&$&$$$&$$%% %&%5&%F&%S#%y %*%& %%% %%%=%$% %%% &L& H&, &; &Fa&J]&OV&X&cz&gr&q& &{& && && && && && \&& ' &'&'*& ';&'H&'Z'd& '''& '& '''''&0' ]( (&(9(=(K(O(^ (b(k&(u[(K(C(p(n(({(&(p(((((((&(()) ))))")+)/)4&)E&p)V&)`)l)p)y)})&))))()&)5)3))?)=)&)&)P)N*&*Z*!X**f*.d*5&*S L*\** **&0+t+n+ +%+)+7+;+@=+L$+V+Z+_+n +x+|+&++++&+&+&+&+&,  ,&,/ ,3,8 ,BQ,FA,U,Y,g,k,p&, ,N,H,.,~,z,&, ,,,,,, ,,I,C-&- &-d- ^-)--}-6-:-?&-M&-W&-s-w-&-----&@-&@-------&d.&X.&(..&.F&<.W&@.d&(.v&.&.&. q.*. . / //*/6U/B /Y/z/ //&///&//&00#0( 02U06K0E0I0N 0Z&00w0{0&0&0&0&0&0&0&`01&@1##1'!1,&X1A^1P1f |1r%1~ 1&11&1 1 1 q11V22# 72, 2<2] 2i 2y q2~ ;2R2 e223$3> 3J 3W>3dV3 3 3&373+3}3e33333'3#4&41484#64,145B49@4BP4FL4Q<4^g4b_4kQ4x4|4&4p444p4&44444&$5&5'&5C5G5P&5e5i5r5v5}&5&L5&@5&(5&5&5666666(6>6Ge6Kc6Y&6c6sq6wm66666&66&6666666677 777 7)&73&7On7Sl7\&7f&7~x7v777&7&777&77777&8&88"8+8/8;&8E&8]8a8j&88888&8&8&8&888&9&9&&9;9?9H9L9W&9a&9y9}9 99&9&9&9&999&9&: &:5!:9:B-:F+:Q&:[&:s7:w5:D:B:&H:&H:N:L:&H:X:V:d:b:& ;&;&;#&p;>|;Bl;K;O;X&x;b&x;~;;; ;&x;&x;&;";:;8;&;&< <O<C> >>&>%&>F&>[>_>h>l>s&>&>&>&>>>>>>>>+?'? ?B?:?!l?%h?0&?:?E?I{?R?V?_?c?l&?v?&?&?& ???&8?&P@ @@ @ @' +@+ #@4 V@8 N@A&`@K&`@g @k @t&`@ @ @ @ @&t@&@&p@&A A  A A A!&A+A7 A; AI AM ARA[!(A_! Ah&Ar&A!UA!SA&A!_A!]A!kA!iA&A&A&pB&B)!{B-!sB6!B:!BC!BG!BP&BZBj!Bn!Bw!B{!B"B"B&B!B"B" B"B"B"%B"#B!B"/B"-B&lB&pB&@C@C"@C">C!"MC%"KC.&LC8KCD"WCH"UCQ"aCU"_C^"nCb"lCgKCp"xCt"vC}& C& C"C"C& C"C"C"C"C&4C&D"D"D&"D*"D/& DU&@Dp"Dt"D}# D#D#%D#D&PD&PD#RD#PD&PD#\D#ZD#hD#fD&dE&E,&E;&EV#xEZ#pEc#Eg#Ep#Et#E}&E&E#E#E&E#E#E#E#E&F& F&F!&F<$ F@$FI$3FM$/FV$MFZ$EFc&Fm&F$zF$xF&F$F$F$F$F&F&F&GG&&&&& & .& >&I&x&&N&^&&&&;&Xp0   T@ ,PD\t @0(<Tl`T.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rodata.rela.data.rel.local.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@ب&@ ,`12`E @@x`O0J@T"a"\@x0 v"(q@0 "@G@iNEp$@h+0@ 0[@P0^0%  H@h 8/75 0 0 0 644 11072 ` ELF%@@@|xx!#, AH|jxH```*, A(, /@8!@;xN `|,A(x|>H@@IH9)UG>,@䛉dxxH`,@!U)&| AAHAHB  stC~SSTUS T~:u !  st"~len# 5p%len% p- 4q2ST3S KSS : ; 9 I8 : ; 9 I$ > I~IH}4:!; 9 IB4:!; 9 IB  !I 7I .?: ;9 'I<  : ; 9! 4:!; 9!I UH}% $ >  &I.?: ; 9 '<.?: ; 9 n'I<.?: ; 9 'I<.?: ; 9 'I@zH}.?: ; 9 'I@z: ; 9 IB4: ; 9 I  nnYYSoSoSoDSDThT\S\hShhSSmYmmS|SoooD0\0n $S$4z4<Z!!!"/ ! y 7" tff ##.". ". / ."st_rdevtv_nsecst_sizetv_sec__mode_tsize_tst_ctim__glibc_reserved4__glibc_reserved5__glibc_reserved6caml_search_in_system_pathlong long int__syscall_slong_tcaml_executable_namest_dev__int128ssize_treadlinkruntime/unix_executable.cgetenvcaml_stat_freeasize_tshort intst_blksizenamelen__int128 unsignedst_gid__ssize_tlong intcaml_stat_string__nlink_tnamelong doubleunsigned charGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesst_inosigned charlong long unsigned intstat64st_nlink__blksize_tst_atimshort unsigned int__ino64_tfullnamecharstrlen__off64_t__pad2_Boolst_blocksst_mtimst_uidlong unsigned intretcodedouble__time_t__blkcnt64_t__dev_tcaml_stat_blockpathtimespec__uid_tstatst_modeunsigned int/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__gid_tcaml_stat_allocGCC: (Debian 13.2.0-18) 13.2.0zRxA pBBN DB A ABBA~EIBBAyAAAABAAAA~BAABAAAAAB4C ADEA~X HAD    .5<LShqunix_executable.ccaml_search_in_system_pathgetenvstrlencaml_stat_allocstat64caml_executable_namereadlinkcaml_stat_freef2n0t   l 260H `     &3& 3   R&* 1 V6 (D R Y ` g qn Eu *|   0    p   ]  L  ) 5 'A N ^ 6c q    3  _ 8  # T =  E  ! .  ; H iU b /o 7| I [   8 M   7 B&Y +c g  l v /z + z J >&P&h&& & m%&8 zC G uL V Z _ "i m      2 *  S K&, x r&t&|*&4&L&&&.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @$ @ 8&d,d12hE0@@X`OaJ@ 8[ i ~ Q0y@#0  $ !@$ 00 @$80`@ $h/97 0 0 0 644 76200 ` ELF"@@|a=")|}x!j|+x!,8A\89Apa9 88X9`88!99A!!!;!!!paxAH`|#@@`a{$})*,)!A4[9J````[9J),)!@H`;|#@A{,#Ac0A0@PH`|yyAa;@?;;H`|#@@8`a{I$})*,)!A0)!)})t}=J?`BA*)!JJAiH`,#ALA* q)@* ), AA;;0*})t? *}t})t})@P?(})t?(|t})t})8P?*} t})t})PP?!),)!@ aH`;Z|#@A;|)@<x#x880H`A0@P#x8!`!a|N ```j H`,#@aA<;9 Hay)$;|cJ|H*`H`|)@AxH`|a8!a|N ```<Ad>,)@j8` H`?~,)A8!)1)|c|N ```<,)A`p?@@I*@L~xxcxH@|y@,:A(Z|>@z*A[})t!A8apH`8!x!Aa|N ```,={&{@ ;8xH`||y@;;Kl;Kd ``,&|fx!a|#x|+xA8?j?,)A|I(8!jH|?xap< ?<7 D EqY +C?P" "% (X(+0.82@6H9P=XA`ChFpIxLPT[`rtwy!{+}5:+ d(0D8Qidd@dH+PIXI`hpxU_dv+ 8+Xsp0 1 3:d; < (id= 0 puXspw x]X EFG8HXp @!!   &0?PZ @jmpAB!CTd3&$223*C?:  ;! d;" h + . fd/d0 #end1 2 max3 4 (5 P5 X6 `7dh8 p9 x /4< %ACC     %POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx%EQy%NEQz{|}~%BEQ / 0len1 d 8 9 d: ;  C  $e$ 85{5{end5{5{ptr5{5{ 5(50 78 +9 <: + 8<<end<<ptr<< <(<0 >X? +mem@ <maxA < 8CCendCCptrCC C(C0# : C  "%L& ( * (+ 0, 8- @/ H0 P1 X2 `3 h4 p6 x7 8 9 : #$=()#$4<3P$9$.  +! +" +#X\RC3F:.Sbuf/ 0 #p $d %d &  '  (d )d *d  +d$ ,d( -d, 3 0 o p e q  r  sd td ud  vd$ wd(#|4+&,UT+$+p<H dUd Y+&S d   S  *LV>LWaT.<k+.b d Z&!%+ eLd] pdbg])pX p9<X1S'AdbgA(pliB=pcD e E LST[ T6 TLpc67eev8 LS= <pc2e6low W di<m% >-'-(- -(- - S d4X Yd'4)'`S T1?(U1Z di5< !+6evl+6l+~ d fdd  d d   (id0ev+*  <  +>< +>jSTS TSETU1cSTSTU SjSUTBS*AU+SQS T U  S T U !+77+C+:H @  Xsp PdP.V1&WHX@["ST pSP>- - S T U 3')S)!L+ 92+:h `  .V1&WhX`)!L S T U . +V1&WhX`)!L!B",!B#!G%Q). S T U !S T U ?.VqPWqXXq`:=r+0"r.:r<t t!u+@u ud"@iw d* x< x+>"j z+U"ST0"S S T U t@G#AspG$+G/+H0X+I$+J.!B+K%!GM:N OXP QdS /\pU e/^+e,$j+']sp+<{T<,$$jU*spv/ p0 $o^-8 -(- -(- -e' &Eexn !+sp . 6d  %p e_-" %Y`-a- -(- - S T U !%TS%S T U &&S T U  S T U '8&1: SS7d'>&S &S T U'$S TU'OS TU>'hS S T U 7+(!%e!8dis+X"+P"d(s,i d*,di< S (+ S T U7+P*A!"e!4+!E+!"d<)+)S6)S(k)S T*A*SU S T Ub -!4e!3+!7-!"~d8l+8ev+"+"+"~d,j < +,i<TT+ ,0,i<+L,LTT ,Y >,STU0V *,S ,S T U S T U H}4:!;9 IB1B:!;9 IB4:!; 9 I4:!; 9 IB.?: ; 9 'I<4:!;9 I4:!;9 I U!I/ .?:!;9 'I@z:!;9 IB I< .?: ;9 '<!:!; 9 IB"4:!; 9!I#&I$4: ; 9 I?<%( &.?: ; 9 '<'.?:!;9 '@z( 1U)H}* U+:!;9 I,4:!; 9 IB-: ;9 I..?: ;9 'I</ 0411 :! ; 9 I2 :!;9 I8 3: ; 9 I 4>! !I: ; 9!5>! !I:!; 9!64:!;9 I7.?:!; 9 'I@z84:!; 9!I9:!; 9 I: !!: ; 9!; :!; 9 I8<:!;9 I=.:!;9 'I@z>1RB UX!YW ?H}@.: ;9 'I A: ;9 IB.:!; 9 'I !C4:!; 9 ID.1@zE 1UF% G$ > H I : ; 9 J : ; 9 K'IL&MGIN : ;9 O5IP  : ; 9 Q : ; 9 I 8RI S : ; 9 I 8 T4: ; 9 I?U.?: ;9 'I<V.?: ;9 '<WX1RB X YW Y.?: ;9 'I Z.: ;9 '@z[I~\4: ;9 I]: ;9 I^1RB X YW _1X YW `1a 1b.: ; 9 'I@zc1d1RB UX Y W e41f.1@z44S44S22S23m33S34m44S22T23o33T34o44T22S23m33S34m44S22S23n34n11S12o22S11SSSSo|SoSoSSZZnnnYY uz"11%YSS0z3%#z#3%nn S lSlSlSlSl iiii 0 SS S oSo S o S m 0 3% x3% S 0 t1&"1$# T --S-.n./S//n--T-.m./T//m..S..o..T..l..Y..S..o//S//o+,S,,n,,S,,S,-n--S,,S,,T--S--T))S)*S**S**V**P*+S))T)*T**T**W**X*+T))U)*U**U**X**`*+U))V)+VS m S S mT n T T n k  00o  oY y" # @ S##S#&P#$Y$%{x%%Y%&{x$$Y$%{x%%Y%&{x$%S$$0$$x#3%%%x3%#%%x%%y%%xxSo!S!"o""T"#S##S##oT!n!!n!!x!#n##T##nUl!U!#l##U##U##l!l!!l##l!o!!o##o 0 z#3%!!z3%# z y !zxSSSoSoSonn00z3%#y#3%#z3%#z#3%TTT1SmSmSmTnTTnUUq#@kk0SoSo1HSHmSmSmSmHTTq#8HUHkUkUkUkTgggd00jnnnnSiSiiToojjjiSSSSSSSSSTZsSZYtYtXsZtTSXZt(&&S&&T&&V&(i((V()i&&W&(e((W()e&&X&(f((X()f&(l((l()S))l&'m((m))m&'j'(j()j&&U&'k'(k()k&'0''n''''n()n))0&)"''S''o''S''o((S()o()m,dTX          !!!!!!!##   !#%%%%&$$$%$$%%%%'''''''''(()--..//o runtimeruntime/caml/usr/include/powerpc64-linux-gnu/bits/usr/include/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/typesbacktrace_byt.cmlvalues.htypes.hfcntl.hstddef.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdlib.hstdint-uintn.hstdint.hconfig.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hsetjmp.hstruct___jmp_buf_tag.hplatform.hio.hexec.hfix_code.hstartup_aux.hinstruct.hstartup.hsetjmp.hbacktrace_prim.hdebugger.hunistd.hintext.halloc.h =/==!.! y !!I4-!4z ./'< '  g8': ' 8 ' ==. . / J/2  g !h .='< '  /  "$- #J!. #! = !    . /+ C#! '] ! = .  . , "K ,  , * " ,  , * #8]:'.8 ' = =. .(>v /L 3 <  ff  = !  hF3 L 4 < . )v C    JXg/-/ .!/! K/ !   /  !X<= .. yf  XX=/!/ .!g='y.'. <Y!#=f/ A >/! 0 ," !K K !0    "J !  <.(*.(  % v. .&v. >f<[ * < `J!t * < ?TJ%.K " ?Y * < L.ty .X&|.,=.|X.!/<;!<.:   ff?  5 ">'<! !%. 2# 0+..@. J|!!<.:J   G |J ! !/ " ! "z&/z&" ! "t /t  e  ! "n /  j. fg/-/!. [=!?3#1!" /=!'Z J .x. -0n<   JX/=<.&+!th,/J!:!..! !@g. J u<!!.:<.J.t=!-/ [= "0"t X=Y h/// ""H"C/C>/i1#1 .-<3 B3   3   ! 2G  /  . ~.&.,=!!<.:././!<;!<.: % 6fd%z&= z A&= A %z  u !#!1  =,4 . 3t.p   Jf !//  /<3&~. ,=!!<.:.K./!<;!<.:    .yJ ! y'Xz! !xR!1" ; X .j j !Ry y / /& ! !y <!m .0'Y!   #K<LL"! %<0#$!(w !! ! ! ! ! ! ! !. rXK%;#!! <   caml_get_continuation_callstackbacktrace_p__aligneventstack_high__pthread_mutex_strace_sizeinstructionsthresholdextra_paramscaml_ext_table_initalloc_callstack__saved_maskMAKEBLOCK1MAKEBLOCK2MAKEBLOCK3blockcaml_params_BooltablesAPPTERMruntime_warningscaml_domain_statelockedyoung_startATOMcaml_stash_backtraceephe_infogc_policycaml_continuation_replaceev_startorigcaml_loc_infofnamecapacitySWITCHbacktrace_activeEV_DEFNAMElocal_rootsnew_sizemajor_slice_epochstack_handlernextslotsGETFIELD0GETFIELD1GETFIELD2GETFIELD3caml_local_roots_ptrRESUMETERMRETURNCONSTINTDIVINTchar_oscaml_custom_eltev_endcaml_read_section_descriptorscaml_minor_tablesloc_filenameloc_is_inlinedcaml_stat_allocsectionGETVECTITEMPUSHTRAPSETFIELD0SETFIELD1SETFIELD2SETFIELD3BRANCHint32_t__jmpbufISINTcaml_debuggerPOS_LNUMSETBYTESCHARyoung_limitBULTINTENVACCcaml__dummy_eventsOFFSETINTextra_heap_resources_minormemprof_young_triggerdependent_sizeGETDYNMET__owner__mask_was_savedCODE_LOADEDallocated_words_suspendedAPPTERM1APPTERM2APPTERM3already_readcallstack__sigset_tbacktrace__lockminor_tables__pthread_list_tBREAKPOINTSUBINTPOS_FNAMEcaml_heap_stateev_end_lnumCONST0CONST1CONST2CONST3ENVACC1ENVACC2ENVACC3ENVACC4BUGEINTinit_custom_major_ratioACC0ACC1ACC2ACC3ACC4ACC5ACC6ACC7LOC_GHOSTBRANCHIFcaml_add_debug_infocaml_stat_strdup_noexccaml_debug_infotrap_sp_offstat_forced_major_collectionsprocess_debug_eventsinit_custom_minor_ratioUGEINTMULINTcds_filecaml_noalloc_endcurr__dataEV_LOC__jmp_buf_tagmarking_donefile_offsetoo_next_id_localgc_regs_bucketsunsigned charruntime_events_log_wsizecaml_ephe_ref_tablepthread_mutex_tcaml_is_instructionalloc_size_prequested_external_interruptPUSHATOM0ev_start_chrinit_custom_minor_max_bszASSIGNcaml_get_current_callstackoff_tcaml__noallocexn_bucketinside_stw_handlercaml_open_descriptor_in__kindhightrace_levelEV_MODULEexn_handlerloc_start_lnumPERFORMcaml_byte_program_modeEVENT_COUNTallocated_words_directstackBGEINTcaml_modify_generational_global_rootcaml_free_backtrace_bufferOFFSETCLOSUREM3LEINTloc_start_chrtrap_barrier_blockcontentscaml__roots_discompare_unordereddebuginfoAPPENDEDcaml_stat_alloc_noexcfinal_infoinit_minor_heap_wszPUSHOFFSETCLOSURE3PUSHOFFSETCLOSUREM3nitemsverify_heapevent_for_locationev_end_offsetflagsBRANCHIFNOTexternal_raiseRAISE__sizemutexsizeCHECK_SIGNALSsize_tEV_KINDev_filename__countstat_blocks_markedcaml__dummy_events_heapdls_rootcode_startmemprof_domain_sev_end_chrPUSHATOMcaml_stat_freeLOC_STARTalloc_idxXORINT__jmp_bufTRAP_BARRIERcaml_final_infomajor_ref__int128 unsignedloc_validunique_idntablesrequested_global_major_sliceEMBEDDEDCLOSURERECcaml_ephe_ref_eltev_infocaml__roots_blockopcode_tyoung_end__pthread_internal_listcaml__dummy_callstackcaml_stat_string__prevcaml__roots_callstackcaml_noalloc_begintrap_sp__int64_tpc_adnamerefcountvaluesweeping_donePUSHcaml_close_channelcache_bucketULTINTPUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3slotADDINTchannelev_pcrequested_major_slicebacktrace_enabledAPPLY1APPLY2APPLY3memprof__valcmp_ev_infolongjmp_bufferMODINTcaml_init_debug_infoPROGRAM_START/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becaml_statereraisecustomLSRINTmagicRESTARTget_callstackcaml_load_main_debug_infonametrap_spoffasize_t__nextcaml_intern_stateexe_namecaml_stat_blockGRABc_stackORINTcaml_exact_event_for_locationRESUMEPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4PUSHACC5PUSHACC6PUSHACC7__int128caml__dummy_disext_tablebacktrace_poscaml__temp_resultallocated_words_resumed__elisionBGTINTallocated_wordsbuffcurrent_stackLTINTshort unsigned intsigned charstartevent_kindptrdiff_tsigjmp_bufinit_max_stack_wszfind_debug_infoLOC_END__off64_tcaml_failed_assertextra_heap_resourcescaml_modifyloc_end_lnumcontdebug_infodependent_allocatedcaml_extern_stateyoung_ptrcaml_start_codecaml_stat_resize_noexcRAISE_NOTRACEintern_stateread_main_debug_infoexec_trailerANDINTminor_heap_wszPOS_BOLGETSTRINGCHARLSLINTloc_end_chrGETFIELDcaml_exception_contextcloseproc_self_exelong intuintnatbuffer_pEV_POSlimitephecaml_code_sizeGETMETHODnum_eventsGETBYTESCHARcaml_ref_tablePUSHGETGLOBALintptr_tuint32_ttracePUSHCONSTINTextern_stateATOM0uintptr_tsection_table_sizelong doublereservemax_frames_valuelong unsigned intPOPTRAPcode_tGETGLOBALFIELDcaml__temp_valevent_traceinit_percent_freebacktrace_slotchancharGETPUBMETDEBUG_INFO_ADDEDmax_domainsev_start_lnumOFFSETCLOSURE__spinssection_descriptorcaml_plat_mutexaction_pending__nusersMAKEBLOCKcaml_remove_debug_infohandle_effectVECTLENGTHcaml_debuginfo_extractcaml_getwordFIRST_UNIMPLEMENTED_OPslice_targetGETFLOATFIELDalloc_sizeSETVECTITEMev_defnamecaml_alloc_backtrace_buffershared_heapSTOPREPERFORMTERMcaml__dummy_lGEINTtrailSETFIELDcaml_fatal_errorint64_tmlsize_tintnatBLEINTcaml_debuginfo_nextC_CALL1C_CALL2C_CALL3C_CALL4C_CALL5BLTINTdoublemajor_work_done_between_slicesPUSHOFFSETCLOSURENEGINThandle_exnC_CALLNPUSHGETGLOBALFIELDPOS_CNUMcaml_debug_info_availableBNEQruntime/backtrace_byt.ccaml_continuation_use__int32_tcaml__roots_lcaml_ext_table_add__uint32_tqsortbacktrace_bufferhandle_valueRERAISEcaml_next_frame_pointerAPPLYbasepc_bcaml_debug_info_statusGETGLOBALUNCAUGHT_EXCcaml_debuginfo_locationCLOSURESTANDARDtrap_barrier_offbacktrace_last_exnlong long unsigned intBREAKoffsetcaml_array_length__compar_fn_tcaml_ephe_infoloc_is_raise__listcaml_gc_policyOFFSETREFcaml__framecaml_get_callstackSETGLOBALhandlerPROGRAM_EXITcaml_seek_optional_sectionslice_budgetcurrent_ramp_up_allocated_words_diffMAKEFLOATBLOCKOFFSETCLOSURE0OFFSETCLOSURE3code_sizenum_anum_bcaml__temp_offsetcaml_attempt_openGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesPUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4exec_namecleanup_on_exitatomic_uintnatnum_sectionsextra_params_areaASRINTlong long intPtr_valmark_stackBOOLNOTcaml_input_valSETFLOATFIELDephe_refEVENTloc_end_offsetparentcaml__roots_eventsparser_tracestack_cachec_stack_linkCODE_UNLOADEDPUSHENVACCcaml_ext_table_removeloc_defnamesection_tablemax_slotscaml_custom_tablestack_infoevents_heapev_aev_btag_teventsstat_promoted_wordsunsigned intgc_regsrequested_minor_gcexception_ptrPUSHOFFSETCLOSURE0GTINTstat_major_wordscaml_allocshort intPUSH_RETADDRprevmax_framesswept_wordsstat_minor_wordsPUSHACCcaml__roots_events_heapyoung_triggerGCC: (Debian 13.2.0-18) 13.2.0zRxA tG A GA~BAAe AACHAD JBJAA A~I40C ACGA~h GAD C AHA~`UACAABFABA~BBFABA~FFBFAAA~8PHD_ BC e BA Q ABA~CAA4PC ACGA~j HAA 8BDr ACA~DAB DC I AFA~EALC AFA~O HAD MVNGABAA~Ad8EpA~CBA4C ACDDA~O GAD ,lC A CGDA~I AC[AAFKAD A~LAA8@DK DA A ALA~HAC AIA~HAAE0|C AGA~P DAB SDA0F ADA~^ GAA `FpA~CIA4$,4$@TB ACA~ICA4hC ABCA~O UAD LEA&`20B0HW   lw)9KixP-C_8z, 85PUkh`4$4T&>Ri}backtrace_byt.cprocess_debug_eventscmp_ev_infoalloc_callstackread_main_debug_infoget_callstack.isra.0caml_statecaml_array_lengthcaml_stat_alloc_noexccaml_stat_strdup_noexcqsortcaml_fatal_errorcaml_failed_assertcaml_alloccaml_modifycaml_stat_freecaml_paramscaml_byte_program_modecaml_start_codecaml_attempt_opencaml_read_section_descriptorscaml_seek_optional_sectioncaml_open_descriptor_incaml_getwordcaml_input_valcaml_close_channelclosecaml_add_debug_infocaml_debuggercaml_stat_alloccaml_ext_table_addcaml_remove_debug_infocaml_ext_table_removecaml_alloc_backtrace_buffercaml_free_backtrace_buffercaml_stash_backtracecaml_modify_generational_global_rootcaml_next_frame_pointercaml_noalloc_begincaml_noalloc_endcaml_stat_resize_noexccaml_get_callstackcaml_get_current_callstackcaml_get_continuation_callstackcaml_continuation_usecaml_continuation_replacecaml_code_sizecaml_init_debug_infocaml_ext_table_initcaml_load_main_debug_infocaml_debug_info_availablecaml_debug_info_statuscaml_exact_event_for_locationcaml_debuginfo_locationcaml_is_instructioncaml_debuginfo_extractcaml_debuginfo_nextcaml_debug_infoZX(C  H b2Xj0Xl   2`0` $ :20>00@ ~22h00h 2200 ZXC@ x  2200 ZX C 2 @$ % 20& ' ( ( D( T) h)   *  2 @ r 2v @+ 2200 2200 "2&062:@  0 Z X C - . R2 Z0 \/  2 2 0 0  Z X C 2 0 Z2 ^@ 2 0 1 &2 *2 20 60 < nZ vX xC C  2 2 00 &2*2.00C>0@ V2b0dCh | 2200  JZVX\CC202@C5 2"2*0.00 H2 TCf2j2r0v0x 2200 2200 20226@`7 6 8 l9 ZXC ZX22 C*0.04 b2n2r0z0  ZXC( H R2V2Z0^0d   = 7 4 D> P8 | 2200 20A  2 @ 2 @,  2 @*2.@4 0R2V0202@ H@ HPG G &3& 30&83H& P3`& h3x& 3& 3& `3&3&03&3&3 &(38&@3P&X3h&p3&3&P3&3&3& 3&@3&P3!&"&#&?& b &*1}8?FMT!Ylx ["Y k1 _&+ ;8 zE XdEqt~ jP' ,!&R`e@q7}o 6jo W, =IZ (fwRl) 1 *m8F{TbCp ~ HYO y&4'BP^\j Vv Q{  x" ,78\DPT\ht x  yt % 2 ? V^k"8  H   @'41 @L0Q[ em  5 l59   $P 0 H I c" }  8   t   b - 2 7 < A F K P # ) / 5 ;) A2 G; MD SM Ye e7 k q w }       + e  ~    - 6 ? S  \    o   \  ,    %V + 1) 7 = C Ii O5 U [ 9 a g m s y    )  /         H  _ * _  z        ! ' - 3! 9z ? E K Q WZ ]  c  i & o 1 uO {h  A   c  J   e v  O d      f B   )   ( " ( .x 4 :' @ F L R XE ^ dh j p vH |  r  = E  V   k:oTa n  "ko $r1Ybfko V   i  $J1y>KXer G 0 l&B/>DJ Q]j8wo%  C>"/<I}Vcq}  P TN . f   v%+117>KJ&^dj.p v QSUV` H,C UkPc(?Vq / B(!|+?UlHe&P  &@+ <:A& c,g"v`zV4&D&X& & /38&M SX& y}vr&( % !(& BuM&h&q& r&&8 &&&&(&@HD4I3Up`di#!-+ 95.U@NDHI&holmqev>yw&p>&&L&\&p)&F&d&&&&&0&&&&4&A&R&c&p&&=jW"!$%"*&?_N&[&8&L&X&}4,&&&&*&8>C&Ze]iQnj}W&,&L&l&& & ,& :| E& \X g k p {   ; /  [ q m & &< & & &!&!&!&!M!X&!oI!z!~!!!!3!p!!!U! ! S!!!:! ""E" >"/"-"")9"-7"2&"A&"V"aP"eL"k&H"&"&"&"&" d" ""#X# ##*j#6=#B#N:#Z_#f##M#&#:#d#`# #3#{#s$$$&$$&$1$5$>C$G$K$TN$]$a$u:$|&0$=$-$$|$ @$$$ $ $$ $&$ %&%#&%8B%<<%E#%N%R{%Z&%k&%x&%&%&8%&%&%&L%&%&&&&&&'&&4&&FT&M&&d'&o&s&x& &_&& `&& && &&&&&&H'&'%&p':&'P&'i&'z&'&''& ' '''3'p'''8((_((!(&(7 (; (@(N (R }(W& (h&(t& (( ( (& D(&(&(h(& ( ( ( )()  ) )) )! )&3)1p); 5)? /)Dm)R )\ O)` M)e)o `)s X)x& d)) ) })& )& )& d)&)& *& *$&*1&*B*M&*d *n *r *w* * ** * *3*p* H* >*m* * q* o*}++++) {+- y+: +> +C+M +Q +V +g +k +p&+}& +*+++ + +&++&+& + ,&,,&t,#&,1&,F,P ',T #,Z&P,g&,&`,&H,&0,&,&h,&,&,&-&- ->-I-T -_p-j2-u8-C-y-& - >- 6.  i. a. . .$ .( .1 .5 .> .B .K .O .X& @.a.m .q .z .~ .. #. !. /. +.&. A. ?. K. I. [. S. / {/  / / / /& /* /3/7 /@0/D(/VY/ZM/c/g/p^/}//r///&t/&/&h/&/&PJ&J&J&J&SJ&kJ& #J& ;J& UJ& mJ&&&]&PT     `h0DP0Dl @P.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.opd.rela.toc.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @d @ph&,12E(@@PO J@(`Y0T@^ eMbxTRs@ c*0@0cZds@00zZ0 @( "fail_byt.bd.o/ 0 0 0 644 36824 ` ELF@@|=")|ex|#x<8!iH`8`H```|=")|ex<8!iH`8`H````|!a?}?j),)Axi|~x,)AH`xj8apH`>x,)A`),)A8)j?,)AI8  jH`H`xH`H`<K<At<9!p9@9>A'Axpq*@\iH`8!|N ```<At<9!p9@9>A'Axpq*@\iH`8!|N ```< |:?1 "  =   " %  (( +0 . 8 2@ 6H 9P =X A` Ch Fp Ix L P T [ `  r tp w yE {O }Y     ^ |  = p(*0h82id p@pH|PmXm`hp x  y p  | 8+ sp0 1 3 :p; . < ( id= 0 pu spw x EF G 8H ^p @EE     JTdc t~ @ jmpA rBEC & 22 b$  j  kp l | 85 5 end5 5  ptr5 5 5*(5*0 7 8 |9 : | 8< %< % end< %< % ptr< %< % <*(<*0 > ^? | mem@  maxA  8C C endC C  ptrC C C*(C*0 *   :*  :? :   ! p "3  K:F :. r4buf/ K X   |! |" |# w|u| | |5} p6^ p   _7x| / | Z!P F F p !! ] |"mQ  { |"|8 e Z pU9 > ph exn%|:f | |@ Sq{?S  |@ q{?S  |@q{?S  |@pq{?S  |Xmsg1|PeZS  TS |@gq{?S  ~|@q{?S  y|d{ o !PieZS T  T  r|msgr>|ttE#ttp$tagu|%Rv| u!PieZS  S T UtE;m|msgm>Z&g|-msgg=Z `||msg`5|bbE#bbp$tagc|%d| 6cMDPWeZS  S T Ub [|X6msg[5Z6]  DPWeZS  TS&U|PmsgU5Z'Mq(M1ZmsgMMZ'D(D+Z<"<v""|) { eSPTS /T1 ] K)S  hS T U/ S T U% S T U5)PH?Ze +T USVT S2)qD{ T US S2=Xo 5!PieZS  TS : ; 9 I8 I~ !I : ; 9 I 8  :! ; 9!I!81BH}: ; 9 I $ >  I  : ; 9! : ; 9 I8 .?:!; 9 'I@z1RB UX!Y W <!I/ H}I:!; 9 IB1RB UX!Y W 4:!; 9!IBH}:!; 9 I4: ; 9 I?<:! ;9 I: ; 9 I .?: ; 9 'I<4:!; 9 I&I7I !!: ; 9! :!; 9 I8!.?: ; 9 '<".?: ; 9 '<#4:!; 9!I$4:!; 9! I% &.:!; 9!'I !'.:!; 9! ' !(:!; 9 I).1@z*% +$ > , -: ; 9 . : ; 9 /GI05I1  : ; 9 2 : ; 9 I 83I 4 : ; 9 I 8 5.?: ;9 '<6.?: ;9 'I<78.?: ;9 '<9.?: ; 9 '<:4: ; 9 IB;.?: ; 9 'I <.?: ; 9 '@z=.1@z S S SS Z         S T S S T S S S T S              SSq#0oo00STTTT  SSq#0oo00STTTT  STSSTSSSTSSSTS  SnTSmSSmSnm(S(/U/HST/V/HTPtSt{U{SSTSSTSSSTSSSTS  ,d                             runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includeruntime/camlfail_byt.cstddef.htypes.hstruct_FILE.hFILE.hstdint-intn.h__sigset_t.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hstdio.hsetjmp.hstruct___jmp_buf_tag.hsetjmp.hstdlib.hprintexc.hsignals.hio.h  # +1  1 / s # +# +1 0Z/<J/.00&z Bz $. 2"+" '."7 "y  /J .[ <.+ <.+ <.+ <.+*<2" - / =  y<' __off_tatomic_uintnatexn_handler_chainhandle_value__jmp_bufsize_tc_stack_linkdependent_size_shortbufrequested_global_major_slicecaml_exception_zero_divideyoung_limitmajor_slice_epochgc_policymlsize_truntime/fail_byt.ccaml_global_datacaml_exception_not_found__jmpbufswept_wordscaml_local_roots_ptrbacktrace_pos_IO_buf_basecaml_fatal_uncaught_exceptionlong long unsigned intunique_idmemprofcaml_failed_assert__int64_tsigjmp_buflimitcaml_exception_contextextra_heap_resourcescurrent_ramp_up_allocated_words_diffnext_codecvtlong long intsigned charstat_minor_words__jmp_buf_tagmark_stackgc_regs_bucketscaml_exception_failure_value_filenorequested_major_sliceparser_trace_IO_read_end_IO_lock_tparentcaml_process_pending_actions_with_root_reslong inthandle_effectmajor_work_done_between_slices_flagsallocated_words_suspended_IO_buf_end_cur_columncaml_minor_tables_IO_codecvtextra_heap_resources_minordouble_IO_write_ptris_exception_old_offset_offsetcaml__dummy_msgcurrent_stackcaml_exception_invalid_argumentbacktrace_slotslice_targetcaml_raisecustomcaml_heap_stateoo_next_id_localbacktrace_last_exntablesintern_statecaml_bad_caml_statecaml_exception_stack_overflowrequested_minor_gcallocated_wordsvaluechar_os_IO_markerinside_stw_handlerlocal_rootsblockunsigned intstack_cache__int128backtrace_active__valGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong unsigned intslice_budgetcaml_ephe_info__sigset_tcaml_stateminor_heap_wszintnatdatadependent_allocatedshort unsigned intstat_major_wordsallocated_words_resumeduintnatcaml__framecaml_exception_sys_blocked_io_IO_save_basecaml_custom_eltcaml_exception_invalid_argument_valuecaml_get_failwith_tagcaml_ephe_ref_eltintptr_t_lockc_stack_freeres_bufyoung_ptrcaml_channel_cleanup_on_raisehandlercaml_terminate_signalsbasetrap_sp_offyoung_startcheck_global_dataasize_texception_ptr__mask_was_savedstack_infoexception_nameextern_statetrap_barrier_offdls_root_IO_read_ptrmarking_donesweeping_donecaml_ephe_ref_table__off64_tcaml_exception_sys_errorephe_info_IO_FILEexn_bucketextra_paramsfinal_infouintptr_texternal_raisestderrextra_params_area__saved_mask_modememprof_young_trigger_markersmemprof_domain_s__int128 unsignedyoung_endlockedthreshold_Boolcaml_exception_with_stringunsigned charstack_handlercaml__temp_resultshort intallocated_words_direct_flags2cache_bucket_vtable_offsetcaml_exception_with_argFILEexitcaml__roots_msgcaml_custom_tablemagic/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-becompare_unordered_wide_datantablesfprintfstat_forced_major_collectionslong doublecaml_intern_statechargc_regscaml_final_infocaml_exception_failurestat_blocks_markedcaml_get_invalid_argument_tagcaml_resultcaml_is_special_exceptionhandle_exncaml_domain_statesiglongjmptrap_barrier_blockoffset_IO_read_basecaml_exception_array_bound_error_IO_save_endcaml__roots_blockcaml_exception_out_of_memory__pad5_IO_write_endyoung_trigger_unused2nitemscaml_gc_policyephe_refreserveint64_tcaml_exception_end_of_filerequested_external_interrupt_IO_backup_baseminor_tablesshared_heapsize_freeres_listprev_IO_wide_databacktrace_buffercaml_result_privatemajor_refstackaction_pendingstat_promoted_words_IO_write_basecheck_global_data_paramresultcaml_extern_statecaml_ref_tableephelongjmp_bufferGCC: (Debian 13.2.0-18) 13.2.0zRxA HIpA~0DHpA~$H<A ABEA~AApXFpA~G BAA (C AEA~X DAD XFpA~G BAA (C AEA~X DAD dEpA~I BAA (@LpA~@@LpA~XXFpA~G BAA x@LpA~@LpA~@LpA~@LpA~h H+D   DKSX0<c$HX;V`sxXd@@-XF@a @|8@P@hhfail_byt.ccheck_global_data_param.part.0check_global_data.part.0stderrfprintfexitcaml_raisecaml_channel_cleanup_on_raisecaml_process_pending_actions_with_root_ressiglongjmpcaml_terminate_signalscaml_fatal_uncaught_exceptioncaml_bad_caml_statecaml_failed_assertcaml_global_datacaml_exception_failurecaml_exception_with_stringcaml_exception_failure_valuecaml_exception_with_argcaml_exception_invalid_argumentcaml_exception_invalid_argument_valuecaml_exception_array_bound_errorcaml_exception_out_of_memorycaml_exception_stack_overflowcaml_exception_sys_errorcaml_exception_end_of_filecaml_exception_zero_dividecaml_exception_not_foundcaml_exception_sys_blocked_iocaml_is_special_exception2 @20( 4 V2Z@b2(f0(t  ZXC C CD L X ` j2`n2v0`z0| 2`2x0`0x 2`20`0 2@! "2&0( NZRXTCr2v@# 2`20`0 2 0  &2*@H! b2f0h ZXC2@# "2`&2.0`204 F2J0L f2j@20! 2200 2@20 2@2260@ V2Z@x# 20 2@20 2@2 0   226@R28V08` r2v@2H0H 2@&&&3&P 30&83H&P3`&@h3x& 3&3&`3&3&3&P3&3 &(38&0@3P&pX3h&p3  q _&*/A=D P Wn^8e;l xIJ   VLj+8 E R :_#ly v dQ$  _ O " r0 -<Dhr #- k)w HN+9 >Je/q }l f d ( f6WDERq` n |fWd P&$2@>NZ\ 1j~x mn ? A $U0Z<>H T*`#lxG u  K0  $ 2?L Y f YH `  V Vf  + {8KU $d]pu  & C 4 | B  U  ) C w ] j w 6    p r   w    + 72 _ G k  w    Q  T 7 X   -  L Y x *        2   0 LY ^ f |v    &   9 7  &p &p #X . E 2 A 7& H&H T ^&0 y&0 H j f &d &8  & & 8   &$&  &7&@(K O T&e&q{&P  &`   > :&&& &.&7B cF _K&D\&h 2r&&  && &`&`   &`% ) 2&`;F J S W \&m&z&&&& C =) a ] 7 t p&3 < @ E&W&`o s |&    &P&&<&&` ^.8&@Y ] b)mv z  7   &  $ "&&6 0 ,&K C ?( V, R1&B&N&_&l&`} 4&  w&   &!    &,&!&7 Q [r|K& ? ) &&&L&T&`*&h7&L&Y&`i&~&x&`&&&`&    &0&,&<D&P_ c h&|}&(&&   &0` $ &0u L D p l&l*&6&PL&H\&Hq&8&8& & &&E&U&j&z&&&&&&&&&#&3&&&]&m&&&w&& &&4PLt@  `,D\P|0p.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @@J &X,X12XWE@@Vp0OJ@VY @LT@Y* e!x%rs@ +0@p0+3h,@03o 0A[ A|@Chh G8fix_code.bd.o/ 0 0 0 644 11560 ` ELF&@@| 41B: ; 9 III~4:!; 9 I !I( 1B H} 1U 4:!; 9 I?< 4G:!; 9 .?: ; 9 'I<:!; 9 I.?:!; 9!'@z :!;!29 IBH}% $ >  &I> I: ; 9 .?: ;9 '<.?: ;9 'I<.?: ; 9 'I@z: ; 9 IB: ; 9 I.?: ; 9 'I@z .?: ; 9 ' !: ; 9 I": ; 9 I#1RB X Y W $1RB UX Y W %.?: ; 9 ' &.1@z'.1@z( 1SSPhShoSoP{T{T  2% 2%YYYy|YYy|VXZyyWSSSTt2%T2%Ss|SSs|WZYssX,L)  runtime/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/includeruntime/camlfix_code.cstddef.htypes.hstdint-intn.hunistd.hmisc.hmlvalues.hfix_code.hmemory.hcodefrag.h% *%"%r01="!0/ !!:. 0s t"r. ". . *!  .* wfw<"   . *!  .*#  "w __int128 unsignedsize_tcaml_stat_alloc__int32_tshort unsigned intDIGEST_PROVIDEDssize_tcaml_register_code_fragmentlong long unsigned intinstr1instr2DIGEST_IGNORElong unsigned intasize_tDIGEST_NOW__int128caml_init_code_fragmentsunsigned chardoublelong doublecaml_fatal_errorcaml_set_instructioncoderuntime/fix_code.cunsigned int/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-bedigest_statuschar__ssize_tGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesint32_tcaml_stat_blocklong long intopcode_tcaml_is_instructioncode_tshort intinstrcaml_code_sizelong intcaml_init_opcode_nargscaml_load_codecaml_start_codesigned charcaml_fixup_endianness_BoolDIGEST_LATERreadGCC: (Debian 13.2.0-18) 13.2.0zRxA LJpA~CBA(8C AFA~o DAA dxx    L%AP`ev0xH`xfix_code.ccaml_init_code_fragmentscaml_register_code_fragmentcaml_load_codecaml_stat_allocreadcaml_fatal_errorcaml_fixup_endiannesscaml_init_opcode_nargscaml_set_instructioncaml_is_instructioncaml_code_sizecaml_start_code2 @2@( ^2j@t ~@2@ @2@ 2@@R2V0X &3&P 30&p83H&P3`&h3x&03  @ `&* 1 6 D R nY  ` g 3n Su |  )   V V z   |    & % F+ 2 = O V [ ^o&&  3  ^ &0 & *  / = &B&g u &   ; &P! *% "3 K7 G@&I&a&~&   ` Z                 &|)&A&`R&] j&&0&p   = 7&p b \ " ~ z    ! % . 2 g&v&&&&o&<Php|0.symtab.strtab.shstrtab.rela.text.data.bss.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @L@@&,61@P ;2 O8:J@p h[ryn i@$H  0~@% 0  - @%P0080 @% P&interp.bd.o/ 0 0 0 644 118280 ` ELFH@@|="!A)9@px})j|zx!|#x|+xAa|3xa!A(A),)A=",:)8ap})j9AaA<!A<(8I~PP~tH`,\(@X9!9^x;<?m;{="[)})j9 I,*9JIA=")i30()@:~( A4=BJy)}*J})R})N D8,|pd% ###0P<$$$$% 4 tHP$x %4$d@8h`| "$$P$($# $$p$,XL%, ,LH%@   | ` ( D t P 0  x\ H "#D lX8P`H`K`xH`3,)@30()@ bs%xDx~xH`8` H`&xExxxH`sH`<(9I8|?P@@<x})t< }xt<(x9I8|?P@A!H`<\|*H@@ | { 9@9)9__?<( H`<(( ;0tK88`H`,1@9>9_x?<(IH`<(|}xx;H`\(<J0|*HA `<,)A;`8xxH`K``y)$} JH*; (})t<tK`\<|*HA,88`H`K;8`~~xH`|}xK;~;H`|}xK;;{;Kt;>;y)$*KX;~~x;KD;~~x;K0;;{$K;>=BJ;Jy)$P*K;^=; >yJ$y)$}J@*P*K;>;y)$H*K``?<;888x;H`88`H`9@|ix y)d9)JK^t|*H@ 0> y)d9)JKp^t|*H@A> y)d9)JKL8;>E})x})P88})*I|*0@; K^t|*H@@H> y)d9)JK|(\<0|(P@$\|*HA8`8H`<|(K^t|*HA> y)d9)JK|^t|*H@> y)d9)JKX^t|*HA> y)d9)JK4^t|*HA ,; K_t~~x})y)$JP*K>];U)<})})R=;K؁>;U)<})JK{~~x;K?~~x;|)A;K?~~x;|)@;Kx?~~x;|)A;K\?~~x;|)@;K@?~~x;|)A;K$?~~x;})tN4a=K?~~x;|)A;K?~~x;})tL6a=K?;~~x;})tH6;K?~~x;Jxa=K?~~x;KxK?~~x;H8Kp~:> Vp<,~}:~}/@ ;()A",)A&>BR~Rjr,#A&pCy2$!0!a(}JBCH`a(C!0|(P@A!y*Ud,)9*(8|;xA&=@= aJa)yJy)9eJe)|BaJa)|;x|;x```~Hx|%P@0:R(|&@@,z $})Z@\}!q}J9N9?A,*}HJxA(yB}I9I|I*9)|Q*By$,Jz8;9'^yJd}QRG@p9S9yJ x}I~&x8`|8yJUd89J89)IFyJd}QRI 9B93y)HP~iy)dJK8 ~~xK,~~x;K~~x;K>{ ;9J;y)d_}3J?K~~x; K~~x;K>_;y)$9)J_K,>_;y)$9)J_K>_y)$9)J_K^ >8}',|PPx$|:Ady) |q(9JyJ$9 R}GRA,( A0y)B})99*;9J B||;x*KH_{ ;9) ;?(_K _{ ;9);? _K_{ ;9);?_K;K~~x;~xKԂ^:,:r@8,:?A!?j,/A"O92})y)$})PP/H`/O|*H@A<~f:`xUd,&9)*9}sx}sxA <=@`aJxyJdeJ`aJ?x|)8@X:sO;|&@@,@ H~I}sxq*889HA,&9H ~'xA,y)B})9'9J8 )*B> ~J9yJ$R; y)d}0J.K`>:>|)A0 P~>xKD>,8y)$J@\;xK ,=A;K~~x0;K~~x(;K0~~xK(~~xK ~~xK~~xK?t~~x;})t})y);K?;~~x;PK|?;~~x;JKd#~~xKX~~x;;KD~~x;;K0:~9=BJx<( >J~~xy)$}*H*Ii}IIN!A(<(|}xxH`;K~~x;K~~x;K_9?}JuA#<t}?Kx}=S~~x})Q})Py);Kl?9_})uA#t}_SxK~~x{;K@~~x;;K,~~x;K ~~xK~~xK~~xK?siA|(<;{0S|(HJA,2AhR0|)PA>{8y)$y9)9}_J}I*S\(;),)@ \39@rhI;i@;s;q>})t<>t~;3K?_siA>\{x9~=x;{y)$yJ9)9J~?J}_I*riA,3:sA!,;A?j?,)A[)(;*<()|(?})t<_K ~~x;;KH?_siA<{ 99Jx~=x;{y)_:?9)?K0|(<0[|(H*A,1A$Q0|)PA8>BR~Rj,>At>9)>H`>^|*H@A9= a) y)e)a)P:P|*H@=@= aJa)yJy)eJe)aJa)PR|*H@= { a)9Jy)8e)sha)92<_y)9)?<(; @:;>})t<^t;;K,~~xKp^;~P(0A|,0A0>bs~sj3,1A1z$!S})R1H`1|(H@Az Ud,09)9S(9}HR}{xA> >@b1bRz1zRf1fRb1bR```3~nx|)@:sN|*@@(0A90}{x})9_}ISx }):}?HP Bz $}{x9)JKD^;(A>bs~sj,0AP9JPH`0P|*H@AzI > 9) >@b1bR*z1zRf1fRb1bRP99 }sx3~px|)@ <:sP|/@@;}sx?.?.Kt>;(Ad>BR~Rjr,3A(39)3H`3|(H@Axz* = 9Ja)y)He)a)sS:S|*H@=@= aJa)yJy)eJe)aJa)SR|*H@x= ;a)y)e)a)2~]x?2K\(<J0|*HAD<,)A8;K 9 xƲ8,|y$x P8@dqH9 A,(x9 A@yJB}I}(9)y$}*yJ$9)|*98}J*HB|~~x2K8};;~~xH`K8};;~~xH`K|x;;~~xH`K\>>b:>s~sjy)$~I*,>A>9)>H`>|(H@A49@= a)Hy)e)a)~S;|*H@ X= ~>xa)y)e)a)3SK>;y)$*K~~xK~~xK:^ ~9=BJ8_~s~dx<( > J~^xy)$}*H*Ii}IIN!A(<(|}xxH`zi$9)JK:~9=BJx<( >J~~xy)$}*H*Ii}IIN!A(<(|}xxH`;0K:~9=BJx<( >J~~xy)$}*H*Ii}IIN!A(<(|}xxH`;(K:~9=BJx<( >J~~xy)$}*H*Ii}IIN!A(<(|}xxH`; KH`<\|*H@AH?~~x; })t<KT>{ 99J;y)d}3J?<_y)9)?}Cx<()})@P})t<K#~~xKs:~@ =Wʄ>U(>U2>| @@@@W>})y)dJ{dK߰8~~xKߤ~~x;xc$|c;H`K|~~x;Kh>=BJx;;jy)$|iH`K8?~~x;y)$*K :~9=BJx<( >J~~xy)$}*H*Ii}IIN!A(<(|}xxH`;Kެ~^: ~o(/A,/A(A?j>,1A1y$!N})R1H`1Q|*H@A dzR yUd}),/*9HA`>@>`bRbszRzsfRfs8bRbs|B}^Sx``>x|)@h;q|'@@(/989(Aq8A,&9(xA,yB} 99)8 B9}]Sxr~xKL~;(At>"1~1jQ,2A82x9)2H`2|(H@A zj = 9Ja)y)He)a)rS;|*H@= a)y)e)a)33Kܨ=BJ*9),)*@`{ :_9)88`?<(IH`<()|)@?|)@p?|)@,xH`|ixKܰ~~x ;K{ :_9)88`?<(IH`<()|)@?|)@ ?|)A8<_;; y)$| ;K$~;;xc$|c;H`K8};;~~xH`K{dK?_~~x;})t}Jt}I;Kڨ,=A{dKڐ~~xKڄ~~xKx~~xKl>;y)$I*;KT>;y)$JK@~~x;K,~~xK ~~xK~~x~xK ~~x;K\<|*HAߘ88`H`K߄~cy)$C})PP#K8K8` H`,A$<(KP<BR~Rjr,3A3y$!})B3H`3|(H@A TyUd,.9)(s;A<=`axyde`axx:@`3~qx|)8@:R:s|.@@,09X9?APqG |BA,8|JxA(yJB}I9I|I*9)|Q*B;9 z$((8|)A;tKװ<t|>@@ TzRdӒ{dK,9H4```}(:})pa)}*yJ$}J(*|*0A}(Kx|8A9H9(UJ8})y)$; D(*K< y)d9)JKR29J})PP})t|)@@88`H`>,2{8y)$y9)9}_J}I*@9>9 x*<( H`|rx~#xH`<(|sxx)H`:1?K`<{8y)$y9)9}_J}I*K| 9Q~d}{x888<(IH`<(O):1K|| 9_~d~#x888<(IH`<(Q;KP| 9_x8888<(IH`<(^;K| 9_~D~#x888<(IH`<(;K| 9}$Kx?88!8a\( H`\(a!;Kݴ}#Kx8H`,z $|}x})@|y$"_9~RJq}.9! @$|rrxH`! |)@A8|rr9H`|rr9H`! |)p@@xK8~xH`|oxKDzD }{xH`x"_;|sxH`q~R@$|;;H`(/A8|;;;H`|}H`|/@@~}x~xK0<K(<88cH`Kp??;;:xx8.H`xx8.H`xx8.;>})t<^tH`K <})t<>tH`K<current_stack) <= spsp <= Stack_high(domain_state->current_stack)parent_stack != NULL(num_args + 3) >= 1(num_args + 3) <= Max_young_wosizeruntime/caml/memory.hField(result, i) == Debug_free_minor(2 + nvars) >= 1(blksize) >= 1(wosize) >= 1(tag_t) (tag) < 256(size * ((sizeof(double) / sizeof(value)))) >= 1(uintnat) index < (sizes >> 16)(uintnat) index < (sizes & 0xFFFF)sp == domain_state->current_stack->spsp[0] == accusp[2] == envruntime/caml/mlvalues.hval & 1((value)p & 1) == 0Stack_parent(cont_tail) == NULLbad opcode (%lx)A6A8.'A)|Bint*[,C A1G3|6 7 8 9 : (; 0< 8= @@ HA PB XD``FehH|pI|tJ xMTNbOjQzY [\]e^ _ 5`|b D+ [ Az. S  A. G p   W Z. l m4 E 22.B.O5F[#X.NA' HG[/\|/]|/^  .2.9;H< > ?[ D4JEg Jx.?I"     " % (M( +0 .8 2@ 6H 9P =X A` Ch F p I x L  P  T  [  ` r  t w  y  {  } '    ,       |(U0 68Jid|@|HP ;X ;` h px G Q    |  l 8+Msp0 1 3:|; 5 <  (id= 0 puMspw x R MEF G X8H p  @        "  1 B L@ jmpA B CE V 0&22 85 5 end5 5 ptr5 5  5U(5U0 7 X8 9 -: 8< < end< < ptr< < <U(<U0 $> ? mem@ -maxA -8C aC aendC aC aptrC aC a CU(CU0 ([  .0*  .?5   6! |6"B([ % ([ wK  .0F w5. Lbuf/   ([k%ACC     %POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx%EQy%NEQz{|}~%BEQ  ! " #M w "%& U( *  (+  0,  8-  @/  H0  P1  X2  `3  h4  p6  x7  8  9  :  ' =( '7  7 M & |J|N^8 u !O!( J[% 19jG 1"9g |U 9,-E-DE!$_-9X || M2M! |[U[U  [[ d |581 u Y|!) |tt| 1!2J!",-9!? | 2e|P8?)([)6U)');pc[spenv  # | *}* w M *! V} J"Q~""F"""x*(? ) hST # U3V0S2TS y, 4  <a    | |i|  ,+" # 4}- . /  IMJMKSS T U L e | ;ig|:@e@;ARAA n |s- u @lu K@|@@<@@% @<u  @S @G@_@`S T U_ST~U3V1W0%S T U uXS T U uS T U uiw-  | X @l H@|@@9@@% @<  @S @G@_@`S T US T U _(ST $ &U3V1W0S T U  ti| i|-S ~ $ &3$"DS $ &T ! | |--pE  @l @|@@@@% @< 6@S @G@_@`S T U_ gS~T~U3V1W0 S T U S T U  i| !Ui|-!S~"8-!;S~"8-S~"8 !qi|DS"T $b-tag 9  # @l "]@|@@"N@@% @< " @S @G@_@`S T U_# ST $ &U3V1W0#=S T U #pS T U S T U  #i- $)i--#S"8-$S"@-S"D$GST-ST &"tag 9   @l %@|@@% @@% @< % @S @G@_@`S T U_%ST1U3V1W0%S T U  S T U  (tag 9  @l&@|@@&@@% @<' @S @G@_@`'TS T US T U_'ST2U3V1W0'S T U S T U  )tag 9  @l(@|@@(@@% @<)D @S @G@_@`S T U_)pST3U3V1W0)S T U S T U  ,-(-)  ++ @l+ *@|@@*@@% @<+ + @S @G@_@`S T U_+;ST $ &U3V1W0+nS T U +S T U + +/-/ ; ,i0-1 -1 ;DST -dE ;F @lF,@|@@,@@% @<F-G @S @G@_@`S T U_-sST1U3V1W0S T U F -a-a ; .Lm-:@m @;AAA / .S T U S T U </_MM/3 |#/SxTS /e 0k 0 Sofs  0T ? Jli |hi|mi*| ? J 1 li |hi|mi(| 1stkM @ 1 @S T U 31S T U  5Y2 3M4M 3> @l>2@|@@2@@% @<>3H @S @G@_@`3S T US T U_3tST2U3V1W0S T U > ?64C @ <@3@T@$4*@/S4T1S4T1 @J4 @STU . @K4 @STU . @R5, @S T U .u5DSS 7eff[ \ ]M^M_M @]&6 @S T U 3 ?a6x @ <@6_@S4T1 @x6 @STU . @7 @S T U .u70S^7HS7`SS T U u+At7 A,.S: @$M8D @/,@$ @/S4T1+@l 8 @|@@8@@% @$93 @/,@$ @/S4T1+@$49 @/,@$ @/S4T1 @*: @S T U 3 @:Z @S T U 3 @$: @/,@$ @/S4T1+@l ;I @|@@;;@@%Y;gSwT0;S 5 ;S;S ;STU<STUV*S>BS>^S0T1>vS>S1T1>S T >S ?#S T U ?VS T U J?uS ?S T U ?S T U J?. V3@$& -$M3@<& 3@l&$&5--Ui-=(|@&(= $+  -$+@$+ >1@?val1>,@?p,=+!A@val8-$ @$  VR|@__cR|I~(  : ; 9 I8 4:!;9 IBH}I41BH} 1B U  !I 1RBUX!YW  : ; 9 I 8  :!; 9!I!8H}4:!;9 IB: ; 9 I U4:!;9 I$ >  : ; 9!1 : ; 9 I8  1<.?: ; 9 '<  1U!I/ I4: ; 9 I?< .?: ;9 'I<!.?: ; 9 'I<" :!;9 #H}$4: ; 9 I%( &: ; 9 I'&I(>! !I: ; 9!):!; 9 IB*4:!;9 I+1RBX!YW ,1RBX!Y!W!- .:!;9 I/ :!;9 I8 0: ; 9 I 1.?: ; 9 '<2.?: ;9!'<3.: ; 9!' !4GI5 !!: ; 9!6 :!; 9 I874:!; 9 I89.?:!; 9!'<:1RBX!YW ; 1< 1U=.: ; 9 'I !>.:!;9!'I !?:!;9!!I@: ; 9 IA% B$ > C D: ; 9 E : ; 9 F> I: ; 9 G : ;9 H5II  : ; 9 J : ; 9 I 8KI L : ; 9 I 8 M.?: ;9 '<N.?: ;9 '<O.?: ;9 '<P.?: ; 9 'I@zQ : ;9 R41S4: ;9 IT1RBX Y W U4: ; 9 IV.?: ; 9 'I -SjSSqjTiTTqiUd U d UdUdUUdqUVh V h VhVhVVhqVn n  n nnnnny"#ny"#ny"#nTny"#ny"#ny"#ny"#nnan   !!#!!!!#!!!!#!!""#""##########$$#$$$$n$$$'`''a''n'( ((n((((((((((((()))))))))))**c**+++++++++,,,,,--#-.//#////33#333335n57n79n::::;;;;;<a<<<=>>b??c@@cAAcAABBBBcBBnBBCCCCCCDDDG`GHnJJKKKKKKLLLL"#LLnLLLM"#MMnMMMMMMMMMMnMMMMnMMMMNNNNNOnOOaOOnOQaQRRR RRnRS`STaTTnTTTTnTUUUnUUUUnUUUUnUUUUnUUUUnUUcUUnUVTVWWW`WWTWWWWnXX"#XXnXX XXnXXy"#XXnZ[a[]n]_`_`n`babbnbc`cdnddnefnff`fgahhnhh`hiaiiniiaijnjk`nnanncoocopappnqqnqq|o o n  o o y y#0 o o Xx oxxxxxxxxxxxooooooooooooooooxooUuxUxo x o h o x o x o!!y"!!o!!y"!!o!!y"!!o""W##h##o##h##o#$h$$o$$x$$o$$a%'a''z"''y"''o((x((o((x((o((()o))))o))))o))x))o))x))o**o****o*+Y++o++Z++x++o--Z--n-.o./a//o//x//o00a23n33o55z55Z55z99o99x9:o::o;;o;;o==o=>>>o??o????o@@o@@@@o@AoAAAAoABXCCxCCoDDoGGwGGwGGWIJxJJoKKxKKoKKxKKoLLoLLoMMy"MMoMMxMMoOOyRSaTTaTToUUoUUoUUoUVoWWoWWoYYZYYzpYYXYZaZ[o[\o\\o]]o]]Z]]h]^Z^^h^^a^_o__o``o`aoaaaaoccoccccoccffaggohhaklnllommnmmomnnppkppppapppppZppp m m  k m S mmmmmZmmmmmVm1mmmmmmmmmW$m$$$%m%'^'(m()m))))m))))m))7))m))1)*m**S**m**m*+m++m++m++3++m+.m..c.///m//5/0m00c05m57m77z78m899:m::sp:;m;;sx;;m;;S;<m<=m==S=>m>>S>?m??S?@m@@S@CmCC1CCmCCTCC1CDmDDSDGmGHmHHaHKmKK1KLmLL1LLmLLshLLmLL1LMmMM1MNmNNmNNmNNmNOdOOmOOaOPmPRmRS^STmTTTTmTTmTUmUUmUUmUUmUUmUVVVWmWWVWWmWWmWYmYYSYZcZZZZmZ[[[y[\m\\a\^m^^^^y^`m`aaazaamaaSacmcfmff^fgmggggyghmhhmhimiiWijmjpmpppppqmqqdqqmd k m   d  yd!!m!!m!!m""m##m##m$$m$$m''m****d-.m//m33m===>d????d@@@@d@AAAdDDDDdNOdRRRRdYYYYdZ[[[d\\\\d\\\\d]]]]d^^^^d^___d____d````d`aaadggggdqqdh h 1& hh""u"""h##2##1$$0$$  $ &$$h''y''h''''h--h--~-.h//033h33~33h::v"::hRR1&RRhllhmmhpp1&pphfqfgqgeqe..a./m/0a00mTTmYZmdeaghappm./b/0bTTbYYSYZbdebghbppb./k00kTTkYZkppklqlYkkYSY##X##X##W!"Y""u""W""U!!Z!!y"!!!!y"#!!!!y"!!!!y"#!!!!y"#!!pphpqhppopqo9:V9:0::1::y~99V''OR`RRVW`gg`nn`op`PPYggYPPcggcPPYggYPQ^VW^nn^PQmVWmnnmPQ0QQbQQQQbVWbnn0QQ0$'bRSbWWb]^bffbhhbjjb%%Y]^Y%%_]]_%%Y]^Y%&V&&  $ &RS  $ &%&^RS^%&0&&c&&&&cRSc&&0ff0hh~~hh~}cSTc`bchiciic^_ST^`a^ab_hi^ii^`ST``b`hi`ii`Y"ST"`a"aaYab"hi"iiYii~ii"Y3${"xy"xy"xy"@mYyTYtaaYaa3$s"aa~"abSbb~"8bb~"8bb~"@Z``Z}``SZ``ZWmSTmiiW0ii00aa01y@.H.#y(.H.#DF_FGSS_^__bc_jj_jj_jk_DEb^_bbbbjjbjjbjkbEFZbbSbccjjZEEY^^YEEa^^aEEY^^YEF_SS_EFZEF0FF1jj1cc1GHcHHzxHH x OO x \\cddcHHmOOmHHY\\YHHb\\bHHY\\YHH1OO1HHmOOmHH0HH1OO079a\]acdaefa89bcdbeeb77Y\]Y77c\\c77Y\]Y882cd2ee288bcdbeeb880881882cd0ee156b66yh[\beeb67^OO^66Y[[Y66`[[`66Y[[Y673OO367^OO^66035`TT`_``bb`hh`ii`ij`45_55WTT_bbShh_34Y_`Y34a__a34Y_`Y45`TT`45_TT_440550bb0hh055 bb hh 551bb1hh155 ;<bOObZ[bfgb;<YZZY;<nZZn;<YZZY<<1OO1<<mOOm<<0<<1OO0KK KKy:%KKYKKmKKxKKYBBnUUnUU|nn|oonBBboobUU1&UUbUU1&nnb ( Y k=>c++y1&++Y*+z1&++ZUUVUWWUTUVTWWTUU3UVXWWXUVWWWWVVYWWYVVTVVx}3$VVZVNNV3XNNXWNNWYNNY./cTTcZZcppc..cYZc13bkkbkmb k03k[[k__kkkkkmk a03a[[a__akkakma11Y__Y01n__n11Y__Y122kk2lm212bkkblmb110121222kk0lm1 l00l[[l00a[[a22kklk22kllk33kllk,-mXYm]]mddmmnm,.aXYa]]addamna,-kXYk]]kmmkmnk,.cXYc]]cmnc,.bXYb]]bmnb,,kddk,,lXXl,,bXXb--y--cmmc--cmmc : lll l Y l Y lNNlNNlll..kghk/0kdek99lWXlWXlAAlAAYAAlAAY,8   03[[__kkkm 000000[[00[[011222222222__kkkklm01__111111111222222222kklm2222kl22ll33llll NNNNUVWWUVVVWWVVVVVVST`bhiiiST`ahi``STaaab!!!!""$'RSWWWWWW]^ffhhjj$$$%%&RSWWWWWW]^jj%%]]%%%%%%%&RS%%&'hhhh''ORVWWWWWggnnopOOOQQQVWWWWWggopPPggPPPQQQVWWWWWQQQR*+++qq++++,.XY]]ddmn,,,,dd,,,,,,,,XX,,XX----mm--mmmm....gh./TTYZpp....YZ//00de35TT_`bbhhiiij35TT_`iiij34__4445TT5555bbbbhh5555bbhh555557OO[\ee57OO[\ee66[[66666667OO79\]cdef7888\]cdef77\\777888888888cdee99WX9:::99999:;<OOZ[fg;;;;;;;<<<OOZ[fg;<ZZ<<<<<<<<<<OOBBUUnnooBBooUUnnDGSS^_bcjjjkEFGGSS^_jjjjjkEE^^EEEFSSFFFGjjbbbcGHOO\\ddGHOO\\ddGGHH\\HHHHHHHHHHOOKKKKKKKKRRpppq>v runtime/usr/include/powerpc64-linux-gnu/bitsruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/types/usr/includeinterp.cstdio.hdomain.hmemory.hmlvalues.hstddef.htypes.hstruct_FILE.hFILE.hstdint-intn.hstdint-uintn.hstdint.hconfig.h__sigset_t.hmisc.hdomain_state.hdomain_state.tblfiber.hminor_gc.hfail.hstdio.hsetjmp.hstruct___jmp_buf_tag.hcodefrag.hdebugger.hsetjmp.hinstrtrace.hinstruct.hprims.hstartup_aux.hsignals.hbacktrace.hcallback.halloc.hstdatomic.h  j%<f %.j %.f .!%< s !!!!-!!# !t . #!-K."  "## x ""! ,!-!! .!J/Y /C./? #Xm%M===K} Ju=..u X%wZJ~.! "~.< !  !  !   5 ! !' ! !0'!'%  !"" ! ! <5x/ ?!   D< y    / !   !k   b #  # "   @ C ..  x FX ( !% !5!5+; "% (   ~) ! < 1  y t   !  .J.X{/  .    |     . .|!!!!!!  |././ " <    ! 1J< H 1 H D -  1<HD.-  1HD.-   !! ! ! !  M$  <   !  !| <  m      r     n    q     ~  !/  .    ! K   !</ 3!   0!  w |. .|X  <'*  E o   x FX$!   .0  < x !   !  ..zJ ! #,!! ! ! "  !.!  . . !  / !   .   / w#t.v!.<X .      z!   !  .n.X!  <X .        z!.<X .        z!  <X .        !!,!! ! ! " u! . .X  .             {!       < X    .             z!   <X .       u!   <X  .             z! .<f  .     .        L ! !.J.J. '..<.'<.<'.< .L"    R K "  !. ".+0! +;  /0. + !+-  - +- .y .{t.|t.{t.{.t.y! .<X  .             }     ~L," . - !%;3. <.t.~. St. !     1t.{ Xt.wKY!wY"w <#!.! !/w<KY"w <#!.! !/w< z.t }}t.t X . z. !0% !  !0%!%#  !"" !  ! .  . .zt    .....+.-GETFIELD2GETFIELD3GETPUBMETc_stack_linksize_tcaml_stop_hereallocated_words_resumedmark_stackwosizememory_order_acquiredependent_sizeUNCAUGHT_EXC_IO_codecvtPUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3caml_event_countint32_tbacktrace_slotephe_infocaml_make_unhandled_effect_exnDEBUG_clearCLOSURERECBREAKPOINTmemprof_IO_save_endcaml_process_pending_actionsBRANCHIFBRANCHIFNOThandle_exnORINTextra_heap_resourcesBLTINT_IO_write_baseLSLINTsizesputccaml_bcodcount_lockCODE_UNLOADEDcaml_fatal_errorhvalXORINTshared_heapcaml_heap_statePUSHATOMblock_IO_save_baseraise_bufMAKEBLOCK1MAKEBLOCK2MAKEBLOCK3LSRINTrequested_major_slicecaml_ref_tableGETGLOBALextra_argscaml_raise_stack_overflowCONSTINTinitial_external_raise_chainephe_cur_columnslice_targetVal_ptrPROGRAM_EXITheader_tresultcaml_custom_tableMAKEFLOATBLOCKstat_promoted_wordscontentscont_tailcaml_disasm_instrlong intlocal_rootsdispatch_instrAPPTERM1APPTERM2APPTERM3trap_barrier_offlimitstat_forced_major_collectionsuintnatcaml_failed_assert__saved_maskRAISE_IO_markerRETURNdo_returncaml_intern_stateinitial_envstat_blocks_markedopcode_tparent_stackBRANCHENVACC1caml_final_infomemprof_domain_sPUSHOFFSETCLOSUREcaml_global_datacompare_unorderedcaml_initializecaml_minor_tablesntables__atomic_store_tmpsigned char_IO_FILEGETBYTESCHARtrap_sp_off_IO_wide_dataDIGEST_LATERinit_custom_major_ratiounsigned charGETVECTITEM_freeres_listPUSHGETGLOBALFIELDbacktrace_last_exnraise_unhandled_effect_codecaml_custom_elt__atomic_load_ptrcaml_statefinal_infoREPERFORMTERMPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4TRAP_BARRIERPUSHACC6PUSHACC7_Boolvalueraise_unhandled_effect_closureMODINThandle_valuecaml_gc_policycharprintfcaml_ephe_ref_tableMAKEBLOCKcaml_paramsPUSHENVACCPUSHACCcapacityADDINT_IO_lock_textra_paramsOFFSETCLOSURE0OFFSETCLOSURE3C_CALL3memory_order_acq_relinit_minor_heap_wszmajor_work_done_between_slicesinit_percent_freecaml_try_realloc_stackASSIGNprog_IO_read_ptrSETFLOATFIELD__jmp_buf_tagGTINTyoung_startinit_custom_minor_max_bszAPPTERMextern_statecaml_continuation_usedom_stPUSHGETGLOBAL_markerscaml_alloc_smallprog_sizesweeping_doneinit_custom_minor_ratiotablesPROGRAM_STARTreservenewspPUSHprocess_signalCODE_LOADEDtrace_levelcaml_exception_contextevent_kindMULINTCONST0CONST1CONST2CONST3_offsetcaml_bytecode_interpreterresume_tailCAML_FROM_CAMLBULTINTindexresume_fncaml_atomATOM0oo_next_id_localminor_heap_wszraise_exn_bucketRESUMETERMinitial_extra_argsdigest_statusexception_ctxlong unsigned intPUSH_RETADDRBNEQresume_argself_flags2caml_alloc_small_flagsdependent_allocated_IO_read_baseslice_budgetaccuexn_bucketAPPLY1APPLY2APPLY3arg1arg2arg3_unused2longjmp_buffercaml_stash_backtraceATOM__mask_was_saveduintptr_tGETSTRINGCHARyoung_enddo_resumeevent_trace_old_offsetexternal_raisec_stacksigjmp_bufcds_fileruntime/interp.cBLEINTgc_regs__uint32_tRESUMEFIRST_UNIMPLEMENTED_OPGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecode_ttrap_barrier_blockCLOSUREext_tablesection_table_sizecaml_debugger_saved_instructionSETVECTITEMcaml_ephe_infomemory_order_consumecaml_event_tracememory_order_seq_cststack_handlerdoublestackinit_max_stack_wszraise_notrace_IO_write_endcaml_register_code_fragmentparentOFFSETREFcaml_extern_stateLTINTmemory_order_releaseDEBUG_INFO_ADDEDenvofsSTOPmethsswept_wordscheck_trap_barrier_for_exceptioncaml_raise_zero_dividethresholdcontcaml_trace_value_file_IO_buf_baseunsigned intcaml__roots_blockDIGEST_IGNOREcaml_icountDIGEST_NOWintptr_tAPPLYinitial_stack_wordsgc_regs_bucketscaml_modifyISINTGETGLOBALFIELDRAISE_NOTRACE__pad5requested_external_interruptUGEINTBOOLNOTcaml_register_generational_global_root__int128 unsignedBUGEINT__sigsetjmpcurrent_ramp_up_allocated_words_diffnfuncscleanup_on_exit_flagsoffsetold_stackraise_exceptionCAML_DO_TRACK_modeEVENT_COUNTGRABexe_name__jmpbufACC0ACC1ACC2ACC3ACC4ACC5ACC6ACC7_codecvtraise_unhandled_effectOFFSETINTcurr_instrinitial_trap_sp_off__jmp_buf__atomic_store_ptrnitemsRESTARTallocated_wordsPUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4nextproc_self_exeyoung_limitcaml_prim_tablelong doubleSETFIELD0SETFIELD1SETFIELD2SETFIELD3FILESUBINTruntime_events_log_wsizeruntime_warningsRERAISEunique_idOFFSETCLOSUREM3allocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intcustomslotsizememory_order_relaxedcaml_alloc_small_dispatch__off_thexnULTINThandle_effectmax_domainsSETFIELDPUSHATOM0allocated_words_suspendedGETMETHOD_freeres_bufephe_refinside_stw_handlerGEINTANDINTcaml_raise_continuation_already_resumeddomain_stateSWITCHcaml_trace_accu_sp_fileSETBYTESCHAR_IO_backup_base_shortbufPOPTRAPGETFIELDSETGLOBALchar_oscaml_free_stackCAML_FROM_Cnum_args__int128handler__off64_tbacktrace_activeDIVINTstat_major_wordsmemprof_young_triggerPtr_valrequested_minor_gcyoung_triggergc_policy_IO_buf_endsection_tablecaml_check_gc_interruptcaml__temp_d__atomic_load_tmpcaml_alloc_shrcaml_debuggercurrent_stackatomic_uintnatshort intPUSHTRAPblksizerequested_global_major_sliceinstructionscaml__temp_iEVENTdivisorcheck_stacksASRINTcache_bucketVECTLENGTHBREAKBGTINT_vtable_offsetPUSHCONSTINTextra_params_areatag_tENVACC2ENVACC3ENVACC4caml_init_callbacksrequired__valexn_handlermagicCHECK_SIGNALSputcharverify_heap__int64_textra_heap_resources_minorPUSHOFFSETCLOSUREM3PUSHACC5young_ptr_IO_read_endC_CALL1C_CALL2asize_tC_CALL4C_CALL5nvarsdls_rootmlsize_tstack_infostat_minor_wordsC_CALLNuint32_tlocked_filenoDIGEST_PROVIDEDcheck_trap_barrier_for_effect_wide_dataENVACCshort unsigned intstdoutCAML_DONT_TRACKexception_ptrnargsbasemajor_ref_IO_write_ptrNEGINTintern_statePUSHOFFSETCLOSURE0BGEINTPUSHOFFSETCLOSURE3Hd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatPERFORMLEINTcaml_update_young_limit_after_c_callcaml_domain_statestack_cacheminor_tablescaml_ephe_ref_elt__sigset_tfflushbacktrace_enabledGETDYNMETprevOFFSETCLOSUREcaml_alloc_point_heremajor_slice_epochGETFLOATFIELDGETFIELD0GETFIELD1GCC: (Debian 13.2.0-18) 13.2.0zRxA \8K A R  A~ " NAGD     7  N_kr8+2EVf| &7^r~=Winterp.ccaml_bcodcountraise_unhandled_effect_code.0raise_unhandled_effectcaml_global_datacaml_paramsstdoutcaml_prim_tablecaml_event_countcaml_bytecode_interpretercaml_state__sigsetjmpcaml_icountprintfcaml_stop_herecaml_disasm_instrcaml_trace_value_fileputccaml_trace_accu_sp_filefflushcaml_failed_assertcaml_event_tracecaml_free_stackcaml_alloc_point_herecaml_process_pending_actionscaml_debuggercaml_make_unhandled_effect_exncaml_update_young_limit_after_c_callcaml_stash_backtracecaml_atomcaml_register_code_fragmentcaml_alloc_smallcaml_register_generational_global_rootcaml_init_callbackscaml_modifycaml_debugger_saved_instructioncaml_try_realloc_stackcaml_continuation_usecaml_alloc_small_dispatchcaml_alloc_shrcaml_initializecaml_fatal_errorcaml_raise_continuation_already_resumedcaml_raise_stack_overflowcaml_raise_zero_divideZX(CZXC  HFZXC>2B@Z20^00` 2@0 D f28j08l v2z@! " # $ 22@00@% 22p0"0p$% 4& ' (  ) T* + , - 8* T. t. 2@62:@22 00 / 0 202@1 2@1 2 b2 f2 n0 r0 t% `* Z X C( fZjXlC( 2 @ L, jZnXpCRZVXXCt( ZXC( ZXC( ZXC( l3 3 3 ZXC( 2 @ , 2 "@ , 2 @ , "2 &@ , ( !3 !2!@!3 "2 "@ "X, "Z"X"C"( #Z#X#C$( $n2($r@($* $4 %8* %n2%r2@%v0%z0@%|% & 3 &,3 ',* 'l5 '2'2'0'0'% '2'2'0'0'% '2'2'0'0'% ( Z(X(C(4( )f2)j2)z0)0)% )2)2)0)0)% )2)2)0)0*% *.2*22*B0*F0*H% +R2+V2+f0+n0+p% +2+28+0+08+% +* ,T* ,+ ,6 ,, ,2,@,2P,2h,0P-0h-% -2-2-0-"0-$% -d7 -* -7 .<7 .7 /7 /d7 /7 0 7 0d7 08 09 19 19 188 1X8 1p9 19 19 19 121210101% 22P2 2h20P20h2% 2&22*222026028% 2J22N2p2V02Z0p2\% 2j2P2n2h2v0P2z0h2|% 222220202% 2222p2020p2% 222220202% 222220203% 3232p303"0p3$% 32236203>03B003D% 3R23V23^03b03d% 3z23~230303% 37 32P32h30P30h4% 4$8 4T9 4n24r24z0404% 4242P4040P4% 424240404% 424240405% 5252`5050`5 % 5.25225:05>05@% 5b25f25n05r05t% 5252p5050p5% 525250505% 52505: 525250505% 52P62p60P6 0p6% 64% 6l% 6z26~260606% 62P62p60P60p6% 6% 62727 0707% 7&27*272076078% 7F27J207R07V007X% 7f27j27r07v07x% 727270707% 727270707% 727270707% 727270708% 8,' 8t; 8~28280808% 8< 8= &&&& &(&&3    &*1 H6+DPWP^eFlqB ;R  )6tCGP]Ojw | y xy> 6-(: HTJ\Atc ]Y Aa %CQ3VpZv |k  > :z"5.:K\ mA}4 Y\  . <JYX ftAj/>*"8FT `lxI=L E   ".b:FRf^jv{h  G+Uz s'4S_ hxJY.+   # 2( > a C M] W 3 p }   3   ^    % 1 > K Y e ^     A E  ^ : G T i p u j      H  0 .  ,     & 2 J A. G< M S( Y _ e k  q     7 Q V [ ` e j o t   W ` i r ${ *t 0 6 <2 H N T Z ` fI l r x ~" '  Z     Z    L  :  1  b q  `  &, 2 +8>8DJ_PjVu\WbOhYnt zAis} [xyYa ; " \( c. j4 q:@FLRX^dCjp Uv|l p.  g  Z #)/Q5;A(G KMhS Y _Ie lMx S 3?   L$ '1>/KXer@ n mN&&/K_ov$ Gv\ . E`o`m - 62> Zzi  &  %/F3<8oBFlK UYhlb{   v  U ''+0 l;w?gD OSXLcgl :| &l_&S&)< & & c&L&&$/38&S&i&&&&&& &  &|- 9 D#H!M X-\+b&w95Q LJVT& `^& lh "&,&dA LPU `di tx~&84&8&&   )26@&J&g&86xB@}WK&(4 &(<&*37=&(<P&(dZjnw{&+x&&&3&7&&&&7;&H&Y&8j&w&20I;&=={ &#'04:&M&WHgktxH&)&&&+&8&&/)&5H:&G&Ybk(o$um=9&4\&4,WZP~ ! %3 7 g<qEU&_py!V}!R&$!i!e!~!z&$&X!!! ! &* & %& 7&0l h&4 }& & &4 &P &  ! !  ! !!&0!&1!<&1!V!h!!l!!r&0!!d!"-!"!"t!"h!A!"!"!!!&"!" """""&""8""<""E""I""O&""b&""l"|#"""#"#""#"#"&)"&"&"&/l# &5(# &`#-&#>&5|#S&#`&#q&5#&p#&#*##)##%#:##<##:#&1#&1$&1$*&1`$H&1x$cE$w#Q${#E$A$#$#$Z$$&$$o$o$#$#$&$$#$#%#%#% &$%&$D%'%7#%;#%D#%H#%Q%Z$ %^$%c&'%t&%&%&.D%&2@%&%&%&2d&&p&&&#&7$*&;$"&@A&K$M&O$G&T&Y&i&&s&&$g&$c&&&$z&$v&$&$&&&&&&$&$'$'$''$'$'#&2'8&'E&'U&2'f&'s&'&.'&3'&'&'&3,'&p(&(a()%(-% (2A(=%6(A%2(Fv(K([&(e(v(%I(%E(& (%\(%X(%o(%k(& (&X((%(%~(%(%)) %)%)&')&&)3&)E&-)q&2)&)&)&2)&p)&)))%)%)A)%*%***&*) *: *C&#*G&*P&*i&6*m&2*v&I*z&E*&*& **&\*&X*&o*&k**&*&~*&*P*&*&+ &0+<&4+Q&+^&+o&5+&+&+'+D+&+&++&+&+A+&+&+V+D+,&, &,&1@,.9,@&,D&,IN,N,^&,hw,yw,',',&,'-,'),'@,'<,&,&,,,'S,'O,'h,'d--'}-'w-&'-)&-6&-H&-l-t&3-&-&--D--'-'---'-'-&%-&%.'.'.&%.4'.8'.A'.E'.M.V.a'.e'.j.s .~( .(.&7.&.&.. .(#.(.&7@.&.&/&//!(J/%(H/*/5(U/9(S/>/I(_/M(]/R&/`&/u/(i/(g/&/&//W/(u/(q//W/(/(/&800 0(0(0+,04!0?(0C(0H0U70d(0h(0w(0{(0) 0)0G00)0)030)(0)$0 00)?0);0)T0)N0)o1)k1)1)~11.)12)1;&L1E1U)1Y)1^&- 1o&h1|&P1&-,1&1&1&8|11h1)1)11)1)22 *(2*2`22-&t272H2Q*W2U*S2^&|2w*j2{*f2*}2*y2&|2&22*2*2*2*22*2*2&52&3 &3&63*&37&3I&/3u&53&3&3&83;3+3*3U3+3+3&-3&-4&-4+&\4H&P4R4b+-4f+)4k&6$4&`44+@4+<4&6<4&44+S4+O4&6t5&p5&P5-&5E&5Z5n+l5r+b5wh5+5+55+5+5 w5+5+5 5,5,5& 545,:5,65&2 5&h6 &P6"&D6,D6<,M6@,I6I^6V,`6Z,\6`&,\6}&6i6,u6,o6&66&6y6,6,6&66&p7&P7&,71&,7I&,7a&77r&7&7&7&7,7,7&7&P7 7,7,8&08 &08",8&,8+&@8I&8S&8o,8s,8|,8,8&8,8,8,8,8&8&88,8,8&'$8&'$9-9-9&'498& 49B& 49^-9b- 9k& X9u& X9-9-9& h9& 99-$9- 9&49&h9&P:&::"-7:&-3:+&2:<&h:I&P:_&:i:y-J:}-F:&+:&+:-[:-Y:&+:& :& :-e:-c:-o;-m; & ;%-y;)-w;2-;6-;<& ;J&;h&h;}&0;&8;&L;&t;&8;&;&<&<&&<;&@ &!>&"D>+&"`>C&$>_&$>w&%@>&%>&@>&>&&>&&4>&'t>&3L?&0?&?$&3l?9&?F&?W&5?l&?v&7`?&0?&?&7?&?&?&8? @ L@@%&@0L@=%@H>@Td@m@}@A@!@@A@ @A!AA ' &&.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.tbss.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @8 @(&9( ,981298E;0@@AO<(J@B00T<@_<@A:Z@B` k}zFy-K0@0{?>z@00c0 <t@H n`/117 0 0 0 644 84744 ` ELFDH@@|?!|dx8!AH`8` H`8`H`|8|#x8|~x!H`,#Ax8xH`,#@=_? 8<<88,=H=B*@D<8 8H`,@X8!|c|N ``|3xH`8`H```8`K``8`K```|a|#x|+x|~x!QH`<8|x8`xH`xH`8xH`,|{xA|,=|x@(88pH`,@!p, #A|xxH,|~x@8!ca|N ``<8`8H`H`#, @;`K!q, !@x;`H`<8`8H`Kp```xxH`<8`8H`8!ca|N ``||}x|#x!qW8;xH`8|~xH`xxH`|#@$8!|N x8!|N 8!;x|N =!:s:R:1:99H``~dxxH`,A~DxxH`,A~$xxH`,A ~xxH`,A}{xxH`,AlxH`,@8=";y)$H*,<A<, -@ xH`,@4<U*>, -A9)U*>( -A=BJy)}*J})R})N 8p0xH`|dx??H`H`H`DxcxH`|dx?qDE~:?S" ? ? ?" ?% ? ( (+0.82 @6 H9 ?P= ?XA #`C -hFpIxLPT[`rtrwy t{ ~}  ~      ( 0 8Tid@ H ~P X ` h p x             #   ? ~ 8+ sp0 ?1 ?3:; . < (id= #0 D p u spw x   E #F G .8H p  ( @ t t   e 2 y f   @ jmpA~B tC  /&22  / A0len1 { 8 v9 {: v; W :   85 5 end5 5 ptr5 5 5(50 ? 7 .8 ~9 : ~ 8< < end< < ptr< < <(<0 > ? ~mem@ maxA  8C :C :endC :C :ptrC :C : C(C0 : ? u:/*  :?7   u8! 8"V(  hS9q:#U W:/ FF7.~Vbuf/Wd  ~! ~" ~# ~!!"+ ".fd"/"0end"1 "2 max"3 "4 ("5P"5X"6 `"7h"8 p"9 xjW# $$ $"$%e$& $( $* ($+ 0$, 8$- @$/ H$0 P$1 X$2 `$3 h$4 p$6 x$7 $8 $9 $: $=($?6&(())~)})|9q&3J&9$(&=&>XbM 0O 0P W: 0R $Ie'~e' !~3~~Jm koA. (,   ed e ) ee).e*mY+!!~%8 ~K,w dd "O{!Y ?~'~"Q   ,!$*l!e'eZ-4.( /X $ 01b t!18 F!e 1).)e(n d(4  1 !e: Bee (U X!a p;(P $F $A <e Z M2f ;3% [4  e S M!7e  YMe) mee.<1} )+_.2s.:2V=l{mm!nn oo)pqd%ress ~\41exny ~`!S5T1  S T U { {SSTTUUVVWWXXYYZZ]~! ) !d"# "# &res$ ~=-c%d1fd~%pos> A~ %res ~      1 : -c    3    ~#> ~%err !ST U~V~73D;TnS T  S 4IS #  #k  #]    d#%iXhSXS XSSSS9SU S +S CS mST07StS7StS0ST.<TUX-ST8tES]S uS S S ST7St S0S%T.<CTU XST8 .<TU#1exn ~~!S5T1  S T U /J g /q /e /[$/} /TU24$ 4 43 S0 S0T0V0/J!p /q /e /[$/}/!MTU S T4 ! 4 43!S0 STV0-hV %`^-v"1-w7 S-!"$-B"|S  BS "S T 7"S 7#S #BS T@#gS T?#S T #S T #S T $S T$5S T$aS T $S T9$S $S T0$S T %S B%3S %KS kT_-N (F'-'-'-'-$---?. T%.!9?.&*..2.2m &S 9S &qST&ST&ST&ST&ST' ST~'!S7'9S4I'XS m'oS09'S X'S9'S m'S09'S m(S0m()S0 4IS |pX(ST81.(STU00S(ST(SU0 )S.<)%TU PH@80'.<)TU .<)TU .<*TU *4ST *LS *~S{i*S H*STU  $ &3$"@8!+S2T1B+:S7+RS4I+qS 1.+STU01.+STU0 ,S T U  ,S1.,LSTU1,iSU07,S4I,S ,S 7,S4I-S U V 7-(S4I-GS  4IS ` -@&i A}-"A1 .-1)d2( 3( 4( &i6&len6 "6B. "E .-"E @&jHa b/E(fd 9/E(elen C /.STTU.S $ &/#STU S T Ac /Dfd+8/E+'eElen 3 0S(fd(A/E0eofs$i M01S"TU4 STU2d1.(fd(A/ECB0Ei 0S0STU21SU S 3{34{&{A/E|fd~erru8 ebuf34@71S2S T U 2*S2GST02jST@U23D2ST2S T 2S2S T 3S S T W3D:3h4-(fdhh4/E3ST U23STU@M3ST U<94S  mS0fa 4DDpa14D{gUp4(msgU)e apW J4TSU894S: mSh ~5+ ++ 9F/JT5 /[ /e /q/}/5wSSTTU S TF{9        ***{9o'       $24$M7F 4 437(S0 S0T0V04g 7 4 437S0 STV0PH@8X7T80'p8@SU08ST{H8STU@89ST!9$S2T1  S T U I|444I~H} : ; 9 I8 IH} !I: ; 9 I : ; 9 I 8 :!; 9!I!8 1B H} 4:!;9 IB  : ; 9 (  : ; 9 I8 .?: ; 9 'I<$ > .?: ; 9 '<4: ; 9 I?<41BI!I/ :!;9 I<.?: ;9 'I<:!;9 IB:!; 9 IB.?: ; 9 '<1RBUX!YW 4:!; 9 IB&I !.?: ;9 '<"4:!;9 I# U$ U%4:!;9 IB&4:!;9 I'1(:!; 9 IB)( *41+: ; 9 I, :! ; 9 I-:!;9 I. :!;9 I8 /: ; 9 I 04:!; 9! I14:!;9 I21RBX!YW 3.?:!; 9 'I@z4.?<n:!5;!57I6> !I: ; 9 7 !!: ; 9!8 :!; 9 I89>! !I: ; 9!:.?: ;9 n'I<;.?: ; 9 'I<<.?: ;9 '<=.?:!;9!'@z>4:!;9 I? 1@ A.:!;9 'I !B C4:!; 9 IBD:!; 9 IE4:!; 9 IF.1@zG% H II$ > J K: ; 9 L : ; 9 M : ; 9 N&OGIP : ;9 Q4: ;9 I?<R5IS  : ; 9 T : ; 9 I 8UI V : ; 9 I 8 W!X4G: ; 9 Y.?: ; 9 '<Z.?: ;9 '<[.?: ; 9 n'I<\ ].?: ;9 'I ^ 1U_1UX YW `.: ;9 ' a.: ;9 ' b.: ; 9 'I@zc.?: ; 9 'I d.?: ; 9 '@ze4: ; 9 If.: ; 9 ' g.: ; 9 '@zh.: ; 9 'I 66S67S66T67T66U67U66V67V66W67W66X67X66Y67Y66Z67Z66S S n S nS!n!"S")n))S)-n-.S./n//S//n 0000!"0"#0#$0%%0)*0./0//0SoS--SSU,-S--USj,.j//jSlS,-l 0kc0ShYhc0Sc0Shh S !c!#h#$c$$h$$S$%c%*h++S+,c,,h,,c,.c..0./h//c//k//hSkkS!k!+k+,0,/kSkkYhkhkh#$k$%h%%k..k 0000#$0$%i%%0..0 j jj!#j#*j,,j,,j./j//j 0000e!"e"#e#$0$$e$%e%%0)*e..0..e./0//0 0000#$0$%d%%0..0./0//0 0000#$0$%f%%0..0./0//000Sii..iSSTmmSb!b*,b//b``**`0S`*,0//`S e**S*,e//e j l !*,0S!f**S*,f//S 0+,0 o~S0 o~Sno))0))o))&&S,,S,,S1m""""m$$..mSS!!S""S""S"#S$$S..S11!"1"#1$$1)*1..1!!0!"o""""o"#= S m S m S m T T U l U l U l S s o S o S n S nS h S ST i T TU l U U 3$  3$  3$  m 3$  n  n n SmSmTnTnoppSnSnSTlTlTUmUmUSkSkkokoSSSSnoopSnSnpToTo8S8GTGpS(q#8(GUGp8 S S T T U o U o S00S01h11S15h55S56h00T01i11T15i55T56i00U01k11U15k55U56k00V01j11V15j55V56j00W01m11W15m55W56m00X01l11X15l55X56l00Y00o00Z01n11Z14n45Z56n14n44Z56n14l56l14m56m14j56j14k56k14i56i14h56h24f55S56f22S24g55S55f56g44S44o23044o44n, ,,..%%%%%),,))&&,,!*,//!*,// !+,!#$$)*..-.//14554444 runtimeruntime/caml/usr/lib/gcc/powerpc64-linux-gnu/13/include/usr/include/powerpc64-linux-gnu/bits/usr/include/powerpc64-linux-gnu/bits/types/usr/includestartup_byt.cinterp.hstddef.hstdarg.htypes.hstruct_FILE.hFILE.hstdio.hstdint-intn.h__sigset_t.hthread-shared-types.hstruct_mutex.hpthreadtypes.hstdint-uintn.hstdint.hconfig.hmisc.hmlvalues.hdomain_state.hdomain_state.tblfiber.hminor_gc.hmemory.hfail.hexec.hsetjmp.hstruct___jmp_buf_tag.hsys.hplatform.hdebugger.hdynlink.hsetjmp.hfix_code.hio.hprims.hstartup_aux.hstdatomic.hstartup.hintext.hosdeps.hstring.hsignals.hprintexc.hbacktrace.hruntime_events.hgc_ctrl.hcustom.hcodefrag.hstdlib.hunistd.herrno.hfcntl.h 1+11+?1/K f=!=.0X0+/- !#K$ Y/J zJ= wX  J  /-! ==K! -! K.C = !&X hf.= .= #(="/YP "/YX y"/$!!/-!=X3J * ?$!+  +X/+;/ !2: !! 2,+"/Y<. <. W X !/. / ! <0 / !< .z & . 9lY!0<,  v.! <v =! 0<.J <}19# 0.,< < L " "J?.<+s!"+#6Y !#> t 0 v / w /110 .{ ."0z <. <0 {K!"=/0Y;! (x<( !/.0={ 0 {Y0 K.!./=>/ /  L05K  z.  z  .. <  .. t=J}fZ(. f0">" !/!=Z ( !   ~ <J$DX> ! ! /-!   !  !$ . <, ot ! /-!   !  "    s  #f .=% !2 !/  !#/  /1 (<. ..<ZJK-!J4;J K>KA  J<z & /  5 /===M1 K 1=) M) #' #/ }  =  . ~< . <  -!= <% ",%."0<~J < ~ . J<.,~.X .tw J0< =! !.;.J J<0///[10/!%M+#+-2 .00y <. <0/-!!/30XMZ00LK y  y  .. J/>J WJ <Rt)X ?#  .xX - !=<<% ",%."08 requested_minor_gcuintnatprint_configgc_regs_bucketsallocated_words_resumedCODE_UNLOADEDcodeparamsstack_cache_shortbufnameDEBUG_INFO_ADDEDbase_IO_lock_tstrlenstderrcapacitystrncmp_IO_buf_endshared_libs__off_tcaml_mainyoung_triggermemory_order_acquireflagscaml_interpreteminor_tablescontentsBREAKPOINTtables_IO_write_endunsigned intcaml_global_datanextSTANDARDstat_blocks_markednum_sections_freeres_listmemory_order_acq_rel_flagsmarking_donehandle_value__int32_tshared_heapparse_command_linecaml_minor_tablesephe_refCODE_LOADED_markersmemory_order_relaxedyoung_endopen64fputccaml_attempt_openfreeprev__builtin_memcpycaml_code_sizessize_tallocated_wordscaml_init_localecaml_locate_standard_librarycaml_extern_stateold_exe_namevfprintfcaml_init_os_paramscaml_decompose_pathcaml_executable_name__pthread_internal_listget_stdlib_locationsectionuint32_tmajor_slice_epochEMBEDDEDstdlibbacktrace_pos__countruntime/startup_byt.ccaml_runtime_events_initcaml_load_codemutexbacktrace_enabledmemory_order_releasemalloccaml_bytecode_interpreterrefcounthandle_effectgc_policyexe_namecaml_init_codefragcaml_startup_auxlong long unsigned intcaml_final_infocaml_close_channelcaml_atomsweeping_doneold_proc_self_exebacktrace_bufferdependent_sizecaml_ephe_infomark_stack__owner_offsetcaml_sys_initcaml_read_section_descriptors__elisioncaml_debugger_in_usecaml_seek_optional_sectioncaml_runtime_standard_library_defaultvalue_filenoatomic_uintnatimage_standard_library_defaultbuff__gnuc_va_listputsdata_sizecds_fileextra_params_areaint64_tdo_print_helpaction_pendingcaml_secure_getenvcaml_init_debug_infotofreedouble_IO_read_base_Boolminor_heap_wszPROGRAM_STARText_tabledo_print_configsearch_path_size_IO_save_endstat_major_wordsNO_FDScaml_ext_table_initprintfcaml_init_custom_operations__atomic_store_tmpPROGRAM_EXITbacktrace_activedependent_allocatedcaml_standard_library_defaultcaml_ext_table_add__jmpbufcaml_failed_assertntablesargvcompare_unorderedUNCAUGHT_EXC__nexterrorcaml_terminate_signalsswept_wordsinside_stw_handlertrap_sp_offstack_handlercaml_build_primitive_table_builtincustomchancharcaml_byte_program_modecaml_gc_message_modereservetoc_sizeexn_bucketcaml_stat_alloc_IO_markerclose__errno_locationallocated_words_directcaml_init_code_fragments_IO_read_ptrexitdatacaml_custom_tableBAD_BYTECODElseekcaml_custom_eltlimit__prev__builtin_putscaml_stat_strduplockedcaml_input_value_from_blockcaml_init_gc_IO_wide_datayoung_startexception_ptrva_list_IO_write_basegc_regslong long intcaml_debuggerfile_offsetlong double_IO_save_baseallocated_words_suspendedslice_targetinit_max_stack_wszcaml_parse_ld_confslice_budgethandle_exnexn_handlercaml_stat_blockopcode_tcaml_fatal_errorprint_magicsection_descriptortrace_levelargv0_freeres_bufcaml_heap_state_IO_backup_basecaml_runtime_standard_library_effective__kindoo_next_id_localshared_lib_pathtag_tcaml_names_of_builtin_cprim__pad5long unsigned intasize_tsigjmp_bufstat_promoted_wordssection_table_sizecode_size_vtable_offsetinit_percent_freeorunGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslseek64parsed__isoc99_sscanf__int64_tunique_idshort unsigned int__pthread_list_tread_sectionintptr_tmagicreq_primssize_tchannelcurrent_stackcaml_open_descriptor_inmemprof_domain_scaml_modify_generational_global_rootcaml_init_signalslongjmp_buffersection_tablec_stack_link_IO_read_endchar_osrequested_major_sliceparentmemprof_young_triggershort intrequested_global_major_slicememprofinit_custom_major_ratiolong intnitemscaml_ephe_ref_eltcurrpoolingcaml_paramsoffsettrap_barrier_offopenverify_heapcaml_parse_ocamlrunparamcaml_input_valephe_infocaml_ephe_ref_tablehandlercaml_init_section_tabledls_root__sigset_tblockcaml_startup_code__ssize_tcaml_verb_gcmemory_order_consumecaml_stat_create_poolextra_heap_resources_minor__datainit_custom_minor_ratio__mask_was_savedmemory_order_seq_cstcleanup_on_exitstack_IO_buf_basecaml_domain_stateevent_trace__saved_maskcaml_fatal_uncaught_exceptioncaml_intern_state__nusers_wide_dataexec_trailercaml_search_exe_in_pathstat_minor_words_lockcaml_debugger_initprogextra_params_IO_codecvtTRAP_BARRIERcaml_gc_policy_old_offsetmax_domains_IO_FILEcaml_startup_code_exnmagicstrglobal_dataint32_tephemajor_refpthread_mutex_t__lockcaml__roots_blockinit_minor_heap_wsz__int128parser_tracecaml_read_trailerunsigned charrequested_external_interruptprog_size__uint32_textra_heap_resources_IO_write_ptrcode_tyoung_limitsizecurrent_ramp_up_allocated_words_diffc_stacktrap_barrier_block__atomic_store_ptrevent_kindcaml_exception_contextexternal_raiseextern_statelocal_rootscaml_executable_ocamlrunparamsearch_path_codecvtcaml_plat_mutex__listfixup_endianness_trailerthresholdunsetenvyoung_ptrmajor_work_done_between_slices__spinsruntime_warnings__jmp_bufstrcmpdo_open_scriptsigned charstrdupintern_stateoff_tcaml_minor_collectioncaml_statecaml_build_primitive_tablecaml_seek_sectionmemcpycaml_shared_libs_pathfinal_info__builtin_va_list__valcaml_stat_freestr_fdcaml_ext_table_freeuintptr_truntime_events_log_wsizecaml_start_codemlsize_t__int128 unsignedsscanfFILE_NOT_FOUND__align_chainintnatstat_forced_major_collectionstrailFILEstack_info_flags2cache_bucket/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__builtin_fputccaml_stat_string__sizeAPPENDED_cur_columnproc_self_exereadWRONG_MAGICbacktrace_last_exninit_custom_minor_max_bsz__off64_tcaml_load_main_debug_info_unused2EVENT_COUNT__jmp_buf_tag__pthread_mutex_scaml_ref_tablebacktrace_slotGCC: (Debian 13.2.0-18) 13.2.0zRxA pB ADA~(8D AEA~c EAC <dC ACEA~f HAC fHA0C ACCA~V FAA HCE AAABACADA~ZAAAAAAAA CA T$C AEA~DQAEAAA~AGAAA~$|TB ACA~D CAA xG AEA~FI EAAFA A AAA A A A AAAA AAAAAAAAAAAEAAFC t AAAAH nDEUAAKABAAdAAAyX_AAAAImIC ABAAB B AAAAF B ABAAB AABAAVB AAAAJ BABAAKBHAACAA` C ADDDDA~P KAB A A A j AAAKAA CA~E BAA Ap x % 1   >ENTYksx0H$`?TQ]s$5EZd}3@Yku-@Nh~-@GSgz0startup_byt.cread_sectionmagicstrprint_magicprint_configstderrvfprintffputcexitcaml_read_trailerlseek64readstrncmpputscaml_attempt_opencaml_stat_strdupcaml_gc_messagecaml_stat_freeopen64__errno_locationclosecaml_read_section_descriptorscaml_stat_alloccaml_fatal_errorcaml_seek_optional_sectioncaml_seek_sectioncaml_paramscaml_shared_libs_pathcaml_byte_program_modecaml_names_of_builtin_cprimcaml_verb_gccaml_runtime_standard_library_defaultcaml_executable_ocamlrunparamcaml_standard_library_defaultcaml_code_sizecaml_global_datacaml_start_codecaml_debugger_in_usecaml_maincaml_parse_ocamlrunparamcaml_startup_auxcaml_executable_namecaml_ext_table_initcaml_locate_standard_librarycaml_statecaml_init_codefragcaml_init_localecaml_init_custom_operationscaml_init_os_paramscaml_init_gccaml_runtime_events_initcaml_init_signalscaml_atomcaml_bytecode_interpretercaml_debugger_initcaml_load_codecaml_init_debug_infocaml_build_primitive_tablecaml_open_descriptor_incaml_input_valcaml_modify_generational_global_rootcaml_close_channelcaml_sys_initcaml_load_main_debug_infocaml_minor_collectioncaml_debuggercaml_terminate_signalscaml_secure_getenv__isoc99_sscanfcaml_search_exe_in_pathunsetenvstrcmpstrlenmallocmemcpycaml_ext_table_freecaml_stat_create_poolcaml_ext_table_addcaml_failed_assertcaml_decompose_pathcaml_parse_ld_confcaml_fatal_uncaught_exceptioncaml_startup_code_exncaml_init_code_fragmentscaml_build_primitive_table_builtincaml_input_value_from_blockcaml_init_section_tablecaml_startup_codecaml_runtime_standard_library_effective 2@@ P \   2 0 2 20 02@202 0  D P  20! " #  @ 2000! $ % 2H0H! % 2` 0` ! '   20(   0) L' d 20( ) &2.00( V2Z@8 9 : 2@; 2@< & 2@@@28@8< 2@" 20 x2H@H=Z> =X? =C@ A $B ,C F2PJ0PPD \E tF |G ) 2P@PH I 2X0X x2`0` x2h0h  x J " .2 0" >0 H) XK dL r2X v@X xM N " O P Q R 2` @` E F S r2 v0 |T 2 0 U  % 2 0 ! P ^2 b0 d V  V  *2 20 < x T8 W 2P 2 0P 2 2 "2 &2 .0 20 60 :0 >0 XX pX X X X X 2 0Y B2 F@  &2X*0X, 4Z TZ d[ \ " " " " ] ^  _  _ & ( x<; l` ` ` _ 2(@( $ 22 60 >2B0D l` z20~@02 280 08a " 208V L 28@8< 2202p0p@b  20b "2&0(T 8 B2`F0`N2R0Tb ^2f0hb r2z0|b 2200b 22(00(b 282@080@b 2h0hb 20b 2200b 20b "2&0( 22:0<b F2J2N0R0Tb ^2(b0(d n2@r0@tT c 2@d 2X0X b 20   20 ( 22608 D T[ h" t" " " ] ^  _ &  x; 20T 2@&260D( d r2v0x ~2p0p( 2h@h=C=CR e ( 2262:0>0F2J0L R2^0l r2hv0hx  2H0H 2 280 08a 2`0` L8 V2Z@x9 > ? @ A 2@; B C : *28.@8:=Z>=XD=CH< R2V@lD xE F G 2`@`2P@Pg I h i 2X@XM O P Q  j 0R DE \F hS V 2 280 08a  f 22h6@hN=ZR=XT=Cd=CR e 2 280 08a &+&,&-& &\(.&0/&80&@1&H2&P3&X4&`5&h6&&3&p 30&83H&PP3`&h3x&3&3&P3&3&3  &*/ = B$OZfBm Gt^{2w 3 j8(5 CBOP\uiv  >|zS dv'O,9F hS `m{ R  ;R Z$]9WejZw . ZG  "-C8tTw | x G%JE-:G5ZgskC  K  !\)7 E Ssaoj}( R(< : 8 R%r3ANOS]ky ~ MP# =+7CO[g s AE 3!^q  2  'j 3E E ^ - kq x   + o    )  )< 3 @| M Z gI z-   u     N    n  C ' B O \ i          ! /] < V p }         - B IL N Z2 v   9      >^"!(.24P;X (e} dck3 v .H U|bo[| _| GB#  V-:G sTan!{ _Ze r"2)8>JDKWc xl& 7& &&y  QA4Kl 13M;" h9XAIWj| D y-  (1 9ATIQYu:> "^* #CY9qE}+ &  # )f 8 Nn wm  &^  Z#&'", |7<;8@8KRONT_hcdh Gs~wz| &0&&&&8#& 5&|^ Z |8 G |_&P0 ;?^mbWgw  >6|[_ b"c&S+c6:? VJNS^bgrv{cW=& && $& <& I& e& o& &p&}  D :ph"x-16HLQ&ti&&&<&\&l&&&,&D&Q&n&{&&&&&&,&D.&F&\^&pv&|&&&&&&&&&D&^& \l& @&&&&8& &    $ ( 1 5 : C G L& l&X v&X     &d &| & 8 "  !&! $!0!.!"!'<!+:!0& L!N&L!_&!u& !2!F!D!P!N!& !& !&!M!g"^" X"&"&"6& "@r"Lr"U}"Yw"^&0"s&"}&"&"&"&p"&"& "& "&"&@"&\#&#&p#3&#C&#X&#h&#}&#&#&#&(#&#&#&@#&8#&$&h$&$&&$6& $K&$X&$b& $w&$&0$&$&D$&$&\$&$&$&l% &(%&|%*&@%4&%L&%e%%%%%% &% %&% g% _%& %&x& &  &&0& &0&8&@&I&&T& `&r& x&& && && && ' &'"& ':&0'O&X'Y&,'p&L'&'&t'&'&'&'&$'&'&0(&L(*&|(;&h(G&(T&(a&(n&(&@(&(&(&)&)&)&&)3&)@&)M&$)Z&,)g&4)t&X)&)&)&)&)&X)&)&`)& * &h*& *5& (*M& 8*Z& `*g& l*& *& *& *& *& *& *& +& +#& +;& X+S& h+h&+r& +& +& +& +&+&8+& ,&,&@,*&P,M&,j&l,&|,&,&,&p,&0,&P,&,&-&-&-)&->&H-H&-Y&`-i-r--- - V--- ..p.3e.= k.H&.h .l .q.{ . .. . . -. #. |. [. S.&4.&T/&l/$&/5&/K/f/r//&/ / x// / // / / / / 0 P0 F0 &02&0Te0[&P0{ 0 x00 0 00 0 0&0&0&1&1$&1/s19&1P1Z 1^ 1c1m &1q 1v#1 Z1 P1 1 1 1 1 1 1&1&2&2&2+&2H&$2k&D2&2&02&2&2&2&H2&3&3*&`3E03O&p3o 3s 3x3 =3 53&3&3&3&3&L4&4&X4.4J54Q&4r b4v \4 {4 u4&H4&X4&d44@4m5&5" 5& 5/ 53 5< 5@ 5I 5M 5R&5x&85&5&5 5 595-5v5j55555-5!6b6 ^6}6q60&6:6O6S6\6`6i6m6v6z6 666606,66E6?6e6[666&t6&t677 7 7&7)&7K&D7U7e7i7r7v7{&L7&d7&7&7&7&7&7&8 &8&8$&P8A&t8N&8[&8h&8u&8&8&8&8&8&8&(9 &89%&p92&9?&9P&89]& 9p&T9}&99939 9m9"&P& &&X&<phP(P$.symtab.strtab.shstrtab.rela.text.data.bss.rela.toc.rela.opd.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame @ @*0&,6p1@P@p;@E2`Y%9T@^ e_xf+s@A0 v0@B0wx @BH00"06 X@Bx 8 8XChzstd.bd.o/ 0 0 0 644 4072 ` ELF @@8`N  intW.Z5l{m;nn+$ > : ; 9 I% $ > .?: ; 9 'I@z: ; 9 IBSS,e runtime/usr/includeruntime/camlzstd.cstdint.hconfig.hmlvalues.h  long long int/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-beunsigned int__int128uintptr_tlong unsigned int_Boolcaml_zstd_initializelong long unsigned intunsigned charcharuintnatlong intdoubleintnatruntime/zstd.c__int128 unsignedshort unsigned intsigned charlong doubleintptr_tvalueshort intvunitGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tablesGCC: (Debian 13.2.0-18) 13.2.0zRxA    zstd.ccaml_zstd_initialize&3 ^  &* 1 8 }F M 3T [ b ]i 'p Nw | ? s     H  j  & X &t&.symtab.strtab.shstrtab.text.data.bss.rela.opd.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.rela.debug_line.debug_str.comment.rela.eh_frame@!T'T1X,@0;p6@G~hUj0e@ 0 ~4y@  00 (@ h ` instrtrace.bd.o/0 0 0 644 51240 ` ELF@@|a|#y|3x|x!AALpi@D|;@A||*|#(@@p|P<|3x|t8H`H0```sA<<tx8H`8!a|N `?j=,)AH)(9I8|?P@A|%@AAx9% {U*>x( AP=BJy)}*J})R})N 000@```<T>8xH``,A A8!a|N <8xH`K`<8xH`,xAL,@}<?b!s;<;{A,?dxx;H`xH`7{;AYxi }*J.q)@@x8`?H`K``<8xH`KH`?<8x|HP|tH`K``,)ApB=Kt|=")!(|P|t@;p<<x888H`;p<xx88H`?j?,)AB@99 =@})@6aJ}*P9@ty)y)C@(W@ ?;p<jx}x88U>xH`?,)@`<( 6At= *q9@a)}J6y)e)a)}IH9@= Aa)y)}JH9A< ;p<xx88H`K0)};py$<|x} @*x88H`K``)|;px$<xx|8*88H`K||#x<|x|+x|3xx8|3x!qH`,?A88!xxxx|H`8!|N `|!>A|}x;:{j:|0P|tH`=BJ9  X0})P09) , AH`)(~ijxx)|)@|HP|t@H`~xxxH`,=x%xDxxAH80;;~H09) | @P;,)@<=(....%#lx[%02d] Event at PC:%ld, Def:%s, File: %s, Line: %d, Chars:%d-%d ???%6ld %s%s %d %s %d, %d %s %d, unknown primitive %d %s %d, %s %s unknown primitive %d %s %s %s ntag=%lu nint=%lu %s [%02d] %saccu= sp=%#lx @%ld: [%ld] ACC0ACC1ACC2ACC3ACC4ACC5ACC6ACC7ACCPUSHPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4PUSHACC5PUSHACC6PUSHACC7PUSHACCPOPASSIGNENVACC1ENVACC2ENVACC3ENVACC4ENVACCPUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4PUSHENVACCPUSH_RETADDRAPPLYAPPLY1APPLY2APPLY3APPTERMAPPTERM1APPTERM2APPTERM3RETURNRESTARTGRABCLOSURECLOSURERECOFFSETCLOSUREM3OFFSETCLOSURE0OFFSETCLOSURE3OFFSETCLOSUREPUSHOFFSETCLOSUREM3PUSHOFFSETCLOSURE0PUSHOFFSETCLOSURE3PUSHOFFSETCLOSUREGETGLOBALPUSHGETGLOBALGETGLOBALFIELDPUSHGETGLOBALFIELDSETGLOBALATOM0ATOMPUSHATOM0PUSHATOMMAKEBLOCKMAKEBLOCK1MAKEBLOCK2MAKEBLOCK3MAKEFLOATBLOCKGETFIELD0GETFIELD1GETFIELD2GETFIELD3GETFIELDGETFLOATFIELDSETFIELD0SETFIELD1SETFIELD2SETFIELD3SETFIELDSETFLOATFIELDVECTLENGTHGETVECTITEMSETVECTITEMGETBYTESCHARSETBYTESCHARBRANCHBRANCHIFBRANCHIFNOTSWITCHBOOLNOTPUSHTRAPPOPTRAPRAISECHECK_SIGNALSC_CALL1C_CALL2C_CALL3C_CALL4C_CALL5C_CALLNCONST0CONST1CONST2CONST3CONSTINTPUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3PUSHCONSTINTNEGINTADDINTSUBINTMULINTDIVINTMODINTANDINTORINTXORINTLSLINTLSRINTASRINTEQNEQLTINTLEINTGTINTGEINTOFFSETINTOFFSETREFISINTGETMETHODBEQBNEQBLTINTBLEINTBGTINTBGEINTULTINTUGEINTBULTINTBUGEINTGETPUBMETGETDYNMETSTOPEVENTBREAKRERAISERAISE_NOTRACEGETSTRINGCHARPERFORMRESUMERESUMETERMREPERFORMTERMFIRST_UNIMPLEMENTED_OPg0 0:  A  T   )1int, 2A1@36 7 8 9 : (; 0< 8= @@ HA PB XDY`F^hHpItJ xMTNgOcQsY [}\]^^ _ .`b3+ TAs:L x A:@$[H$%` / @  uWZ: lE mQ4i  O.%`   XuNA5 [\]^ 29];]<i>iD-EqY 5:?6 " "% ((+0.]82,@61H9P=XA;`CEhFipIixLiPiTi[i`]rit)wiyO{Y}c]]h5]iiii (0r87id@H5PwXw`ihip]x]]iii]i]]9v58+sp0 1 3 :; . < i(id= 90p,uspw x, 6 @ J T ^ m  ~   8 & 22   5! 5" 5# ]9` ACC     POP !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxEQyNEQz{|}~BEQ : &   "%& ( * i(+ i0, i8- i@/ iH0 iP1 iX2 i`3 ih4 ip6 ix7 i8 i9 i: i =(' "0op eq r stu v$w(%e: ' &  ; O#pM 5^ !  z C . ' Y d q < e   '{ e,py 5sp. 9e Gf!!i!p =y    >(STU STUV)y0| ** (USTU STUVXS T1U5VST UqS T U2S:TCJS qS T U?w"vw5+w(e+w6"fwF@#s tg l ,i,i#i<pc<eAbuf>|&?~B@!STU W !ST U VYS UC!CSTU W $ &3$"!uST U VqS T Ur!ST U V! ST U V!=ST U V!oST U V!ST U V !ST U VA:A:.pc.e!evi0JSYiS C qS T U5C)D+A"val85#--i.yP    E)  F["ST@ST STS TST XS T1U4V7T S?TbST VST UST UXS T1U2VS)T0ST UHSsST UST UST US)T aS'T2ST U2&_ST U1&ST  qS T U.yX    -ST UGSSTTUUVV//( I~ : ; 9 I8 H} !I :!; 9!I!8  :!; 9!I!8: ; 9 I 1B I $ >  < H}41B&I : ; 9!I!I/ 4: ; 9 I?<4:!; 9 I( .?: ;9 'I<(:!; 9 IBH} 1U:! ;9 I :! ;9 I8  :!; 9 I8 .?:!; 9 '@z :!;!9 IB!4:!; 9 IB": ; 9 I# $7I%>! !I: ; 9 &4: ; 9 I'.?: ; 9 'I<( 1)1RB X!Y W *1+:!; 9 I, -4:!; 9! I..1@z/.?<n:!;!0% 1$ > 2 3: ; 9 4GI5 : ;9 6  : ; 9 7 : ; 9 I 88: ; 9 I 9> I: ; 9 :4G: ; 9 ;.?: ; 9 'I<<.?: ;9 '<=1RB UX Y W > U?.?: ; 9 ' @ : ; 9 A4: ; 9 IB4: ; 9 IBC.?: ; 9 '@zD.: ; 9 'I E 1F 1GH}TSmSToToUjTjUjViUiViWnSnVnWn0llonijmnVnm S S S#SoS# nnnnx?nnx? S m S m S o S oPSPdodSoSSomSmSm S o S m S o mLTLdkd|T|kTTkTkTkTk T k T T k T k<Uinstruct.h  3k  // /1 JK / 9<< <H  J. ./?N+5   J" # !...h . Jl<.Kw..K '<J YI !-- =I /-- -..     F  ?   Ky< 'y.  .K  1J aX<ut. ./ ;!)/ / ). / u0H. !  < ?t .Kh.3.3/> !1"."  .1 M",1K# 1#/ Yf  " 1 1 / .t",1-K# 1%K=t J !v<tGETFIELD2GETFIELD3GETPUBMETc_stack_linksize_tcaml_stop_hereallocated_words_resumedmark_stackruntime/instrtrace.c_ISgraphmemory_order_acquiredependent_size_IO_codecvtPUSHCONST0PUSHCONST1PUSHCONST2PUSHCONST3int32_tbacktrace_slotephe_infoCLOSURERECmemprof_IO_save_endBRANCHIFBRANCHIFNOThandle_exnORINTextra_heap_resourcesBLTINT_IO_write_baseLSLINTev_start_chrputc_lockXORINTshared_heapcaml_heap_statePUSHATOM_IO_save_baseMAKEBLOCK1MAKEBLOCK2MAKEBLOCK3LSRINTrequested_major_sliceGETGLOBALCONSTINT_chainev_start_lnum_cur_columnslice_targetheader_tev_end_lnumOFFSETREFMAKEFLOATBLOCKstat_promoted_wordscontentscaml_disasm_instrlong intlocal_rootsAPPTERM1APPTERM2APPTERM3trap_barrier_offstat_forced_major_collectionsuintnatcaml_failed_assertRAISE_IO_markerRETURNcaml_intern_statestat_blocks_markedopcode_tBRANCH_ISprintcaml_final_infomemprof_domain_sPUSHOFFSETCLOSUREcompare_unorderedcaml_start_codecaml_minor_tablessigned charev_end_chr_IO_FILEGETBYTESCHARtrap_sp_off_IO_wide_datanames_of_instructionsinit_custom_major_ratiounsigned charGETVECTITEM_freeres_listPUSHGETGLOBALFIELDbacktrace_last_exn__atomic_load_ptrev_end_offsetcaml_statefinal_infoREPERFORMTERMPUSHACC0PUSHACC1PUSHACC2PUSHACC3PUSHACC4PUSHACC5PUSHACC6PUSHACC7_BoolvalueMODINTev_infohandle_valuecaml_gc_policycharinit_minor_heap_wszMAKEBLOCKev_filenamecaml_paramsPUSHENVACCPUSHACCcapacityADDINT_IO_lock_textra_paramsOFFSETCLOSURE0OFFSETCLOSURE3C_CALL3memory_order_acq_relmajor_work_done_between_slicesinit_percent_freeASSIGNprog_IO_read_ptrSETFLOATFIELDGTINTyoung_startinit_custom_minor_max_bszAPPTERMextern_statePUSHGETGLOBAL_markers_ISpunctsweeping_doneinit_custom_minor_ratioprintfPUSHtrace_levelcaml_exception_contextMULINTCONST0CONST1CONST2CONST3_offsetBULTINTev_pcATOM0oo_next_id_localminor_heap_wsz__builtin_fwriteRESUMETERMlong unsigned intPUSH_RETADDRBNEQproglen_flags2dependent_allocated_IO_read_baseslice_budgetaccuAPPLY1APPLY2APPLY3_unused2ATOMuintptr_tGETSTRINGCHARyoung_end_ISxdigitevent_trace_old_offsetexternal_raisec_stackRESTARTsnprintfcds_fileBLEINTgc_regsRESUMEFIRST_UNIMPLEMENTED_OPGNU C17 13.2.0 -msecure-plt -m64 -g -O2 -fno-strict-aliasing -fwrapv -fno-common -fexcess-precision=standard -fasynchronous-unwind-tableslong long intmarking_donecode_ttrap_barrier_blockCLOSURE_ISupperext_tablesection_table_sizeSETVECTITEM__builtin_fputccaml_ephe_infomemory_order_consumecaml_event_tracememory_order_seq_cststack_handler__ctype_b_locdouble_IScntrlstackinit_max_stack_wsz_IO_write_endparentcaml_extern_stateLTINTmemory_order_releaseSTOPswept_wordsRAISE_NOTRACEcaml_trace_value_file_IO_buf_baseunsigned intcaml__roots_blockcaml_icountintptr_tAPPLYgc_regs_bucketsISINTGETGLOBALFIELD__pad5requested_external_interruptUGEINTBOOLNOTcaml_exact_event_for_locationopbufBUGEINTcurrent_ramp_up_allocated_words_diffcleanup_on_exit_flags_modeGRABexe_nameACC0ACC1ACC2ACC3ACC4ACC5ACC6ACC7_codecvtOFFSETINTcaml_prim_name_tableallocated_wordsPUSHENVACC1PUSHENVACC2PUSHENVACC3PUSHENVACC4proc_self_exeyoung_limitlong doubleSETFIELD0SETFIELD1SETFIELD2SETFIELD3FILESUBINTev_defnameruntime_events_log_wsizeruntime_warningsRERAISEunique_id_ISalphaOFFSETCLOSUREM3allocated_words_directaction_pendingbacktrace_possizebacktrace_bufferlong long unsigned intmemory_order_relaxed_ISblank__off_tULTINT_ISalnumhandle_effectmax_domainsSETFIELDPUSHATOM0allocated_words_suspendedGETMETHOD_freeres_buf_ISspaceinside_stw_handlerGEINTANDINTSWITCHcaml_trace_accu_sp_filedisplayfieldsSETBYTESCHAR_IO_backup_base_shortbufPOPTRAPGETFIELDSETGLOBALchar_osPUSHCONSTINTGETDYNMEThandler__off64_tbacktrace_activeDIVINTfputcstat_major_wordsmemprof_young_triggerrequested_minor_gcyoung_triggergc_policy_IO_buf_endsection_tablecaml_string_lengthfprintf_ISlower__atomic_load_tmpcurrent_stackatomic_uintnatshort intPUSHTRAPrequested_global_major_sliceinstructionsEVENTASRINTcache_bucketVECTLENGTHBREAKBGTINT_vtable_offsetextra_params_areaENVACC1ENVACC2ENVACC3ENVACC4exn_handlermagicCHECK_SIGNALSverify_heap__int64_textra_heap_resources_minorPUSHOFFSETCLOSUREM3young_ptr_IO_read_endC_CALL1C_CALL2asize_tC_CALL4C_CALL5dls_rootmlsize_tstack_infostat_minor_wordsC_CALLNinstr_fileno_wide_dataENVACC_ISdigitshort unsigned intstdoutexception_ptr_IO_write_ptrNEGINTintern_statePUSHOFFSETCLOSURE0BGEINTPUSHOFFSETCLOSURE3Hd_val/home/ci-ocaml/builds64/workspace/precheck/flambda/false/label/ocaml-ppc-64-be__int32_tparser_traceint64_tintnatPERFORMLEINTcaml_domain_statestack_cacheminor_tablesfflushbacktrace_enabledprevOFFSETCLOSUREfwritemajor_slice_epochGETFLOATFIELDGETFIELD0GETFIELD1GCC: (Debian 13.2.0-18) 13.2.0zRxA PB ACDA~\ EAB ANAg AAAEAA VaaAAAEADA~Nj`AABHAEABA~ECIB8C ACA~E[ADAAA~(HA~i EAB 8DC ADHA~E JAB AFAHpC A CDO A~h MAB AgnuP  +  AIT}[n|0BH!`7Cxp[ instrtrace.ccaml_trace_value_file.part.0names_of_instructionsfprintfcaml_statefwritecaml_string_length__ctype_b_locfputccaml_failed_assertcaml_stop_herecaml_start_codestdoutcaml_event_tracecaml_exact_event_for_locationfflushcaml_prim_name_tablecaml_disasm_instrsnprintfcaml_trace_value_filecaml_paramscaml_trace_accu_sp_filecaml_icountJ2V0X z20 ZXC2@b2n0t 20 20 20, X x 202 0   F2N0` x 2x0x     "2*00 F2`N0`\ r20  2P0P  2 280 "08$ x" ZXC2@20# 2@$ 2 280 "08$ R2V@~2P2X0P0X' 20' ZXC20# 2@$ & 2* 062XB0XL' ZX2C0' 2 280 08 ^2b@v20' 2@20' 2h 0h ' n2p ~0p ' 2 0 ' 2 0 ' *2 >0 L  2 2 0 &0 ( < \ bZ fX hC ~2 0 2 C 0  2 @   8 f2 j28 r0 v08 x  $ 2 28 0 08  &0& &%& )&&3&P 30&`83H&@P3`& h3x& 3&(&0&8&@ &H(&P0&X8&`@&hH&pP&xX&`&h&p&x&&&&&&&&& &(&0&8&H&X&h&x&&&&& &(&0&8&@&H&P&X&`&h& p&0x&@&P&`&x&&&&&&&&& &(&8&H&X&h&x&& &(&0&8&@&H&P&X&`&(h&8p&Hx&X&h&x&&&&&&&&&&&&&& &(&0&8&@ &H(&P0&X8&`@&pH&P&X&`&h&p&x&&&&&&&&&&& &(&0&8&@&H&P&`&p&x& &(&0&8&@&H&P&X&`&h&p&x&& & & & & (& 8& @& H& X& h  d &*/+=DbPQWc jqvX  Pa a" /k<IVcp}h_/GD pk % D& 3A MU%y  $I2ly   ? " S) .:oF R'^wj}     +  q *S61BHN5Z\f nwV q?S Tz  "-Y8 aCN CY =doAz  a c v` "@. K:bFqRl x,E;Iv I,;8 DP u\kh t*>" q H7AYK U _unz 8 v7  F4  o    ) / 5 ;  A  G M  S  _ e k q w }   "  D h p x  {  S  _  k  w            0  % + 1 7 - = C I O U [ a g m s 5 yy  Z "   {    g            ] / _    !e ' -( 3[ 9 o ? E K Q W ] c i o$ uZ {( / 6 =          !  7 T ?  p     k N " $ (] . / 4 @ FZ L R@ X ^ d h jL p v |   :    1 ~     # &  .    "w / < Ib V c p }2 g 9  }  N     S  ->9TFS `!mwzQ+N *"DZr  wb&  3+K_S (,9==;F& 0OL_GcElQpOy[}YecL& D& `& &  sm$(2& V& <}& 0&& && & &8& & 3& K& \&8i& z Kz&@'+@ Pb[_d&&X&P&&&&&&T!&X8 &D&f&v&&8& &&&& & .&h>& `&pp& && & &`ZR*.z3&K&`&j&w&,&8& 2&P&%})U2 6?\C>L&Y fjs$wy&&&&&4#&`A&`1mqv&&&&<-#&&&8&|S&c&~&&&&&& &h!&1&I&d&xt&8&&d&`&&&`&3&N&`&{&P&,&8& & pd'& T&.& Y]bf  &&&`P`@H  .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.8.rela.toc.rela.opd.tbss.rela.data.rel.ro.local.rela.debug_info.debug_abbrev.debug_loclists.rela.debug_aranges.debug_rnglists.rela.debug_line.debug_str.comment.rela.eh_frame.gnu.attributes @ 0@gx8& p, p12 p E(@@wxOJ@x( T_Z@yHp wxkr@6 8 =XD[0@0D\D@00L0_ `@oaa  fg